EMLSAG00000008211, EMLSAG00000008211-690977 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000008211
Unique NameEMLSAG00000008211-690977
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000008211 vs. GO
Match: - (symbol:dp "dumpy" species:7227 "Drosophila melanogaster" [GO:0007475 "apposition of dorsal and ventral imaginal disc-derived wing surfaces" evidence=IMP] [GO:0005578 "proteinaceous extracellular matrix" evidence=NAS] [GO:0007424 "open tracheal system development" evidence=IMP] [GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA] [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0008362 "chitin-based embryonic cuticle biosynthetic process" evidence=IMP] [GO:0040005 "chitin-based cuticle attachment to epithelium" evidence=IMP] [GO:0031012 "extracellular matrix" evidence=ISM] [GO:0005201 "extracellular matrix structural constituent" evidence=ISM] [GO:0046331 "lateral inhibition" evidence=IMP] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR003651 InterPro:IPR018097 Pfam:PF07645 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 SMART:SM00525 InterPro:IPR000152 EMBL:AE014134 GO:GO:0005509 GO:GO:0008362 GO:GO:0051539 InterPro:IPR013032 PROSITE:PS01186 GO:GO:0046331 GO:GO:0031012 InterPro:IPR003645 SMART:SM00274 PROSITE:PS00010 GO:GO:0007475 InterPro:IPR009030 SUPFAM:SSF57184 GO:GO:0007424 InterPro:IPR026823 Pfam:PF12662 GO:GO:0005201 InterPro:IPR001507 SMART:SM00241 PROSITE:PS51034 Gene3D:2.40.155.10 InterPro:IPR023413 InterPro:IPR006150 SMART:SM00289 UniGene:Dm.20530 GeneID:318824 KEGG:dme:Dmel_CG33196 FlyBase:FBgn0053196 GO:GO:0040005 RefSeq:NP_001260032.1 PDB:1OIG PDBsum:1OIG OMA:PTTRPFE Uniprot:M9PB30)

HSP 1 Score: 2928.66 bits (7591), Expect = 0.000e+0
Identity = 3195/11189 (28.55%), Postives = 4400/11189 (39.32%), Query Frame = 0
Query:   18 CQSDDECDSNQACR--NRVCVNPCTNSNPCGVLAECSVR-NHRTTCVCTIGFTGDAYSNCSPINEDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILK-------------------------------------------PECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVGGTCLNSCRVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDC---------RPQP-----------------------------------EPECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVC---EEPG----------------------------------------------CRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPYSYCNAYECLSDPECPDHLHCISEKCVDPC---KCAANAECDARNHRGYCACIIDFTGDPYGIECTPIPEPVIEEVECVEDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGK---GDERCVKIEPII------------------------DVG-----------CRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCT----FNKPCSDSQECKVFDTSPTKT----VACI---------CPTD----TVVGIDGRCNRVQT-----------------SPECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECY---FVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRP----HPECPDRLKCENEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPY---------------------------------GIACEPIPE----PVIE-EVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKI-------EPVVD------------------------------VG--------CRSNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCECSPGFTGDPYSLCSPTRED------------------------------------------------ECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCF-----------------------------------------------KYECQKNEDCPFDKSCSSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYVACKEVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINPCAESSPCASSARCKVINHEPECTCPDGFIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPV------------------------VD-----------VG--------CRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKISNSECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSFECKKNEDCPFDKECKSESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPC----------------------------------IVE-----------SPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNCQPPERPECRVDAECPLDRACIHQKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXENHRAICHCLSGHKGQAYVNCK--RYECLRDSDCPNHLHCVNDKCVDPCE--CARNADCKARNHRGYCTCIPNFTGDPYGIVCEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTH------------------------------------------------ECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYCYKYE---------------------------------------------CKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCRE--------VECRNDNDCASNEKCD-------------------------LRYLKCSAL-------CSD--NNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEI-------VRRPDE-------------------------------------PECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGF-----------------------ECKEVELST------------------ECQVNNDCQQFEICVDGTCRKTCSINSCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQ-PVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPC--ECARNADCDARNHRGICTCILDFTGDPYGI-ACEP--IPEPVIE--------------------------------------EVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCY----------------------------------------------RYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRD-----NEKCDMTTYK---------------CTPLCTGSNKCASK-------------------ATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHV-------EPSL------------------------------EPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNC----RPPK----------------------------------------KPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYT--FCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAEC-NANGHRAICSCLQGHKGDPYSFCKPYECLSDPECPNHLKCKNEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPYG----------------IACEPIP--------------------EPVIE-EVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKY----------------------------------------------ECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTI---------------------------GLNYNCQRVES-----------------RPECEKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPC--ACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETS--------------------------------------------TKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCY-----------------------------------------------KYECVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPY-----------------------IMCKEV---------------------ECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFC---------DKKIASVD-----------------------------------TAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQ-------ITIQTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQ------LPQ-----------------------------------KPECTKDSECANHLACIQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDP-YVKCRSYECLVDSDCPRHLACENEKCVDPCK--CAKYADCKVTNHQGYCTCNSYYTGDPYGLACEPIPEPIEVECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQK--CSVSNSLP----LRSITCE-------------------------CPSNEIISENGICE---------KIQIKTECKVDTDCARSDMCKDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQ-------------------------------------EASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPCK---CARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQC-VKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNFECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRE--NSCTKSAICEATRHTEICTCPTPFIGDGKSFC----------MEIVKP--PS---------------------------SPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTDRDCPDSDVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLSPKPECIVDQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGDPYTFCRPYECLVDRDCPDQLKCDHEKCVDPCQ---CAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVV---------------------------------VG--------CTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHSYECLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLDCHNDNDCKDDEKCDRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCELPSEPECLVDDDCPSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEEPGCKSDIECPFDKACISRECQNPCLYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPCQCAKYAECDARNHRGI---FPEPV--EVEGCQ----MDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPI----------------------------------VVG--------CSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSIC-----VIIEDH--------------------------------------------ECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEY---------------------------------------------ECLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLVVDSSPSKSVSCSCREGFYV----------------------------GKNGDCIEVDGQ-----------------PECRSHSDCRYNEQCQSGSCLDACRIRLCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECKPPTPLSIGCSADSDCPVVEACLNTKCVDPC--NCGENALCRKINHKAVCFCPSGFSGNPEVLCEKLECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGW--IPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPC--NCGGGAKCFLSGHRPICQCPEGFIGNPQIECNPAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIP-------------------------------------------PPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCINAICRSPCACGLNADCKIIDHQPVCTCKPGFYGDPEIECTDTVCQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNIVSCSDNSDCPTDKECINKLCTDSCSIS----NPCGSKSECKVKNHKVDCSCALGFIGNKGTSCVKVSVTCEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECFPVKTCPANSGLILDNREECVCPTGFGFTENKDECIPCLKENGFILNNEGKCVCNDARGYEYNPDSGKCECPPGERLNNFGICERVPDCEEDPDCPTQKYCEKTNGTCSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGC--IPVIIPPVKTDFPRPEMVVNCLSDGVLV 9504
            C+S    D+ Q CR  +R   +P    NPCG  A C V  + +T CVC  G +GD  S     +  EC+ D+DCP + ACM ++C DPC     CG  A C+ + H PVC C  GL G+P   CY  +    N               PC  + CG N++C +  + A+C C  G  G P   C+  EC  N DC D   C   N KC + C +  +C  +AIC   +H   C+C     GD +  C    + ILK                                           PEC  +SDCP   AC+ ++C +PC  +  C     C V +  P     C CP     +   +C+  +S  E      C               ++H CG NA+C        C C +GY G+P   C+           P C  N DCP   +C N  C+  C     C + A CRV+NH PVC C  GY G  +  C         RP P                                   +PEC + S+C+ + AC+ Q+C  PC    CG  A+C V NH  ICSC + + GDP+  C   ++PG                                              C    ECP  + CIN +CQNPC    CG NA C+   H A C C++ ++G+ +  C + +    P   DH        +DPC    CA NA C   N+   C CI  + GDPY   C P         EC+   +C S  ACI + C +PCT    C  NA C V + LP    +C C  G+ G    G +R V + P                           VG           C    EC  +L+C NQKC++PC    TCGF+A+C V NH   C+C   + G+ + +C+                K     +  DPC     CG+N+IC   N+RA C C PG    +  NC   EC+ N DCP ++AC+ ++C +PC   +CG  A CS + H+P C C +  +G PY  CK  E              ++ L         + C A+A+C   N    C C     GD Y +C        +PEC  + DCP   AC++ KC+DPC     FN  C  +    V    P  T     AC+          P D    +  G+   C+ V                    PEC  + +C     C++  C D C    CG NA C+  +H   CSC +GYTG+P H+C       P ++P++ P                    NPC   SPC P + CQV +   VC+C   YIG P   CRP    + ECP R+ C N +C DPC   C  NA C    H  +C C P ++GDP+                                   AC+ +PE    P +E   EC  + DCP   AC+N++C +PC     C  NA C V++  P     C C+ G+TG     C  +       +P+V                               +G        C S+SEC ++ +C N +C +PC     C ++A+CR  NH P C CSPGF+GDP+  C P  +                                                 EC  D +CP N+ C + +C +PC     CG    C V NH P+C+C++ +AGDP S C                                                + EC  N DC  +++C +N C DPC   VCG +AEC V  H   C CPSG  G+P   C+E+                 R          + C   ++C        C C + Y G           PA + EC+V  +C    +C++Q C +PC     C     CKV +  P     C CP     + F  C   +   E   +N+             N C   PCG N++C     + VCSC   F G              P   P C  N +CP++ AC + +C +PC  S  C  +A C V+NH P CTC  G+ G         DP++ C P      P  PD    E      P  C  NA+C  RN  G CTC+P++ GDPY   C P         EC  + DC    +C+N++C +PC     C  NA+C+V + LP    +C+C+ G+TG     C +I  +                        VD           +G        C  +S+C+  L C+N +C++PC     C   A+CQV+NH   C C  G+TGDP+++C KI       +    S   CI            PCG +++C  +R    C C     G P  +C   EC  + DCP +  C ++ C +PCI   CG  + CTV  H+  C+C  GY G+P+  C  VQ     D +++  CN               C  +A+C+  N    C+C     GD YS C        +PEC+ + D  RS ACI++ C++PC                                  ++E           SPC P   C    S+ +    C CLEG  +G    C     + EC + ++C Q+  C    C + C    CG NA+C    H   C+C PG  GDP + C       EP                M + +   NPC   SPC   ++C+ I ++  C+C  G+IG P T      RPEC  + EC    +C  ++C +PC   +CG NA C+V  H A+C+C  GY G+P   C+L    +  E P+                 CG   EC+  N    C+C  G +G  Y   +  R EC  + DC     C   KCVDPC   C   A C    H   C C P +TGDP+   C+P+P  V            P  N C      NP     PC  N+ C+  +        C+C  GF        +   P  +  C   +EC  +  C    C++PC   + C   A C+ ++H  +C+CP    GDP+  C ++                                                   EC  +++C  T+ACI  +C++PCS +  CG  A C   NH  +C C  G+ GDP   C K E                                             C    DCP DKAC + +C+DPC    CG  A C    H   C C +G +G+P+V+CR         +E  + + C SN +C                          +   +CSAL       C D     C   A+CE INH   C CP   TGD +  C  +       V+ P +                                     PEC ++ DC S  ACI+ +C NPC   + C  N  C+V  +     VSC CP+G Y  + F                       EC E   +                   EC +++DC   + C+   C+  C    CG NA C  V H   C C DGYTGDP ++C +  V    P+ +P                        I SPC  ++ C+  N  AVC+C++ F+G P  +C+P    EC ++AECP + AC   +C NPC+  TCG NA+C V  H  IC+C     G P   C   P                  K+     PC + +PCG +++C+V+  +A+C C   + G P  NC P    EC  +TDCS ++ACI  +C DPC  +  CG ++EC   NH + C C     GDP   C+++    +   P  +        DPCD   CGS A C+     G C C    QG+PY  C+  EC   TDCA  + C   N +C+  C     C   + C+ SNH   C C   + GD + +C  + P A                      KDPC   NPC  N  C      P+    C C Q   +GS   C     K EC  + +CS +  C +  C+D C    CG   RC    H   C C  GYTG+    CY      +    P  T D               NPC +  PC P + CKV+   A C+C   FIG+P + C+    PEC  +PECP   ACI+QKC +PC +  CG NA+C V NH+ IC+C  GY GDP+T C++           +Q  I  E   PC    CG NA C   N    C CL  H GDPY  C+P EC+   +C ++  C+ +KC DPC   C  NADC   NH   CTC + +TGDPY     EP  +P  V E                                        EC    +CP+  ACI++ C +PC     C  NAEC+V +  PL    C C +GFTG    RC  + P      R   +              PCL + PCG  +QC       +CTC   F G P +      EC    +CP N ACI  +C +PC  +  CG  A C    H P+C CP G  GDP S+C                                               R EC  N DCP DKAC S KC++PC  T CG  AIC+V  H   C+CP    G+ +I C  ++      CR      N +C     +               C P CT +++CA                     A C   +H   C CP  + G+ +  C    +P IEP  R   D   V         DPC  + PC P  +C+ +  +P    SC+   + YIG    C       EC+ + DC+S   C    C++ C   +CG NA+C  + H  QC C +G+ G+P   C   + +         PS                                P C  + DCPS   C+  +C DPC     C + A C+VV+H   CTC  G+VG P   C     PP+                                        +PECTI  +C+   AC+ QKC +PC+  TCG NAIC+ RNH  ICSCI  ++GD +T  F   P      E +D         ++PC+   CG N+EC N NG  A CSCL    G     C+P EC  + ECP+ L C N+KC DPC   C +NA C   NH  +C CI  + G+P+                   C P P                    +P +    EC  + DCP   AC+  +C +PC     C  NA C+V + +P+    C C E  +G     C  + P                        NPC   +PCG  ++C+V    + C C   ++G P     P    EC  + DC  +Q C N +C DPC    TCG +A+C   NHRP C CP G +GNP   C +                                               EC +N +CP ++ C ++KCVDPC    CG  A+CR   H ++C C  G  G+P+ +C  +        RD+    LQ    SP       C   A CE R    +C C     G+ Y  C        + EC  + DC  + AC+++ C++PC     C  + EC+ ++ L     TC C  G T                            G N  C+ V                   RPEC    +C +   C    CVD C  + CG  AEC    H+ IC+C SG TG+P   CY                            R  +DPC+  +PC A + CR I+    C+C   Y+G+P     P  +PEC  + ECP H ACI QKC++PC   +CGLN  C V NH  +CSCL GY+GDP+  C+          P          +DPC    CG N +C    +  +C C   + GDPYT C+P +C++  DC     C   KCVDPC   C   A C+  NH   C CL    G+ + I C P+P+ L V                     +NPC    PC  N++CRV +    +   C C+  + G          P     C +NSEC  NLAC   KC +PC     CG  A+C+V NH P C C   YTG+P+  CQ+                                                EC +  +C T++ CIQ +C DPC     CG++A C    H P C CP G+ GDP + C                                                + ECV   DCP +K C  + C DPC  T CG  A CN  +H   C+CISG  G+PY                         C+EV                     EC  +++C  D+ C +N  KC+  C   N C   A C  VNH   C C     GD +  C           +   VD                                     EC+++++CP  QACINE+C +PC  +  C     C +   +         +    ++C        T V L     D C   PCG  A C    +   C C   Y G+P S C              C   +DC R  AC+  KC +PC     CA  AIC V+NH P C+C +GY G++   C+      L Q                                   +PECT +SEC +HLAC+ QKC DPC    CG NA+C V  H   C CL  + G+P+      GC+   E P          QDPC    CG N+EC      A C CL  F G P Y K    EC+ +S+CP +LAC N+KC DPC   C   A C+V +H   C C++  TGDP+   C+PI + +E+                    NPC   SPC  NAEC   +        C CL  Y G   E C R E      C  NSD   N AC  ++C  PC     C   A C V+NH  +C+C  G  GDP   C                    I ++  +PC+  +PCG N+ C   N ++VC CR    G P +     +C ++ +C  ++ C+ QKCV+PC   +CG  A+C+   H  IC CP  + G P+V C        I   T     L +         P  C + A+C    ++  C CLP Y+G              +P+C I+ +CP  ++CI +RC+DPC    P   GQ+  C V + +P    LR    +                         C SN I S  G C+          +  + EC + ++C R+  C    C + C    CG N+ C    H A C C    TG+   +C    P+Q                                       S  P CS + DC    AC+N +C++PC     C   A+C+ V+H   C+C  GY G+P   C + I+P+  RD    D           PC    CG N+ECR       CSC S + G P      P C S+ EC Q   C N  C++PC    CG +A+C   +H  +C C  G+ GDP+  C P+           +Q  + + V PC    C   A+C  +N  G C C  ++ G+PY   C P         EC+ D DCPS  AC++ +C +PC     C   A C V + LP    TC+C+ GY G     C ++  PI                      VNPC   SPCG  S C+ QN  + C C   ++G P     P    EC    EC+ ++ACV ++C DPC  A  CG +A C+  NH  +C C  G+ GDP T CY                + +    PC  + CG  A+C      ++C C     G P   C+  ECT+ S+CL++      LA  N+ C      SC  +AIC    H   C CP  ++GD  + C          + +  P  PS                            P C ++ DCP + AC+  +C +PC     C+    C V + +      C+C + M  NA          ++C+T    P   +       D C  + CG  S C    +N+ CSC+  + G P            P+  P C  + DC    +C+ + CI+PC     C  NA C V+NH P+CSCP  + G+P   C     PE       P+ +  +I K  +PC  + CG  A C +   +A C C+  Y+G P      P C +N EC   +AC+N+ C DPC    CG NA C+  +H AMC C  G  GDP+T C     +              + V PC    C   A C  + H G C C+ +Y G+PY   C P         C ++ DC S +AC  ++C++PC     C  NA C+V + LP    TC C  G+ G     C++  +PV+                                 VG        C +  EC    AC    C +PC     C S A C V  H   C+C  GF GD +S C+P+        D          N C     V +PC + A C        C C P   G P N     EC  N DCP   SCQ + C +PC    CG NA C+V  H   C+C  G+ G+ + SC +      +  +  + CD  T     VCN                  +C C    +G+    C       +PEC + ++C  + AC+ + C +PC     C +N  C V   I      C CP   +     +C+ + P P                   I  C    CG NA C++ +    C CL +F+G P            PS    C  + +CP + AC  R C DPC    C  NA+CRVI H P C C   + G+P  +C                    I      PC  S CG NA+C V+   A C C++G+ G P      P C S+ +CP + AC++++C++PC    CG NAEC   +H  MC C  G  GNP+V C+    + +P  P         CV P  C   A C   N  G     PE      EGC+    ++ DCPS  AC+++ C++PC     C  NAEC+V + LP     C+C  GY G     C ++ +P+                                   +G        C+   +C  +LAC    CV+PC     C  +A+C V  H  HC+C PG TGD  S C      I  D                                             EC  + DC  + AC+  +C DPC     CG  A C  I+H P+C C SG  G+P   C                                                EC+ + DC  +KAC   KCTDPC    CGI A C+   H   C C  G  G+ F++C  V+        ++    +N   C P     +PC   A C   N +  C C P   G       +P K   PEC I+ DC    AC+N++C++PC     C     C V+   P     CSC  GF                              G N +C   + Q                 PEC + S+C     C    C D C   LCGI A C   +H  +C C   + G+P   C    P+  E                       ++PC  N PCG +A C+       C+C   + G+P   C+P       C  +SDC    ACLN  C DPC  +C  NA C+ +NH   C C  G+SG+P   C   +    +      + H N C       +PC  N +C  S   + CRC  D  G P +     EC  N +C +++AC   +C DPC     C  NA+C+  QH + C C P   G+ F+ C +  PSP  +    V+  D              PC   +PC   A C V     +   VC+C   +   P   R          P C ++ +CPS+ ACVN+ C +PC   CG  A+C +  H P C CPEG++G+P   C                 V     +PC  + PCG +A+C+    N  C C   ++GDPY GC    C   +ECP  KAC    C+DPC     C   A C   +H A C+C VGYQG+P+  C   P                                            PECV D +C   +AC+N+KC +PC     C   A CHVI   P     C CP GY       C  +        R D        I+    SPC  G +A C       VC C   + G P        C +++EC    AC N +C   C      CG  A CR   HQ  C C  GL GNPF +C   +  +    P     I  L  +   I+    NPCG+ ++C  +   V C C   + GN   +C      C ++ DCP  ++C++++C +PC     CG+NA C V D +P     C C  GY G+    C PV             +E  + P          +C P L        NE  C C      E+      C                 P+C  + +C   K C   +  C +PC    CG NA    + H   C CI  ++GDP   C   P  + P   D P P   V  + D V V
Sbjct: 8928 CRSGYVGDAYQGCREPSRTVCDP----NPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIG-CHGYECQVDADCPNSKACMGYRCYDPCPGA--CGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKN---------------PCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQP-ECDINSDCGDTLSCI--NHKCVDPC-AGAICGINAICNVRQHTPVCLCLDGFVGDAFLQCVP--IGILKNVSRDPCAPSPCGPHDVCSVYGDGVALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGS--CGRNAICNVYEHNPV----CACPTGLFGNPYEQCT-TKSVVETPPQPSCA--------------KLH-CGANAECKRQHSGLACVCRKGYFGDPHIGCR-----------PECVLNSDCPAEKACLNSKCVEACTGV--CGVNAVCRVVNHAPVCICAEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCP-GICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKACINEKCQNPCA-NVCGHNARCTVIAHSAHCSCDEDYEGDAFIGC-SKKITERPG--DH--------IDPCYPNPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCRP---------ECIYSSECPSSLACIKQHCRDPCTAA--CGANAECTVVNHLP----SCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVG--TCGFNAKCQVNNHNPICSCPANYEGNPFEQCMP---------------KPAEPTRNVDPCLPSP-CGSNSICRNVNNRAECSCAPGMF-GAPPNCRP-ECVINQDCPSNRACIRQRCEDPCIG-ICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMRE--------------IVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINC--------RPECVQNSDCPNNRACINMKCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCPGT-CGYNARCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPP--------------------NPCVP-SPCGPNSQCQVSSSGAVCSCVTNYIGRPPG-CRPECSINSECPARMACINARCADPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKCVDPCPGM--CGHNALCAVFNHAP----NCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGT--CGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLACINLRCRDPCVGT--CGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPCPG-VCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIP----------------RLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIG---------TPPACRPECSVSSECAQDRACVNQRCADPCPGT--CGNEAICKVTNHNP----ICSCPAGYSGDPFVRCAPWQEEPEQPKSNE-------------NPCVPSPCGRNSQCRVVGETGVCSCLPNFVGR------------APNCRPECTINTECPANLACINERCQDPCPGS--CGFNAFCSVVNHSPICTCDSGYTG---------DPFAGCNP----QPPAIPD----ERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYS-GCRP---------ECVVNSDCSRDKSCVNQKCVDPCPGV--CGLNAQCRVSNHLP----SCSCLAGYTGNPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKCVDPCPGT--CGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTE---KSGNPCIPS----------PCGPNSKCLDVRGSPACSCLPDYLGRPP-NCRP-ECLSSADCPANLACVNQRCSNPCIGA-CGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPD-ETRNPCNPSP------------CGANAICRERNGAGSCACLPEYFGDPYSGC--------RPECVQNDDCDRSRACINNKCQDPCPGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAV----CSCLEG-YIGAPPSC-----KPECVVSSECPQNRACINQKCEDPCR-GSCGNNAKCQVVNHNPICTCQPGMTGDPISGC-------EP----------------MPEVKNVENPCVP-SPCGPNSVCRQIGNQAACSCNAGYIGRPPTC-----RPECTNNDECQNHLSCQQERCVDPCPG-SCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPC----------EPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPF-FSCKPVP--VTPR---------PPLNPC------NP----SPCGPNSNCRAMN----NQAVCSCQAGF--------INQPPNCKPECVVSAECAPEKACVHKKCVDPC--QHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFIGAPPRCRPECVLNSECGPTEACINQKCADPCSGS--CGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPCPG-ICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNKKCVDPCAAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNPCP--ESCGTNAECRVIGH----AVSCSCPTG-YAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCP-GICGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDP-----------------------CIPSPCGANSKCRVANGLAVCSCMETFIGAPP-NCKP----ECTVNAECPSNRACHKFRCANPCAK-TCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPP-----------PPGPKDEPVRRPC-QPSPCGLNSECRVRDEQASCSCLPNFIGAP-PNCRP----ECVVNTDCSPDQACIAEKCRDPC--DGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQ--------DPCDLQPCGSNAECR----NGICSCLADYQGDPYTGCRP-ECTLSTDCAPTKAC--LNKKCVDPCP--GVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVA----------------------KDPC-QPNPCGPNSLCHISGQGPV----CAC-QPGMLGSPPAC-----KPECIVSSECSLHTACVNRKCVDPCP-GACGQFARCQVINHNPSCSCNTGYTGDPFTRCY------QEERKPPTTPD---------------NPC-QPSPCGPNSECKVLNGNAACSCAATFIGTPPS-CR----PECSINPECPPTKACIRQKCSDPCVN-ACGFNARCNVANHQPICTCDVGYTGDPFTGCQK-----------EQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRP-ECVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLSTECPTDKACISQRCQDPCPGT--CGINAECRVRNHSPL----CQCRQGFTGDSFTRCYPLPPPPPVIERVERD--------------PCLPS-PCGLNSQCRNVQGVPSCTCLPDFLGAPPNCRP---ECTISAECPSNLACIRERCIDPCPGS--CGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCNPSPCGPNAQCNAGICTCLAEFHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGT-CGENAICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNPCRPSPCGPNSQCREVNQQAVCSCLPSFIGAPPSCRPECTSNSECAPTQACLNQRCGDPCPGTCGVGANCAVVSHSPFCTCPERFTGNPFIRC----QPQIEPPVR---DVAPV---------DPCRPS-PCGPYSQCRPVGEAP--ACSCV---ETYIGRPPNCR-----PECVTSSDCSSQLACVNQKCVDPCP-GRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRACQQLRCQDPCPGT--CGLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADTCGNNAICRVRNHSPICSCISGYTGDAFTRCFLIPP---PIIETKDEPL------RDPCIPTPCGPNSECRNINGVPA-CSCLVNFIGQ-APNCRP-ECTINSECPSQLACINQKCRDPCPGACGQNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPRDRACVRNKCIDPCSGT--CGVNALCEVNNHIPI----CRCPEQMSGNAFFECRPVPPA--------------------KIQNPC-QPSPCGPNSQCRVVQQTAVCSCLANYVGSP-----PQCRPECVTNSDCPADQDCQNMKCRDPCP--GTCGFNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCGPNSECRVSGDSPSCSCLPEFVGAPPNCRPECISNSECPTNQACINQKCVDPCPGL-CGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPI--------RDSPPEVLQPCNPSP-------CGVNAKCEERGGAGSCQCLPDYFGNPYDGC--------RPECVLNSDCPSNQACVNQKCRDPCPGT--CGQNAECQVVNHL----ATCNCLVGYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTSSSECAADKACVNRKCVDPCP-NVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQP------------------PPPPVVEREPLDPCVP-SPCGANSQCREIHGTPSCSCLPQYLGTP-----PNCRPECSINAECPSHQACINQKCRDPCPG-SCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPP-------EDPCNPSPCGSNTQC----NNGVCSCLPEYHGDPYTGCRP-ECVLHTDCDRSRACVRHKCVDPCPGTCGTNAICEVLNHIPNCRCLEGMQGNAF-IQCSPVPK-LDV--------------------VQNPCQ-PSPCGPNSQCRVVN----QQAICSCITSFIGS--------PPFCRPECTTNSECPLNLACRNQKCSDPCPGV--CGRGAQCHVTNHSPFCRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVTSSECPTNQACIQQKCRDPCPGL--CGQSAECRVLSHTPSCVCPEGMEGDPFTLCKEKRIQELDQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCRPECVLNSDCPSNKACQQQKCQDPCPGT-CGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKAC-VNQ-KCVDPCP--NTCGDQAICRVVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPYSQCRSQGDAPACSCLVGYIGAPPNCRPECRINAECPSSQACINEKCRDPCPGS--CGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLD----DPCNPSPCGPNAQC----NNGVCTCIPEYHGDPYSGC-----------RPECITSADCSRELACSRNKCFDPCPGT--CAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSNSECLSHLACVNQKCNDPCPG-SCGRNAQCSVVNHNPFCTCLPRFTGNPF-----VGCQQIIEPPRQDIVP----QDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCK---PECVANSECPSNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPF-TQCQPIVQDVEI-------------------INPCQP-SPCGANAECIQRNG----AGACQCLTDYFGNPYEGC-RPE------CVLNSDCPSNRACQQQKCRDPC--PGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCS--------------QPPEPIVHEYVNPCQP-SPCGPNSNCREVNEQAVCSCRSEFEGAPPN--CRPQCTSSSECASNRACINQKCVDPCPG-VCGQQAICEVRNHSPICRCPTAMIGDPFVRC--------IPRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFGT---------PPHCRPECSINAECPSHLACIGERCRDPC----PGACGQQTECRVISHVPSCVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICSNQGECKCVADYQGDPYVACRPECVLSSECPRNLACIQQKCTDPCPGT-CGTNAICDVVNHIAMCHCPDRMTGNAFVQC---TPVQLDVYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECSTNYDCSPSLACQNQRCVDPCPGA--CGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQ--RDITPKD-----------PCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNC--RPECVSNSECSQVHVCSNNRCKDPCPG-LCGTDAVCRVISHSAMCYCQPGYSGDPFVRCAPH-----------IQRESIEIVQPCNPNPCGAFAECRQQNGVGSCQCLPEYFGNPYE-GCRP---------ECVLDSDCPSQLACVNQKCRDPCPGS--CGQNAECFVRNHLP----TCNCLSGYVGDPYRYCSIEPKPIREY-------------------VNPC-QPSPCGPNSQCREQNGVATCSCLPEFVGTP-----PGCRPECTVSSECNLDKACVRHKCLDPCPGA--CGSSANCQVVNHAPLCSCQAGYTGDPFTRCYPIPSPPT-------HIVHDYARHPCQPSPCGANAQCRQSQGQAICSCIPNYFGVP-PNCRP-ECTQSSECLSS------LACINQRCADPCPGSCAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPCNPSPCGANAVCQNGQCSCIPEYQGDPYTGCRPECVLNADCPRNRACVRHKCVDPC--PGTCAPNAICDVINHI----AMCRCPERMTGNA---------FIQCET----PPVSLAPP----DPCYPSPCGPNSRCRVFNNNAVCSCIEDFIGTP------------PNCRPECTHNSDCLPRLACQRQHCIDPCP--GTCGFNALCHVVNHAPICSCPPKHNGNPFLGC----FPE-------PVRRDEVIPK--NPCQPSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNC--RPECITNSECSFDKACLNQRCRDPC-SGTCGSNANCHVISHTAMCYCLPGFTGDPFTSCVQVPVI-----------QQAEIVQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYET-CRP--------ECVTNNDCPSNKACQQQKCRDPCPGV--CALNALCRVINHLP----TCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPC--PGVCGSNADCRVIQHAPICSCRAGFTGDAFSRCLPLPPSRPPQLD-------VYRNPC-----VPSPCGQYAECRDNQGTATCSCLPSYFGTPPNC--RPECTINPDCPSHLSCQQQRCRDPCPGA-CGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQG----------------QCNCLPEFVGNPLVGC-------RPECVLSTECDWSKACVRNKCIDPCPGT--CGSNAICEVHRHI----AMCHCPPEMTGNAFSQCRPLPPAP---------------VRDVIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIGVP------------PSCRPECVSNAECPLHLACLQRHCRDPCPGV-CGLNAECRVINHSPNCHCIGSFTGNPFAACHR-------------PPPPPIKHEPIDPCQPSPCGANAECRVQGSNAQCSCLSGFIGTPPNC--RPECVSNSDCPMNLACLNQKCRDPCP-GVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTP---------CV-PSPCGANALCSEGNGAGACKCLPEFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCPGT--CGINAECQVRDHLP----QCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPACRPECTISSECDLTLACVQQHCVDPCPGV--CGNSAQCRVINHSPHCSCLPGFTGDAISGCQRIPPAITHDAPNETPRDPCVPSPCGAFGQCRAQGNQAICSCLPGYYGAPPNCRPECAINPDCASHLACISEKCRDPCPGS--CGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSPGGQCSCLPDFDGNPYVGCRPECVLNTDCARDKACQRSKCTDPCPGA-CGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTLVQ--------SSPVVPLN--PCQP-----SPCGNNAQCREVNDQAVCSCLPGFFG-------VPPKCR-PECTINSDCAPHLACLNQQCRDPCP--GACGQFAQCQVIRHVPH----CSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSPCGPNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLACIGQKCKDPCS-GLCGIAATCQVVSHVPSCICIADYIGDPYTGCYARPPIQREQ----------------------INPCYQN-PCGSNAVCRERGEAASCQCLPEYYGNPYEGCRP------ECVLNSDCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQ------VVHFNPCQ-----PSPCGPNSQCTESQGQAVCRCLPDYYGSPPAC--RPECTTNPECPNDKACVSRRCTDPCA--GACGQNAICRAHQHRAYCSCHPGYTGDAFMRC-QSLPSPQPIRDSPVIYRD--------------PCVP-SPCGQFAQCRVE----YEQAVCSCLTSYYGTPPYCR----------PECTQNSDCPSHRACVNQRCVDPCPGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCY-------PAPAPPPTPVTVVADDPCQPS-PCGPNAQCS----NGVCSCLPLYQGDPYVGCRP-ECVLSTECPWDKACIRNRCLDPCPGT--CGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQAPVELHPCQPSPCGHHGECREVGSQAICTCRLGYYGSPPACRPECVSDPECPPSLACVNQKCRDPCPGA--CGHLAQCHVINHSP----QCVCPAGYTGSPYSECHLI--------RADSSPIQRQPIDPCLPSPC--GPHAQCSNEGGNAVCRCLTEYLGVPPY--CRPECIANSECPSDRACINRKCQDPCPGL---CGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPATPPTTA-IQVLQYEEPFINGCEPNPCGANAQCNQRRGVVSCVCLPDYFGNPYEACRP---ECILNSDCPLSRACVQQKCRDPCPGT--CGLNAECHVMDHLP----QCRCFSGYTGNPLAYCSPVPII----------QESPLTPCDPSPCGPNAQCHPSL--------NEAVCSCLP----EFYGTPPNCR----------------PECTLNSECAYDKAC--VHHKCVDPCP-GICGINADCRVHYHSPICYCISSHTGDPFTRCYETPKPVRPQIYDTPSPPYPV-AIPDLVYV 18784          

HSP 2 Score: 2884.75 bits (7477), Expect = 0.000e+0
Identity = 3161/11303 (27.97%), Postives = 4310/11303 (38.13%), Query Frame = 0
Query:    2 ACTCIEGYE-EPII-------ASGCQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGDAYSNCSPINEDECRYDSDCPLNNAC--MKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFE-CKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDC------------------PQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVC--------------VG---------GTCLNSCRVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPG-----------------------------------CDSNQDCPTYSSCRNRLCINPC----------------------------------AEDKP---------CSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGD-------------------------PYSVCE-----------------------EPGCRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPYSYCNAYECLSDPECPD--HLHCISEKCVDPCKCAANAECDARNHRGY-CACIIDFTGDPYGIECTPIPEPVIEEVECVEDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKI-----------------------------------------EPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCY-EYECLRNSDCPFDKACVSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVG--IDGRCNRVQTSPECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRPHPECPDRLKCENEKCVDPC---ECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERC-----IKIEPVVD---------------------------------VGCR----SNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYVACKEVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNC-KRVETATECQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINPCAESSPCASSARCKVINHEPECTCPDGFIGSPTTDCR-----PRDP----------------YSFCRPY---------------------ECLSDPECPDHLKCENEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPYGIACEP---------------IPEPVIEEVECK----------------------------EDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKISNSECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSF---------------------------------------------ECKKNEDCPFDKECKSESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQ-----------------CRRNSDCDSKEKCNL---------KTYKCTPLCRKN-------------------NNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPT------------------------EIE---------------PLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNC-----QPPE-----------------------------------------RPECRVDAECPLDRACIHQKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPC--ECARNADCKARNHRGYCTCIPNFTGDPYG------IV------CEPIP------------------------EPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERC---------------------------------------VKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILT-------------------------------------------------HECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYCY----------------------------------------------KYECKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGF---ECKEVELST---------------------------------------ECQVNNDCQQFEICVDGTCRKTCSINSCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVG----------------------------------------------CRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRK---------DTDCASNEKCNLQN------------------------------------FRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAE---------------------------------------------KIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIG-----------------------------------SNGICQEVET---------KVECEYNDDCSTNDICQDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYL-------PITPN-------------------EPSLV-------PGCTSDQDCPSYTACRNRQCINPCA-----------------------------------------------EDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPC--ECARNADCDARNHRGICTCILDFTGDPYGI-ACEP--IPEPVIE--------------------------------------EVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERC------------VKIEPIIHTGCRSNT--------------------------------ECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNS-------------------------------------LHAHQG--------ECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGD----------------------PHSTCY---------------------RYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNC----RPPK----------------------------------------KPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYT--FCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAEC-NANGHRAICSCLQGHKGDPYSFCKPYECLSDPECPNHLKCKNEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPYG----------------IACEPIP--------------------EPVIE-EVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKY----------------------------------------------ECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTI---------------------------GLNYNCQRVES-----------------RPECEKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPC--ACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETS--------------------------------------------TKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFC---------------------------DKKIAS----------VDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQITIQTQAECTTNNDCR------XTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQ----------------------------------LPQ---------KPECTKDSECANHLACIQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCRSYECLVDSDCPRHLACENEKCVDPC--KCAKYADCKVTNHQGYCTCNSYYTGDPYGLACEPIPEPIEVECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTG-------------------------------------------ECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQC--------YSY---------------------------------------ECKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQK--CSVSNSLP----LRSITCE-------------------------CPSNEIISENGICE---------KIQIKTECKVDTDCARSDMCKDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQ-------------------------------------EASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQ---------------------------------------------PECTRDYECPDNKACIQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPC--KCARNADCEIKNHRGYCTCQSDFTGDPY---GISCDPIPEPV-------------------------LVEY---------ECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKI-DPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNF----------------------------------------------ECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEV------------------------------ECTKD---------SDCLNNEECNLRLAKCNRLCQREN-------SCTKSAICEATRHTEICTCP-----TPFIG---------------------------------DGKSFCME--IVKPPS-SPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTDRDCPDSDVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLSPKPECIVDQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGDPYTFCRPYECLVDRDCPDQLKCDHEKCVDPCQCAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKG-----------------DEKCELIT--------------EPVVVG---------CTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHSYECLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLDCHNDNDCKDDEKCDRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKV--TPQPQCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCE---------LPS------------------------------------EPECLVDDDCPSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEEPGCKSDIECPFDKACISRECQNPCLYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPC--QCAKYAECDARNHRGIFPEPVEVEG-------------------------CQMDKDCP--SQEACIDRECQNPCLSFRP-CVEN-------------------------AECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVV--------GCSNDRDC--------------------------------STSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEYECLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLVVDSSPSKSVSCSCREGFYV---------------------------GKNGDCIEVDGQ-----------------PECRSHSDCRYNEQCQSGSCLDACRIRLCGINAICVAENHESTCACRIRFSGNPEVACLPI--------SPLVVE------------------------------ALPPGCR----SDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECKP------------------PTPLS---------------------IGCSAD----SDCPVVEACLNTKCVDPC--NCGENALCRKINHKAVCFCPSGFSGNPEVLCEKL----------------------------------------------ECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDV--------------------------------------------------ECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPC--NCGGGAKCFLSGHRPICQCPEGFIGNPQIECNPAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPP 9016
             CTC +G+E  P++       +  C  D +C   +AC N++C +PC   +PC   A C   NH   C C  GF G+ +  C P     C+Y+ DCP    C  +  +CI+PC+ +  CG  A C   +H   C C  G  G+ +  C   + C+ +++C   +AC+  KC  PC   +CG  A C V  H  +CKCP G  G+P + C   +    D C D   C LN                 A+CE       C CP  LTG+ +  C  +        C  +S C                  P    C  E   NPC  + PC    +C V+ +  ++   C C  +   S N     +E    C+  N CG   +C              +G            +  C+  PCG NA+C  + +R  C C  GY G+    C+    T   P   G                                   C  + DCP   +C    C +PC                                  A D P         C   + C+++N++ VC+C  GY+G P + C    +PEC ++SDC D L+CI  +C+ PC+   CG+NA C V+ H  +C CL G+VGD                         P+ VC                         P C  + +CP  + C+ + C +PC    CG NA C+   H   C C  G  GNPY  C     +  P  P    LH           C ANAEC  R H G  C C   + GDP+ I C P         ECV + DC +++AC++ +C   CT    C  NA C+V +  P+    CIC EGY+G     C                                             P+    C    EC  N AC NQ+C +PC     CG  ARC V NH   C+CE  F GD +  C  I         D P  K        +PC     CG N+IC  + +R +C C    A    S  Y   EC  +S+CP DKAC++EKC NPC N +CG  A C+V  H   C C +  +G  +I C     +R  D  D          C       N CA +AVC   N+  +C C  P  GD YS+         +PEC    +CP  LAC+ + C+DPCT    C  + EC V +  P    +C C T    G   DG    V   PE                     C+ NPCG N+IC+S      CSC  GY G P            P   P C    +C  +  C N  C++PC     C   A CQV NHNP+C+CP  Y G+P   C P P  P R        VDPC    C  N+ C   N+R  C+C P   G P    C P         EC  ++DCPS  ACI + C++PC+    C  NA C   +  P     C+CIE F G     C     + ++P  D                                 + CR     NS+C  N AC N KC +PC N   C  +AICR  +HQP C C P  TG+P   C            + PSNM     K  +PCR  S CG  + C V+   PVC CL ++ G P +   K EC  + +CP D++C +  C DPC  T CG NA C    H  IC C  G  G P+  C  V  RK                    C  S  C  N++C+ S     C C + Y G           P  + EC+++ +CP++++CI+  C +PC  +  C  +  C V+   P     C+C P    + F  C K +ET  E                  I  C+  PCG+NA C  R  ++ C C   + G+P   C            P C  N DCP   AC ++KC++PC     C  +A C V NH P C C  G+ G+P   C      PR P                YS CRP                      EC+S  EC     C NE+C DPC   C  NA C   NH  IC+C P F+GDP+ + C P               +P P     EC+                             D +CP   ACIN  C +PC+    C     C V +  P+    C CI+G+ G     C    P ++V  +    C+P+                PC   A C+  N    C C   Y GDPY++C      EC  ++DC+ N AC+N++C D C     CG  AEC  I H   C CP G  G+P   C                                                EC  + +C  D+ C ++ C DPC  T CG  A C V  H  IC C +GY G+P++ C   Q                 C RNS C    +  +         +   C P C  N                    +C  +A C   NH   C+C +   GD ++ CN P  PA                 I D    PC   SPC P+  CR          SC CL          C     + EC +++DC++D  C    CV+ C    CG+NA+C  + H   CSC  GY G+P +AC + P                         E++               P   P C +  DC     C+N+ C++PC     C + A C+VI H P C+C  GF G P   C     +PP                                          RPEC   A+CP + AC++Q+C NPC    CG ++ C V  HR  C C+ GY GDP+S C +            Q     E +NPC    CG    C+  N    C CL  + G  Y  C R EC+++ DC     C+N+KC DPC   C  NA+C+  NH   C C   +TGDP+       +V      C+P P                         P   + EC    +CP   ACIN++C++PC     C  NA+C+V +  P+    CTC  G TG     C                                       +   P     C ++ EC   L C+   C++PC     C ++A C V  H A+CSC  GY G+P   C+ I                                                    EC  ++DC   QAC   +C +PC  N ICG  AIC    H   C CP G++GDP   C                                               K EC    +C  +KAC  +KC+DPC+ T CG RA C T+ H   C C + + G+P+V C  V   NDN   S            A C   + C  NAKC+ + +   C C   F G     C         PEC ++ +C    ACI+ +C +PC  +  C     C V N+ P+    C C  G YE D F     KE + S                                        EC ++ DC + + C+   C   C    CG NAVC  + H   C+C  GY GDP   C    +  +P++E  CS                       SPC  ++ C+ +N  AVC+CL+G++G P   CR    PEC++ +EC    AC+N+KC +PC+   CG  A+C V  H  IC C  G  G P   C   P + V                                               C  N +C  T AC N +C NPC E+  CGT+A+C+V  H  +C CP GY G+ +  C P Q+   K                  PC  + PCG NAEC+  N  + CKC   + G+P+  C + EC +S DCP DKTC+  KC DPC    CG  A C A  H  +C C +G  G+P+  C+ VE             + C +N KC + N                                    FRC   C+    C   A CE  NH   C CP    GD ++ C                                                 P   + EC ++ DC   +ACI   C+DPC     C  + EC+    + +    C C +G F G                                    NGIC  +           + EC  + DC+    C +  C+D C    CG N++C  S H   C CLQGYTG+  V C         P  PN                   +P ++       P C    +C  +TAC NR+C++PC                                                +  PC P + CKV+   A C+C   FIG+P + C+    PEC  +PECP   ACI+QKC +PC +  CG NA+C V NH+ IC+C  GY GDP+T C++           +Q  I  E   PC    CG NA C   N    C CL  H GDPY  C+P EC+   +C ++  C+ +KC DPC   C  NADC   NH   CTC + +TGDPY     EP  +P  V E                                        EC    +CP+  ACI++ C +PC     C  NAEC+V +  PL    C C +GFTG    RC            V+ +P + + C  N+                                EC  +LAC    CI PC  +  CG  A+CSV NH   C CP GFTGDP S                                     L    G        EC  ++DCP +KAC +++C NPC     CG NAIC    H P+C+CP   AG                       P+S C                      R EC +N +C   +AC +++C DPC  T CG  A C V  H   C CP    GNP+I C+    +     RD    D     C P     + C   + C        C C   YIG           P   PEC    DC S  AC+  KC DPC     C    EC V++ +    V CIC          QC+                 ++ YE      C    CG NA C        C+C   Y G+P  GC            P C  + DCPS   C+  +C DPC     C + A C+VV+H   CTC  G+VG P   C     PP+                                        +PECTI  +C+   AC+ QKC +PC+  TCG NAIC+ RNH  ICSCI  ++GD +T  F   P      E +D         ++PC+   CG N+EC N NG  A CSCL    G     C+P EC  + ECP+ L C N+KC DPC   C +NA C   NH  +C CI  + G+P+                   C P P                    +P +    EC  + DCP   AC+  +C +PC     C  NA C+V + +P+    C C E  +G     C  + P                        NPC   +PCG  ++C+V    + C C   ++G P     P    EC  + DC  +Q C N +C DPC    TCG +A+C   NHRP C CP G +GNP   C +                                               EC +N +CP ++ C ++KCVDPC    CG  A+CR   H ++C C  G  G+P+ +C  +        RD+    LQ    SP       C   A CE R    +C C     G+ Y  C        + EC  + DC  + AC+++ C++PC     C  + EC+ ++ L     TC C  G T                            G N  C+ V                   RPEC    +C +   C    CVD C  + CG  AEC    H+ IC+C SG TG+P   CY                            R  +DPC+  +PC A + CR I+    C+C   Y+G+P     P  +PEC  + ECP H ACI QKC++PC   +CGLN  C V NH  +CSCL GY+GDP+  C+          P          +DPC    CG N +C    +  +C C   + GDPYT C+P +C++  DC     C   KCVDPC   C   A C+  NH   C CL    G+ + I C P+P+ L V                     +NPC    PC  N++CRV +    +   C C+  + G          P     C +NSEC  NLAC   KC +PC     CG  A+C+V NH P C C   YTG+P+  CQ+                                                EC +  +C T++ CIQ +C DPC     CG++A C    H P C CP G+ GDP + C +      D             +DPC  + CG+ A C +    G C C+    GNPY  C+  EC  N+DC  ++ C     KC   C     C  NA C  +NH   C C +   GD Y  C                           ++ I S          V   EC + S+CP  +AC+N++C +PC   N C     CR+   S I    +A  T +   R           +  T +D C   PCG Y+ C        C+C  GY G             P      C  +++CP   AC N+KC +PC     C   AIC VINH P C+C  GY G   + CQ                                  +P+         +PEC   ++C+  LAC + KC DPC    C  NA C V  H  +C C E Y G+ +  CK          P+    + + CQ       CG N++C   N +A C C+  + G P + CR  EC  +S+C  HLAC N+KC DPC   C + A C V NH  +CTC   +TG+P+ + C+ I EP           PRQ    +  C+      SPC  N+EC+        T TCTCL  + G             +  C ANS+   NLACI ++C  PC     C S+A C+V++H A+C C  G TGDP   C PI                                              EC  +SDC ++ +C   +C DPC     CGQNAEC   NH  +C C  G IG+P+  C        + Y                                       +C ++ +C  ++ C+ QKCV+PC   +CG  A+C+   H  IC CP  + G P+V C        I   T     L +         P  C + A+C    ++  C CLP Y+G              +P+C I+ +CP  ++CI +RC+DPC    P   GQ+  C V + +P    LR    +                         C SN I S  G C+          +  + EC + ++C R+  C    C + C    CG N+ C    H A C C    TG+   +C    P+Q                                       S  P CS + DC    AC+N +C++PC     C   A+C+ V+H   C+C  GY G+P   C + I+                                             PEC  + EC     C   +C +PC  + CG +A CRV  H A+C C+ GY GDP+  C     +   E  Q           PC+   CG  A C  +N  G C C+  + G+PY  C+P EC++DSDCP+ L C N+KC DPC   C +NA+C ++NH   C C S + GDPY    I   PI E V                         L E+         EC    +C  ++AC+  +C++PC     C   A C+V +  PL    CSC  GYTG    +C  I  P  H               V     +PC   SPCG  + C+    +++C C   Y G P     P    EC    EC S+ AC+N +C DPC  +  C YNAIC  +NH   C CP G+ GDP T+C+                                                EC+ N DCP ++ C+  KC+ PC  T C   A C V  H ++C+CP  + GN ++ C+                                 C +D          +C +N +C  RLA     CQR++       +C  +A+C    H  IC+CP      PF+G                                   +  C+   I  PP+  P C  + +C    AC++++C++PC     C S   C V     + T  C C      +    C  +  + + +                V  C  N CG+ + C    H   C C+  Y G+PY  C            P C ++ DCPS  +C+ + C +PC    +C +NA C+VINH P C C NG++G P   CQ+  KP              ++ +  +PC  + CG N+ CR NN +A C C+  YVG P      P C ++ EC   +ACI + C DPC    CG NA C    H  +C C+ G  GD ++ C P    +    P QL      CV P  C +YA C        C+C+  Y G P          P     C  + DC S  +C  + C++PC     C  NA C V +  P    TC C  G+ G                    + C+LIT               P  VG         C    EC  S AC    C++PC     C S A C V  H A C CP    G+ +S C P+                      I  C   +PC  NA C   N + +C C    IG P +     EC+SN +CPL  +C  + C +PC   +CG NAEC V  H   C C   + G+P+ +C             D             C  +  C   A+C  +    +C+C    IG         P + +PEC  +SDC  NLAC+N  C++PC     C +N +C V N  P+    C C  G +      C+ V   P+PQ                   T C+   CG NA+C   + + AC+CLP F G+P++ C              C +++DCPS+ AC N+ C DPC    C  NA+C+V  H P C C  GY G+P   C          +PS                                     PEC +  +C   LAC+ Q C  PC    CG +A+C V +H   C C+ G+ GD    C+        + P +        ++PC+   CG   +C  + ++A+C C  G+ G P  +C+P EC  +PDC  HL C +EKC DPC   C   A+C   NH  I   P   EG                         C  +  C    Q +C+     NP +  RP CV N                         A C V N +P    TC+C  G SG    +C L+    VV         C N+  C                                +  LAC N +C +PC     C Q A+C+V RH  HC+CP G +G+ + +C  +                 V+ E I+PC    PCG NA C   + + +CKC     G P +     EC+  ++CP+  AC+ QKC DPC +  CGI A C+   H   C+C     G P+  C     R     +    C            ++NPC   A C  +     C C P   GN +  C        PEC ++ DC S  AC+N+ C++PC     C P+  C VV+  P    SCSC  G+                             G N  C E  GQ                 PEC ++ +C  ++ C S  C D C    CG NAIC A  H + C+C   ++G+  + C  +        SP++                                  PP CR     +S+CP++  C N +CVDPC     CG +A C V  HVP C CPEG+ GDP   C P                  P+P                       +GC  +    ++CP  +AC+  +C+DPC   CG  A C+  NH A+C CP G+ GNP VLC++                                               EC SD +C     C    C +PC     C    +C   NH  +C CP+   G PYS C  +                                                  EC  N +C S+RAC   KC DPC     C  NA+C+T  H  +CVC P L+GNPF SC+      I              +   +N    NPC +   C+               + C C   +      +C        P C+ + +CP + ACV + CR+PC   CG  A+C +  H P C+C  G+ GNP   C+P               ++ S + PC  + PCG +A+C P+L+ A C C   F G P        C  +SEC   KAC +  C+DPC     C + A+C    H   C C   + GDP+  C   P P
Sbjct: 8526 VCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTEACINQLCQHPCDVHDPCATNAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQEDS-CGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPC---QCGAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQ----DPC-DPNPCGLN-----------------ALCELDNGNPICYCPKGLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPC--ELPSNPCDPS-PCGPNTQCSVLSNGFSK---CTCLPNYVESPNTIRGCVEPINPCD-PNPCGTGAICDSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGC----QPECDINSDCGDTLSCINHKCVDPCAGAICGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGVALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPG-SCGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETPPQPSCAKLH-----------CGANAECK-RQHSGLACVCRKGYFGDPH-IGCRP---------ECVLNSDCPAEKACLNSKCVEACTGV--CGVNAVCRVVNHAPV----CICAEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCP--GICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDP----GRDIPVPK--------NPCVPSP-CGPNSICQIKQNRPVCSC---VANYIGSPPYCRPECTLSSECPSDKACINEKCQNPCAN-VCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHID---------PCYP-----NPCAENAVCTPYNNAARCTCIEPYNGDPYST-------GCRPECIYSSECPSSLACIKQHCRDPCTAA--CGANAECTVVNHLP----SCSC-TRGFEGNPFDGCKRVVVVRPE-------------------TVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAP------------PQCRPECVVSSECAQHLSCINQKCMDPCVGT--CGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRN-------VDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPN--CRP---------ECVINQDCPSNRACIRQRCEDPCIGI--CGFNAVCSTQNHQP----KCSCIESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRPECVQNSDCPNNRACINMKCRDPCANA--CGFNAICRVAHHQPVCSCEPHLTGNPLRACV-----------ERPSNMYLPLPK--DPCRP-SPCGLFSTCHVVGERPVCACLPDYMGAPPNC--KPECMTSAECPSDRACINQRCKDPCPGT-CGYNARCRCTNHSPICSCYDGYTGDPFHQC--VPERKPPPIADP-------IVPPNPCVPS-PCGPNSQCQVSSSGAVCSCVTNYIGR---------PPGCRPECSINSECPARMACINARCADPCIGS--CGNNALCHVSLHAP----VCMCEPGYSGDPFSGCYKIIETPIE-----------------VIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPYVEC-----------RPECVINSDCPRSRACVNQKCVDPCPGM--CGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCSPGFSGDPF-VRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLACINLRCRDPCVGT--CGIQTTCLVNNHRPI----CRCIDGYAGDPFSEC---SPKINVPVQVAQPCNPS----------------PCGANAVCKERNGVGSCSCLPEYNGDPYTEC----RPECVLNSDCSKNRACLNNKCRDPCPGV--CGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGT-CGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPNCRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCN-PQPPA-----------------IPDERLTPC-QPSPCGPNAECRERNG----AGSCTCLPEYFGDPYSGC-----RPECVVNSDCSRDKSCVNQKCVDPC-PGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKCVDPCPGT--CGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIG-ACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIV----------QQIAPPDETRNPCNPSPCGANAICRERNGAGSCACLPEYFGDPYSGC-RPECVQNDDCDRSRACINNKCQDPCPGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDPCRGS--CGNNAKCQVVNHNPI----CTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQERCVDPCPGS--CGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPC--NNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDPCQHT-CGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPS---------PAPASCVP-SPCGPNAKCQIVGNSPACSCLPNFIG-APPRC--------RPECVLNSECGPTEACINQKCADPC--SGSCGFEAKCHVLNHLPI----CNCIEG-YEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPCP-GICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIE-ACS----------------------PSPCGSNSQCRDVNGHAVCSCLEGYIGAPP-QCR----PECVVSSECSALQACVNKKCVDPCAA-ACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNPCPES--CGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPK------------------PCQPS-PCGPNAECIERNGAAACKCIDEYQGNPYEGC-RPECVLSSDCPTDKTCIRNKCQDPCPGI-CGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANPCA--KTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQACIAEKCRDPCD--GSCGVDSECRVQNHLAI----CTC-RGGFTGDPFVRCFEFVEETTKSPPLTQDPCDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVDPCP-GVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPS-CR----PECSINPECPPTKACIRQKCSDPCVN-ACGFNARCNVANHQPICTCDVGYTGDPFTGCQK-----------EQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRP-ECVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLSTECPTDKACISQRCQDPCPGT--CGINAECRVRNHSPL----CQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSPCGLNSQCRNVQGVPSCTCLPDFLGAPPNCRPECTISAECPSNLACIRERCIDPCPGS--CGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCNPSPCGPNAQCNAGICTCLAEFHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGT--CGENAICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNPCRPSPCGPNSQCREVNQQAVCSCLPSFIGAPPSCRPECTSNSECAPTQACLNQRCGDPCPGT-CGVGANCAVVSHSPFCTCPERFTGNPFIRCQP---QIEPPVRDVAPVD----PCRP-----SPCGPYSQCRPVGEAPACSCVETYIGR---------PPNCRPECVTSSDCSSQLACVNQKCVDPCPGR--CGLNAECFVVSHA----VQCICQQGFNGDPFVQCK----------------PEIAYENEIRTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGC-----------RPECMLDSDCPSNRACQQLRCQDPCPGT--CGLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADTCGNNAICRVRNHSPICSCISGYTGDAFTRCFLIPP---PIIETKDEPL------RDPCIPTPCGPNSECRNINGVPA-CSCLVNFIGQ-APNCRP-ECTINSECPSQLACINQKCRDPCPGACGQNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPRDRACVRNKCIDPCSGT--CGVNALCEVNNHIPI----CRCPEQMSGNAFFECRPVPPA--------------------KIQNPC-QPSPCGPNSQCRVVQQTAVCSCLANYVGSP-----PQCRPECVTNSDCPADQDCQNMKCRDPC--PGTCGFNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCGPNSECRVSGDSPSCSCLPEFVGAPPNCRPECISNSECPTNQACINQKCVDPCPGL-CGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPI--------RDSPPEVLQPCNPSP-------CGVNAKCEERGGAGSCQCLPDYFGNPYDGC--------RPECVLNSDCPSNQACVNQKCRDPCPGT--CGQNAECQVVNHL----ATCNCLVGYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTSSSECAADKACVNRKCVDPCP-NVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQP------------------PPPPVVEREPLDPCVP-SPCGANSQCREIHGTPSCSCLPQYLGTP-----PNCRPECSINAECPSHQACINQKCRDPCPG-SCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPP-------EDPCNPSPCGSNTQC----NNGVCSCLPEYHGDPYTGCRP-ECVLHTDCDRSRACVRHKCVDPCPGTCGTNAICEVLNHIPNCRCLEGMQGNAF-IQCSPVPK-LDV--------------------VQNPC-QPSPCGPNSQCRVVN----QQAICSCITSFIGS--------PPFCRPECTTNSECPLNLACRNQKCSDPCPGV--CGRGAQCHVTNHSPFCRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVTSSECPTNQACIQQKCRDPCPGL--CGQSAECRVLSHTPSCVCPEGMEGDPFTLCKEKRIQELDQ------------LDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCRP-ECVLNSDCPSNKACQQQ--KCQDPC--PGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPC--PNTCGDQAICRVVNHSPI-CSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPYSQCRSQGDAPACSCLVGYIG------------APPNCRPECRINAECPSSQACINEKCRDPCPGS--CGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPG-TCAPNAICTVLNHVPMCTCPEGYNGNAFVQCK----------PTPPPALVQPCQP----SPCGPNSQCREVNQQAVCSCVPGYIGTPPL-CRP-ECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPF-VGCQQIIEP-----------PRQDIVPQDPCRP-----SPCGPNSECRAAG----ETATCTCLGDFVGS--------PPYCKPECVANSECPSNLACINQKCRDPC--PGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGS--CGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPIVHEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFEGAPPNCRPQCTSSSECASNRACINQKCVDPCP-GVCGQQAICEVRNHSPICRCPTAMIGDPFVRC--------IPRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFG---------TPPHCRPECSINAECPSHLACIGERCRDPC----PGACGQQTECRVISHVPSCVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICSNQGECKCVADYQGDPYVACRPECVLSSECPRNLACIQQKCTDPCPGT-CGTNAICDVVNHIAMCHCPDRMTGNAFVQC---TPVQLDVYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECSTNYDCSPSLACQNQRCVDPCPGA--CGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNCRPECVSNSECSQVHVCSNNRCKDPCPGL-CGTDAVCRVISHSAMCYCQPGYSGDPFVRCAPHIQRESIEIVQ-----------PCNPNPCGAFAECRQQNGVGSCQCLPEYFGNPYEGCRP-ECVLDSDCPSQLACVNQKCRDPCPGSCGQNAECFVRNHLPTCNCLSGYVGDPYRYCSIEPKPIREYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVGTPPGCRPECTVSSECNLDKACVRHKCLDPCPGA--CGSSANCQVVNHAPL----CSCQAGYTGDPFTRCYPIPSPPTHI--------------VHDYARHPC-QPSPCGANAQCRQSQGQAICSCIPNYFGVP-----PNCRPECTQSSECLSSLACINQRCADPCPGS--CAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPCNPSPCGANAVCQNGQCSCIPEYQGDPYTGCRPECVLNADCPRNRACVRHKCVDPCPGT-CAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSLAPPDPCYPSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLA-----CQRQHCIDPCPGTCGFNALCHVVNHAPICSCPPKHNGNPFLGCFPEPVRRDEVIPKNPCQPSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNCRPECITNSECSFDKACLNQRCRDPC--SGTCGSNANCHVI----SHTAMCYCLPGFTGDPFTSCVQVPVIQQAEI---------------VQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETCR-----------PECVTNNDCPSNKACQQQKCRDPCP--GVCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKP--------------VLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNC--RPECVTSAECPHDKACIRQKCNDPCPG-VCGSNADCRVIQHAPICSCRAGFTGDAFSRCLP----LPPSRPPQLDVYRNPCV-PSPCGQYAECRDNQGTATCSCLPSYFGTP----------PNCRPECTINPDCPSHLSCQQQRCRDPCPGA--CGFNALCTVINHNP----TCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQGQCNCLPEFVGNPLVGCRPECVLSTECDWSKACVRNKCIDPC--PGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPV--------------RDVIDPCQP-SPCGPNAQCRNINGQAVCSCLRDFIGVPPSC--RPECVSNAECPLHLACLQRHCRDPCPG-VCGLNAECRVINHSPNCHCIGSFTGNPFAACHRPPPPPIKHEPIDP------------CQPS-PCGANAECRVQGSNAQCSCLSGFIGT--------PPNCRPECVSNSDCPMNLACLNQKCRDPCP--GVCGSNAECYVINHTPM----CTCLAGQTGNPFVSCQVVRDVPEPQ-------------------TPCVPSPCGANALCSEGNGAGACKCLPEFYGNPYEGCRPE-----------CVLNSDCPSHLACLNQHCRDPCPGT-CGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPACRPECTISSECDLTLACVQQHCVDPCP-GVCGNSAQCRVINHSPHCSCLPGFTGDAISGCQRIPPAITHDAPNETP------RDPCVPSPCGAFGQCRAQGNQAICSCLPGYYGAP-PNCRP-ECAINPDCASHLACISEKCRDPCPGSCGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSPGGQCSCLPDFDGNPYVGCRPECVLNTDCARDKACQRSKCTDPCPGACGIGAVCEVRNHIP----TCNCPPGTSGNAFVQCTLVQSSPVVPLNPCQPSPCGNNAQCREVNDQAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQCRDPCPGA--CGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLP------------PPPPVQREPINPCYP-SPCGPNAECTNQNEQAICKCLKDYIGTPPNC--RPECITSSECPIQLACIGQKCKDPC-SGLCGIAATCQVVSHVPSCICIADYIGDPYTGCYA---RPPIQREQINPC------------YQNPCGSNAVCRERGEAASCQCLPEYYGNPYEGC-------RPECVLNSDCSSHLACLNQHCRDPCPGS--CAPNAQCQVVNHVP----SCSCYPGYSGDPYRHCHVAQAEPVQVVHFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGSPPACRPECTTNPECPNDKACVSRRCTDPC-AGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRPECTQNSDCPSHRACVNQRCVDPC--PGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNGVCSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQAPVELHPCQPSPCGHHGECREVGSQAICTCRLGYYGSPPACRPECVSDPECPPSLACVNQKCRDPC--PGACGHLAQCHVINHSPQCVCPAGYTGSPYSECHLIRADSSPIQRQPIDPCLPSPCGPHAQCSNEGGNAVCRCLTEYLGVPPYCRPECIANSECPSDRACINRKCQDPC--PGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPATPPTTAIQVLQYEEPFINGCEPNPCGANAQCNQRRG----------VVSCVCLPDYFGNPYEACR-------PECILNSDCPLSRACVQQKCRDPCPGTCGLNAECHVMDHLPQCRCFSGYTGNPLAYCSPV------------PIIQESPLTPCDPS-PCGPNAQCHPSLNEAVCSCLPEFYGTPPN--CRPECTLNSECAYDKACVHHKCVDPCPGI--CGINADCRVHYHSPICYCISSHTGDPFTRCYETPKP 18761          

HSP 3 Score: 2689.45 bits (6970), Expect = 0.000e+0
Identity = 2882/10378 (27.77%), Postives = 4000/10378 (38.54%), Query Frame = 0
Query:    1 MACTCIEGYE--EPIIASGCQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGDAYSNCSPINEDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSC-KEVECR---HNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRI---ESKTECENNNDCGDQDVCVGGTCLNSCRVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQP-------------------------------------------EPECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPYSYCNAYECLSDPECPDHLHCISEKCVDPCK--CAANAECDARNHRGYCACIIDFTGDPYGI---------------ECTPIP------------EPVIE------------EVECVEDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCV---KIEPIIDV--------------------------------------GCRSD----RECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNV---------------------------------------------------ECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKRE-------------VPSD-------------------------------KPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPT----------KTVACICPTDTVVGIDGRCN-----------------------------RVQTSPECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRPH----PECPDRLKCENEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYVACKEV-----------------------QCRK--------------------------DNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYTGDGYSFCQKIVV---PASKS---------------------------------------ECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINPCAESSPCASSARCKVINHEPECTCPDGFIGSPTTDC--------RPR-------DPYS----------------------FCRPYECLSDPECPDHLKCENEKCVDPCE--CARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKIS-------------------------------------------------NSECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSF----------------------------------------------ECKKNEDCPFDKECKSESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQ---------------------------VGTNGQCITVQSQ--------------NECSIDNDCNQDDMCYEGTCVNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLS------------------------------------PGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNC------------QPPE------------------------------------RPECRVDAECPLDRACIHQKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPCE--CARNADCKARNHRGYCTCIPNFTGDPYG-------IVCEPIPEPVIE-------------------------------EVECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYCYKY-----------------------------------------------ECKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCR-EVECRND----NDCASNEKCDLRYLK---------------------CSALCSDNNLCANN-------------AKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPD----------------------------------------EPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFE---------------------------CKEVELSTECQ------------------VNNDCQQFEICVDGTCRKTCSINSCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVC-------------EEQPVVDVGCRSNS--------------------------------ECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGI-CQ-EVETKVECEYNDDCSTNDICQDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIV--------------------------------------------PECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPCE---CARNADCDARNHRGICTCILDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNS-------------------------------------LHAHQG--------ECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGD-----------------------PHSTCY---------------------RYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPC------------FTNNP-CL--------PLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTS------------------ECIVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFCEE--------------------------------------------------PGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPY---ECLSDPECPNHLKCKNEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKY-----------------------------------------------ECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTI-----------------------GLNYNCQRVES-----------------RPECEKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCD----------------------------------------------EPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPY--------------------------------------------DCLVDNDCLDHLRCTNTKCVDPC--ACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEY-----------------------------------------ECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTI------------------------------------GCKS----NSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETS--------------------------------------------TKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVT----KDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNP---------------YIMCKEVECRRN--NDCNFDEKCDLNSFKCIRLCSQSNI---------------------------CAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQITI-QTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQLPQKPECTKDSECANHLACIQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCRSYECLVDSDCPRHLACENEKCVDPCK---CAKYADCKVTNHQGYCTCNSYYTGDPYGLACEPIPEPIEVECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCT-RVEEIKEY---------------------------------------GCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPL----------RSITCECPSN-------------------EIISENGICEKIQI--------KTECKVDTDCARSDMCKDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPCK--CARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEY---------------------------------------ECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCY----------------------------------------------NFECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMN------------------------------------ARGDCEAIKGLV--------ECQTDRDCPDSDVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSI------------------------------------TPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSP----------------TTECQLSP-----------------------------KPECIVDQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGDPYTFCRPYECLVDRDCPDQLKCDHEKCVDPC--QCAKYANCDAKNHRGYCNCIADYTGDPY--------------GIACEPIP---------------------EPVV--EEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVVVG----------------------------------------CTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHSYECLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLDCHNDNDCKDDEKCDRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHST---------------------------GKDGKCKKVTPQ-----------------PQCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDP--------------------HDACLHAP----------------------ITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCE------------------------------------LPS---------EPECLVDDDCPSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEEPGCKSDIECPFDKACISRECQNPCLYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPC--QCAKYAECDARNHRGIFPEPVEVEG-----CQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVG------CSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHECEQDSDCNGNKACVEYECIDPCI---KDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEYECLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPC 8393
             AC+C+  ++   P+    C    EC  NQAC N+ C +PC     CG  A C V NH   C C   F GD +  CSPI +       D P+     K+ C+       PCG  +IC+ + ++PVC C     G P  +C   EC ++++CP +KAC+ EKC +PC +  CG NA+C+V  H+A C C +  +G  ++ C K++  R   H D C  N                   CA +A+C  Y +   C C  P  GD YS       +  +PEC   S+CP   ACI + C++PC  T  C    EC V++  P    SC C +    +    C R+     +T CE N                     PCGPN+ C +     TCSC  GY G P               +P C  + +C  + SC N+ C++PC     C   A C+V NH P+C+CP  Y G+P   C P+P                                            PEC ++ DC  + ACI Q+C  PC    CG NA C  +NH+  CSC+  + GDPY+ C+             +  +     +PC    CG NA C  RN   +C C + + G+PY  C   EC+ + +CP++  CI+ KC DPC   C  NA C   +H+  C+C    TG+P                   C P P             PV              + EC+   +C S  ACI++ C +PC     C  NA C+  +  P+    C C +GYTG    +CV   K  PI D                                       GCR +     EC   +AC N +C +PC    +CG +A C V  H   C CE G++GD +S C +I +   +    C                    CG NA+C  +N  A CKC P +  D    C   EC+ NSDCP  +ACV++KC++PC   +CG  A C+V  H P C+C  G  G+P + C  V                                                   EC    +C   + C  ++ +C+  C G   C  +A+C   NH   C C P   GD +  CF +E             VPS                                +PEC  D +CPG LAC++ +C+DPC     C     C V +  P               C    +  V +   CN                               +  PEC + +DC  +  C++  C D C    CGV+A C   +H   CSCP+G+TGNPS  C  +     P                       + PC   SPC P + C+ +N + VC+C   YIG+P   CRP      EC     C N++C DPC   C   A C   NH  IC+C   ++GDP+ + C P            E+ + P  N       +NPC+   PC +N++C+V       T  C+C+  F G+         P     C  N+EC  NLAC N +C +PC  +  C  +A C   NH P C C  G+TGDP++ C+P  +     DE               PC+  S CG NA C   N +  C CL  + GDP+S C + EC  N DC  DKSC +  C+DPC   VCG NA+C V  H   C C +G  G+P  AC+E+                       QCR+                           +DC Q+  C  Q+  C   C  +  C   ARC+   H   C C+  +TGD ++ C KI++   P  KS                                       EC    DCP+ L+C++Q C NPC     C     C V    P    AC C P    + F  C  V+           PD          N C   PCG NA C  R  +  C+C   + G+P S C            P C  N DC    AC + KC +PC  +  C  +A C+V+NH P C C DG+ G P   C        RP         PYS                       C+P EC+   ECP +  C N+KC DPC   C  NA C   NH  ICTC P  TGDP    CEP+PE  ++ VE                   NPC+   PC  N+ C+           C+C  G+ G+         P     C +N EC   L+C+   C++PC  +  C + A CQV+ HNA C C  GY G+P   C  I                                                    EC+ + DC + +AC   +CVD C  N  CG  A C   +H   C CP G  GDP  SC                                                 EC  + +C  +K C  + CVDPC  T CG  A CT + H  IC C     G+P++ C  V    ++   S    +     C P     + C  +A C+   +   CSC    IG           P  +PEC+++S+   +EACI+  C +PC     C     C VL    +    C C+EG +                            G N  C   + +               EC++  DC +D  C    CV+ C    CG NA C    H   CSC  GY GDP   C   P   +P++                                     P C V  +C +   C N+ C++PCA  + C + A C+VI H P+C CP G  G P   C             PP+                                    RPEC ++ +C   +ACI+ KC NPC   +CG NA+C+V  H   C+C  GY G+ +  C                    E   PC    CG   EC   N  A C C+  ++G  Y  C R EC+  SDCP    C+ +KC DPC   C  NA C A NH   C C   +TGDP+            P+ +P I                                + EC  + +CPS  AC    C NPC   K C LNA+C+V +  P+    C+C    TG    RC              +      G +D     PC + +PC  +++C VR  +A CSC   + G P + C+     EC  + DC   QACI  +C +PC  +  CG  + C  +NH ++C C  GF+GDP   C+++                                               EC    DC   KAC  +KC+DPC    CG  ++C    H   C C QG  G+P+V CR E     D    N C  N  C +                          S+ CS +  C N              A+C+ INH   C C + +TGD +  C +  R+P                                          PEC ++ +CP   ACI  +C +PC+    C  N  C V N+ P+    C C  G Y  D F                            C+E      CQ                   ++DC   + C    CR  C   +CG+NA C+   H   C C  GYTGDP   C+     VEP   P              R  +   PC   SPC  ++ C+ +N +AVC+CL+ ++G P  +CRP    EC+L  ECP   ACI+++CQ+PC   TCG NA+CRV+ H  +C C  G+ G   T C             E  P +   C  NS                                EC   LAC    CI+PC  +  CG +A+C V  H   C+CPAG+ GDP+S+C P    E               ++ +DPC  + PCG NA+C    +   C C     GDP++ C + EC ++ DCP DK C + KCV+PC  T CG  AIC    H   C CP    G+ +I C  V+      C  +                   C   + C   N +  C C P F G          P + + EC  + +C  T+AC+   C DPC     C     C   +  P     C CP+  F G+  I CQ ++E  V              +D + +D CR + CG  ++C        C C++ Y G              P+  P C +  DC S  AC N++C++PC     C   A C VV H   C C  GF G P   CK  I                                             PEC+ D +CP + AC Q +CQ+PC   TCG NA C+V NH   C+C  GYVGDPY  C         E P        E  NPC    CG N++C   N +AVC+CL    G P S C+P EC    EC     C N+KCVDPC    C  NA C  RNH  IC+CI  +TGD +   C  IP P+IE       +D P ++ CI            PC  N+EC+  + +P     C+C+  F G+         P     C  N+EC   LAC N  C  PC     CG  A CSV NH   C C  G+ G+P +                                     +  ++G        EC  +TDCP ++AC+ N+C +PC  +  CG NA+C    H P+C+CP  ++G+                       P+S C                      R EC TN DCP D+ C + KC DPC  T CG  A+CNV  H+  C CP G+ GNP+++C++L  R   D R    C              + C   + C  +     C C   ++G           P   PEC  + +C +  ACI  KC DPC            F+++  CL        P  +C  +  SP + +    PS    G + +CE   G                    EC++N DC S   C    C + C    CG NA+C  + H A C C  GYTG+P S C I +                    N+   R  ++PC +  PC   + C+ V+ + VC+C   F+GSP     P  +PECT   +C    AC+ +KC +PC  + CG+ A C+ RNH  IC+C+  F+GDP+T C                                                    P C  + EC  +QACIN++C++PC    CGLN +C+   H  ICSCL G+ GDP+S C P    E + DP  P       E   +P  C  N  C+     G+C+C+P++ GDPY   C P         EC    DC    AC+  +C +PC     C  NA C+V + +P     C C+EG  G    +C  + P +DV                    NPC   +PCG  ++C+V N ++ C C   FIG P     P    EC  + +C  N  C N +C DPC     CG+ A C   NH P C+C +   GNP   C +                                                EC T+ +CP ++ C  +KC DPC    CG  A CR   H   C CP+G++G+P+  CK  + ++            Q   CSP     + C   A C +R    +C C     G+ Y  C        + EC  + DC  + AC  + CQ+PC     C  +  C  L+ +P    +C C SG +                        G N  C+ V                   RPEC    +C +   C    CVD C  + CG  A C    H  ICSC +G+TG+    C+                    P   +   +  +DPC+  TPC   + CR       C+C  GYIG+P     P  +PECR + ECP   ACI +KC++PC   +CG  A+C V NH   C+C  GY GDP+  C                                                P C +  +C    AC    C DPC    C  NA C   NH  MC C EG+ G+ +  CKP                                             +C  +++CL HL C N KC DPC  +C + A+C   NH  +C+CL  FTG+P+ + C  I EP + +                                          EC+A+ +CPS   C +Q+C++PC     C  +A CRV       T  C+C  G TG    QC  I     I                                    GC+     NS+C  N AC+  KC +PC     CG  A+CNV NH P C+C  G+ GDPY  C +                                                +CTS  +C ++  CI  +C DPC     CG+ A+C    H P+C+CP  + GDP   C     +     +D  P+          DPC  + CG+ ASC  + +Q +C+C+    G P               ++ C    CR      C    +C + S     +C +  +                           C  NA C   +++ +C+C  D  GD Y  C          EC + S+CP+  ACI ++C +PC     C ++  C +  ++ I +       T N   + T V L     + C   PCG+YA+C     +A C+C   Y G            VP      CS + DC    AC N++C++PC     C + A C+ +NH PFCSCR GY G+    C +  +P+  +D         I  K  DPC    CG N+ CR       C CL N+ G P +   E  C S+ EC     C N  C+DPC    CG +A C V +H A C C   + GDP+V+C             H+  E+ + V PC    C  +A+C+  N  G C C   Y G+PY   C P       EC LD DCP Q AC+ Q+C++PC     C  NAEC V + LP    TC CL GY G     C+   + I+EY                                        C  +S+ + + AC+  +C  PC     C S+A CQV+NH  +CSC  G TGDP   C PI +               + +    PC+  +PCG NA+C  +  +++C C     G P +     EC  + +C     C+ Q+C +PC  + C  NA+C    H   C CP G  G P+  C              + CN            P  C  NA C+       C C+P Y GD Y+ C        +P+C ++ DCP+  +C+  +C DPC     C     C V N + +            I CE P                      + + N +C  I+         + EC  ++DC     C+  +C++ C    CG+N+ C    H   C C   + G+P   C    P++   + P                    NPC    PC   A C  V  Q+ C+C   YIG+P        +PEC  + EC  +KAC+ Q+C +PC S  CG NA C V  H A+C C  G+ GDP+T            C Q       E   PC    CG NA+C  + H G C C+  + G+PY  C+P EC+ ++DCP+N  C  +KC DPC   CA NA C + NH   C CQ+ F GDPY   C    +PVL EY                                       EC+   +CP ++ACI  +C +PC     C   A C+V    P+    CSC  G+TG    +C+ + P               L   R    NPC+  SPCG ++ C+     + C C   Y G P     P    EC  + +C S+ +C   +C DPC  A  CG+NA+C   NH   C C  GF G+  TSC+                                                EC+ + +C + K C+  KCI PC  T CG+ A C V  H ++C CP  + GN +  C+ +      D ++              CQ  + C  +A C       +C+C   FIG         V P   P C  + +CP   AC+ + C++PC     C    +C V +  P    +C C  +   N                                    +   C  + G +        EC ++ DCP +  C +  C D C    CGS + C    H   C+C+AG TG+P+ +C      PEP                                       P C  + DCPS+ +C N+ C +PC     C INA C+V +H P C+C  GY G+P                +  CQ SP                             +PEC +  +C LT AC+   C  PC   +CG +A CR  NH   C C+ G+ GD  + C+       +    T    N+   DPC+   CG   QC  + ++A+C C  G+ G P   CRP EC ++ DC   L C  EKC DPC   C   A C   NH   C+C + Y G+P+                AC P P                      P V     C  + DC   +AC   +C +PC     C   A C+V + +P    TC C  G SG    +C L+    VV                                         CT + +C+  LAC N  C +PC     C   A+C V  H   C+CP GF+G+ + LC  +                 ++ + I  C   +PC  NA C  QN + ICKC    IG P N     EC+++ +CP+  +C  + C +PCS  +CG  A C V  H   C C   Y G PY  C                   +   CY+     + C   A C  R     C C     G+ Y  C       +PEC ++SDCS++LAC+N  C++PC  +  C  N QC V N +P    +C C  G+S                            G + +C +   Q                 P+C  + +C + + C +  C   C    CG NA+C++  H   C C P + GD                      D C+ +P                          P     CT ++DCPS+ AC N+ C+DPC    C  NA+C V+ H P C+C +GY+G P   C                                     LP           PEC++  +CP D ACI   C  PC   TCG  A C V +H A+C C  GY G+P+ +C++   ++ +E             +PC    CG + EC     +A+C C+ G+ G+P   C+P EC+ DP+CP  L C N+KC DPC   C   A+C   NH      P    G     C + +   +  + I R+  +PCL   PC  +A+C                EG    G+  C  +TE + V       C  + +C +  AC N +C +PC     C   A C    H+ +C C PG+ G+P++ C+     E          +  ++YE  +P I   +  PCG NA C        C C     G+P+  C   EC+ ++DCPL++ACV QKC DPC  T CG+ A+C    H   C C  G  G+P   C  V   +E        CD             +PC   A C    ++  C C P   G              PEC ++ +C    AC++ KC +PC
Sbjct: 9394 AACSCLPNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCPGI--CGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDP----GRDIPV----PKNPCVP-----SPCGPNSICQIKQNRPVCSCVANYIGSP-PYCRP-ECTLSSECPSDKACINEKCQNPCANV-CGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNP------------------CAENAVCTPYNNAARCTCIEPYNGDPYS-------TGCRPECIYSSECPSSLACIKQHCRDPC--TAACGANAECTVVNHLP----SCSCTRGFEGNPFDGCKRVVVVRPETVCEPN---------------------PCGPNSICRSVEGHPTCSCQVGYFGAPPQ------------CRPECVVSSECAQHLSCINQKCMDPCVGT--CGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVINQDCPSNRACIRQRCEDPCI-GICGFNAVCSTQNHQPKCSCIESFEGDPYTACKM-----------REIVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRP-ECVQNSDCPNNRACINMKCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCP--GTCGYNARCRCTNHSPI----CSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIG--SCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPC----------------RPSPCGLNALCEERNQAAACKCLPEYFGDPYVECRP-ECVINSDCPRSRACVNQKCVDPCPG-MCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSC--LNERCKDPCPG--TCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLACINLRCRDPCVGT--CGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPCP-GVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAP-----------------------VEPC-RPSPCGPYSQCREVNGHAVCSCVTNYIGTPP-ACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSCPAGYSGDPF-VRCAPW----------QEEPEQPKSN-------ENPCVP-SPCGRNSQCRVVG----ETGVCSCLPNFVGRA--------PNCRPECTINTECPANLACINERCQDPCPGS--CGFNAFCSVVNHSPICTCDSGYTGDPFAGCNP--QPPAIPDERL------------TPCQP-SPCGPNAECRERNGAGSCTCLPEYFGDPYSGC-RPECVVNSDCSRDKSCVNQKCVDPCPG-VCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQK--CVDPCPGT--CGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCI--GACGLHSVCTVIKHRP----ACECVPGYTGDPFSGCAIVQQIAP-------PDETR-------NPCNPSPCGANAICRERNGAGSCACLPEYFGDPYSGC-----------RPECVQNDDCDRSRACINNKCQDPCPGA--CGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKP-ECVVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPIS-GCEPMPE--VKNVE-------------------NPCVP-SPCGPNSVCRQIG----NQAACSCNAGYIGR--------PPTCRPECTNNDECQNHLSCQQERCVDPCPGS--CGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPC--NNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDPCQHT-CGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPAS-----CVP-----SPCGPNAKCQIVGNSPACSCLPNFIG---------APPRCRPECVLNSECGPTEACINQKCADPC--SGSCGFEAKCHVLNHLPI----CNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPC-PGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNKKCVDPCA--AACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNPCPE-SCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQ---------------QEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGC-RPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANPCA--KTCGLNAKCEVINHNPI----CSCPLDMTGDPFARCYP------------APPPPPPGPKDEPVRRPC-QPSPCGLNSECRVRDEQASCSCLPNFIGAPPN-CRP----ECVVNTDCSPDQACIAEKCRDPC--DGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDPCDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVDPCPG-VCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCRPECSINPECPPTKACIRQKCSDPCV--NACGFNARCNVANHQPI----CTCDVG-YTGDPFTGCQKEQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRPECVRHSDCASNKACQQQKCRDPCP-GTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCH-----VEPPQLPA-------------RVTEPSQPCRP-SPCGPNSQCRELNGQAVCSCLELYIGLPP-NCRP----ECVLSTECPTDKACISQRCQDPCPG-TCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSPCGLNSQCRNVQGVPSCTCLPDFLGAPPNCRPECTISAECPSNLACIRERCIDPCPGS--CGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEP------------TQSEYVDPCNPS-PCGPNAQC----NAGICTCLAEFHGDPYSGC-RPECVLNSDCPRDKACHSSKCVNPCPGT-CGENAICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNPCRPSP------------------CGPNSQCREVNQQAVCSCLPSFIG---------APPSCRPECTSNSECAPTQACLNQRCGDPCPGT--CGVGANCAVVSHSPF----CTCPE-RFTGNPFIRCQPQIEPPV--------------RDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRP------------PNCRPECVTSSDCSSQLACVNQKCVDPCPGR--CGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRACQQLRCQDPCPG-TCGLNANCQVVNHLPTCTCLTGYVGDPYRQCNR-----LPEPPQN------EYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPS-CRP-ECTISSECSADRACVNQKCVDPCAADTCGNNAICRVRNHSPICSCISGYTGDAF-TRCFLIPPPIIET------KDEPLRDPCIP----------TPCGPNSECRNINGVP----ACSCLVNFIGQA--------PNCRPECTINSECPSQLACINQKCRDPCPGA--CGQNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPRDRACVRNKCIDPC--SGTCGVNALCEVNNHIPICRCPEQMSGNAFFECRPVPPAKIQNPCQPSPCGPNSQCRVVQQTAVCSCLANYVGSPPQCRPECVTNSDCPADQDCQNMKCRDPCPGT-CGFNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIR---DERPQNPCQ------------PSPCGPNSECRVSGDSPSCSCLPEFVG---------APPNCRPECISNSECPTNQACINQKCVDPCPGLCGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPIRDSPPEVLQPCNPSP--CGVNAKCEERGGAGSCQCLPDYFGNPYDGCRPECVLNSDCPSNQACVNQKCRDPCP-GTCGQNAECQVVNHLATCNCLVGYTGDPYSICRITV--------------------NEPPERVYVNPC-QPSPCGPNSQCREVNEQGVCSCLPEFIGSP-----PACRPECTSSSECAADKACVNRKCVDPCPNV-CGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPPVVEREPLDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNCRPECSINAECPSHQACINQKCRDPCPG-SCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPP-------EDPCNPSPCGSNTQCN----NGVCSCLPEYHGDPY-TGCRP---------ECVLHTDCDRSRACVRHKCVDPCPGT--CGTNAICEVLNHIP----NCRCLEGMQGNAFIQCSPV-PKLDV------------------VQNPC-QPSPCGPNSQCRVVNQQAICSCITSFIGSP-----PFCRPECTTNSECPLNLACRNQKCSDPCP--GVCGRGAQCHVTNHSPFCRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVTSSECPTNQACIQQKCRDPCPGL-CGQSAECRVLSHTPSCVCPEGMEGDPFTLCKEKRIQELD----------QLDPCSP-----SPCGINARCTSRQDAGSCQCLPDYFGNPYEGC--------RPECVLNSDCPSNKACQQQKCQDPCPGT--CGQNALCNVLNHIP----SCSCISGYSGDPYRSCVPEPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPCP-NTCGDQAICRVVNHSPICSCRAGYTGDAFFRCFP-----------------KPPVPPTPVQKTPVDPCVP-TPCGPYSQCRSQGDAPACSCLVGYIGAP-----PNCRPECRINAECPSSQACINEKCRDPCPG-SCGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCP-GTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPF-VGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPC--PGLCGSSATCRVVS----HTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGS--CGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPIVHEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFEGAPPNCRPQCTSSSECASNRACINQKCVDPCPGV--CGQQAICEVRNHSPICRCPTAMIGDPFVRCIPRPTIAPPPLRDVAPYR---------DPCLPSPCGLYASCRNQQNQAVCSCLPNYFGTPPHCRPECSINAECPSHLACIGERCRDPCPGACGQQTECRVISHVPSCVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAIC---SNQGECKCVADYQGDPYVACRP--------ECVLSSECPRNLACIQQKCTDPCPGT--CGTNAICDV--VNHIAMCHCPDRMTGNAFVQCTPVQLD-VYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFG------------VPPSCRPECSTNYDCSPSLACQNQRCVDPCP--GACGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQ--RD---------ITPK--DPCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNCRPE--CVSNSECSQVHVCSNNRCKDPCP-GLCGTDAVCRVISHSAMCYCQPGYSGDPFVRCAP-----------HIQRESIEIVQPCNPNPCGAFAECRQQNGVGSCQCLPEYFGNPY-EGCRP-------ECVLDSDCPSQLACVNQKCRDPCP--GSCGQNAECFVRNHLP----TCNCLSGYVGDPYRYCSIEPKPIREYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVGTPPGCRPECTVSSECNLDKACVRHKCLDPC--PGACGSSANCQVVNHAPLCSCQAGYTGDPFTRCYPIPSPP----------THIVHDYARHPCQP-SPCGANAQCRQSQGQAICSCIPNYFGVPPN--CRPECTQSSECLSSLACINQRCADPCPGS-CAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPCN------------PSPCGANAVCQ----NGQCSCIPEYQGDPYTGC--------RPECVLNADCPRNRACVRHKCVDPCPGT--CAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSLAPPDPCYPSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLACQRQHCIDPCPGT-CGFNALCHVVNHAPICSCPPKHNGNPFLGC-FPEPVRRDEVIPK-------------------NPC-QPSPCGPYAKCTSVGDQAQCSCLPEYIGTPPN-----CRPECITNSECSFDKACLNQRCRDPC-SGTCGSNANCHVISHTAMCYCLPGFTGDPFT-----------SCVQVPVIQQAEIVQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETCRP-ECVTNNDCPSNKACQQQKCRDPCPGVCALNALCRVINHLPTCHCQNGFVGDPYRY-CQIPEKPVLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGV--CGSNADCRVIQHAPI----CSCRAGFTGDAFSRCLPLPPSR----------PPQLDVYR----NPCV-PSPCGQYAECRDNQGTATCSCLPSYFGTP-----PNCRPECTINPDCPSHLSCQQQRCRDPCPGA--CGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQGQCNCLPEFVGNPLVGCRPECVLSTECDWSKACVRNKCIDPCPGT-CGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRDVID-------------PCQ-PSPCGPNAQCRNINGQAVCSCLRDFIG---------VPPSCRPECVSNAECPLHLACLQRHCRDPC--PGVCGLNAECRVINHSP----NCHCIGSFTGNPFAACHRPPPPPIKHEPIDPCQPSPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCRDPC-PGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVPSPCGANALCSEGNGAGACKCLPEFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCP--GTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPACRPECTISSECDLTLACVQQHCVDPCPG-VCGNSAQCRVINHSPHCSCLPGFTGDAISGCQ------RIPPAITHDAPNETPRDPCVPSPCGAFGQCRAQGNQAICSCLPGYYGAPPN-CRP-ECAINPDCASHLACISEKCRDPCPGSCGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSPGGQCSCLPDFDGNPYVGCRPECVLNTDCARDKACQRSKCTDPCPGA--CGIGAVCEVRNHIP----TCNCPPGTSGNAFVQCTLVQSSPVVPLNPCQPSPCGNNAQCREVNDQAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQCRDPC--PGACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLP------------PPPPVQREPINPC-YPSPCGPNAECTNQNEQAICKCLKDYIGTPPNC--RPECITSSECPIQLACIGQKCKDPCSG-LCGIAATCQVVSHVPSCICIADYIGDPYTGCYARPPIQR----------EQINPCYQ-----NPCGSNAVCRERGEAASCQCLPEYYGNPYEGC-------RPECVLNSDCSSHLACLNQHCRDPCPGS--CAPNAQCQVVNHVP----SCSCYPGYSGDPYRHCHVAQAEPVQVVHFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGSPPACRPECTTNPECPNDKACVSRRCTDPC-AGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRPECTQNSDCPSHRACVNQRCVDPCPGA-CGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNGVCSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCP-GTCGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQAPVEL------------HPCQPSPCGHHGECREVGSQAICTCRLGYYGSPPA-CRP-ECVSDPECPPSLACVNQKCRDPCPGACGHLAQCHVINHSPQCVCPAGYTGSPYSECHLIR---ADSSPIQRQPIDPCLP-SPCGPHAQCS--------------NEG----GNAVCRCLTEYLGVPPYCRPECIANSECPSDRACINRKCQDPCPGL--CGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPATPPTTAIQV-LQYE--EPFINGCEPNPCGANAQCNQRRGVVSCVCLPDYFGNPYEACRP-ECILNSDCPLSRACVQQKCRDPCPGT-CGLNAECHVMDHLPQCRCFSGYTGNPLAYCSPVPIIQESPLT---PCD------------PSPCGPNAQCHPSLNEAVCSCLPEFYGT--------PPNCRPECTLNSECAYDKACVHHKCVDPC 18722          

HSP 4 Score: 2679.43 bits (6944), Expect = 0.000e+0
Identity = 2949/10514 (28.05%), Postives = 4093/10514 (38.93%), Query Frame = 0
Query:  681 NPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQG-ECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCY---EYECLRNSDCPFDKAC--VSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVE-CKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDC------------PGLLACMSEKC---QDPCTFNKPCSDSQECKVFDTSPT-----------KTVACICPTD----TVVGIDGRCNRVQTS-PECEIANDCKISDICVSG--SCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPG------------------CRNDDDCPTYSLCK---NTMCINPCAEDSPCAPTANCQVI-NHNPVCTCPNGYIGSPTTV-------CRPHPECPDRLKCENEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCECSPGFTGDPYSLCSPTR---------------------------------------------EDECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYVACKEVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYTG-----------------------------------DGYSFCQ-----KIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINPCAESSPCASSARCKVINHEPECTCPDGFIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCENEKCVDPC---ECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGK---GDERCVKIQPVV------------------------DVG-----------CRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKI-----------------SNS--------------------------ECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSFECKKNEDCPFDKECKSESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCK-NPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACY---QSPTEIEPLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNCQPPERPECRVDAECPLDRACIHQKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPCE--CARNADCKARNHRGYCTCIPNFTGDPYGIVCEPIPE------PVIEE-------------------------------------VECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCV-----------KIEPIIETG----------------------------------CRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYCYKYECKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREV-------------------ECRNDN--------------------DCASNEKCDLRYLKCSALCSD--NNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDE------------------------------------------PECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGF---------------------------ECKEVELS------------------TECQVNNDCQQFEICVDGTCRKTCSINSCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEE------------QPVVDVGCRSNSEC-----SPT---------------------------LACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVP---------------------------------------------------ECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPCE--CARNADCDARNHRGICTCILDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDP--------------------------------------------NSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCY----------------------------------------------RYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPS----DMYI------------------GSSGQCERVEGTS------------------ECIVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNP--------------------------ESGCNIA-----------MVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNC------------------------------------------------RPPK-KPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPYECLSDPECPNHLKCKNEKCVDPCE--CARNADCDARNHRGICTCIPDFTGDPYGI--------------------------------ACEP--IPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACY-----------------LPLP-----------------------TVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDN-------------------------------------------DCLDHLRCTNTKCVDPC--ACAKYAECDARNHKAYCSCLVDFTGDPYGIACDP-----------------------------------------IPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKY-----------------------------------------------ECVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPC-----------------------------FLN--------------------NPCSSSQECRIAELSQIT-------IQTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGN-----------------------PRSQCTRVV------------ILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQ-----------------------------------LPQ--------KPECTKDSECANHLACIQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCRSYECLVDSDCPRHLACENEKCVDPC--KCAKYADCKVTNHQGYCTCNSYYTGDPYGLACEPIPEPIEVECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTC--KEIECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQ--------------------------------------------PECTRDYECPDNKACIQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPC--KCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPV-----------------------------LVEY---------ECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNF----------------------------------------------ECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEV--------------------------------------------ECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSS------------------------------------------PGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTDRDCPDSDVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLSPKPECIVDQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGDPYTFCRPYECLVDRDCPDQLKCDHEKCVDPC---QCAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSG-----------------------------------KGDEKC--ELITEPVVV---GCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHSYECLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLDCHNDNDCKDDEKCDRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCEL-------------PS------------------------------EPECLVDDDCPSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEE-PGCKSDIECPFDKACISRECQNPCLYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPC--QCAKYAECDARNHRGIFPEPVEVEG-----CQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPY---------------------------------SICVIIEDH---------ECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCY---------------------------------------EY---------ECLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLVVDSSPSKSVSCSCREGF------------------YV--------GKNGDCIEVDGQ-----------------PECRSHSDCRYNEQCQSGSCLDACRIRLCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEAL------------------------------------PPGCRSD----SECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECKPPTPLSIGCSADSDCPVVEACLNTKCVDPCN---CGENALCRKINHKAVCFCPSGFSGNPEVLCEKLECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCI----------PIETPNPPGCVKDDEC--------------------------------PSNEACVNRMCRNPCN--CGGGAKCFLSGHRPICQCPEGFIGNPQIECNPAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVI------------------------------------------PP---PECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCINAICRSPCA---CGLNADCKIIDHQPVCTCKPGFYGDPEIECTDTVCQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNIVSCSDNSDCPTDKECINKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFIGNKGTSCVKVSVTCEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECFPVKTCP------------ANSGLILDNREECVCPTGFGFTENKDECIPCLKENG------FILNNEGKCVCNDARGY----EYNPDSGKCECPPGERLNNFGICERVPDCEEDPDCPTQKYCEKTNGTCSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDP 9472
            NPCTV + C  N +CK+                  G   ++     P     C+S+ +C  + AC    C +PC     C  +A+C+ K+H+  C C  G  G+   KC+      EC  D DC   +ACI+  C  PC     C  NA+C   NH A C C  GF  +    C     + C  N DCP  K C  ++ +CINPC+   CG  AEC    H   C+C  G  G+ Y++C   + C+   +C   + C  I+ KC   C    +C A A+C+  NHR  C CPP   G+    C   + P D   C ++  C             GL     + C    D CT N PC  +  C+    +P             ++ C  P++    +  G + +C+ +     +C    +   S   + G    I+ C  NPCG  AIC S+ H   C CP+   GNP   C   + T E L  PG                  CR+      Y  C+    T+C     + +PC P ANC V  +    C CP+G  G PT+V       C+   +CP+   C   +C DPC   C + A C    H  +C+C    TG+P GI C  +              D P +N C+            PC +N+ECK+ +        C+CI G+ G     C   +P  D+    NS+C   L+C N KC++PC     C  +AIC  + H P C C  GF GD +  C P                                                 EC  + DCP +  C   +C +PC  +  CG NA+C V  H+PVC C     G+P+  C      +    P             C    CG NAEC  ++    C C  G  G P++ C+  +C  ++DC  ++ C   +  C + C  + VC  NA C    H   CIC+  Y+G                                   DGY+ C      K   P  + EC V  +C    +C++Q C +PC     C     C+V +  P     C C  N   + F  C  ++           P  D+       N C   PCG N+ C  + +  VCSC   + G+P            P   P C  + +CPS  AC + KC NPCA    C  +ARC VI H   C+C + + G     C  +      RP          DH        +DPC    CA NA C   N+   CTCI  + GDPY   C P         EC    +CPS  ACI + C +PC     C  NAEC V + LP    +C+C  GF G    G +R V ++P                           VG           C  +SEC+  L+C N +C++PC+    C   AKCQV NHN  C C   Y G+P+ QC+                   SNS                          EC  + DC SN ACI  +C D C+    CG +A C T  H+  C C +   GDP+ +     CK  E    D         DPC  + CG  A C V    G C C   Y G+PY++CR  +C +NSDC +   C     KC   C   N C  +A+C+  +H+  CSC   L G+    C             V+   +       D C+ +PC + S CH           + +   C CL    +G    C     + EC    +C  D  C    C + C    CG NA C    H   CSCY GY GDP + C    + P   +P++ P                    NPC   SPC   + C+V     VC+C   +IG P     P  RPEC +++ECP   ACI+ +C +PC   +CG NA C V+ H  +C C  GY+GDP+     SGC    E P        E   PC    CG    C+  N  A C CL  + G  YV C R EC+ +SDCP    CVN KCVDPC   C  NA C   NH   C C+P +TG+P  + C  +PE      P++ E                                      EC    +C    +C+NE C +PC     C  NA C+V +  P+    C+C  GF+G    RC            +I+P + +                                   C SDSEC   L C +  C +PC+    C     C V +H+ +C C  GYAGDP+S C   +                +  Q ++PC+ +  CG  A+C+ RN    C C   ++GDP++ C + EC  ++DC  ++AC   KC DPC    CG  AEC    H  +C C  G  GNP   CRE+                   +CR  N                    +C+ + +C       +  C+D     C N A C+  NH   C CP+ ++GD +  C+     P++                                          PEC ++ +CP+++ACI+ RCQ+PC  +  C  N  C V N+ P+    C C SG Y  D F                           EC+E   +                   EC VN+DC + + CV+  C   C    CG NA C    H   C+C  GYTG+P+SAC +      P L P    D+              NPC   SPC   + C+ ++  AVC+CL GF+G+ + +CR    PEC++ ++C  +L C N+KC +PC   TCG  A+C+V  H   C+C  G+ G P   C +             P +   C  NS+C     SP                            LAC N  C NPCI    CG  + C V +H   C C  GY GDP+S CA +Q +    +T              +PC  + PCG NA C   N    C C P + GDP++ C + EC  +DDC   + C+N KC DPC    CG  A C+   H  +C C +G  G+P+  C  +E          E C              + C  ++ C  +N    C C      +GY       P + K EC +  +C   +ACI   C+DPC     C  N +C+     P+    C C  G        C+ +      E                 + C  + CG N+ C    +++ C C  GY G              P+  P CT++ +C ++ +C+  +C++PC     C   A C+VVQH A+C+C DG+ G P   C+  ++P                                                   EC ++ +C    AC + KC +PC++I CG  A C V  H   C C  GY GDP+ +C+                  R   NPC    CG N+ C   N++AVC+C  G    P + CKP EC+   EC     C ++KCVDPC+  C   A C  +NH  ICTC    TGDP+ + C  +       +  +     P+  +C+            PC  NA+C++    P     C+C+  F G          P     C  N+EC  + AC N  C  PC  +  CG  A+C V NH   C C  G+ GDP                                            N+    + EC    DCP +KAC+ N+C +PC     CG+NA+C    H PVC C  G  GDP   C                                               R EC  + +C   +AC ++KC+DPC    CG +A C V  H   C CP G  G+P+  C  L      D +   +       C P     + C   + C+   +   C C   + G           P   PEC ++ DCQS  ACI +KC++PC  +  C    EC+V+  +    VSC CP+    + ++                  G + +C    G +                  EC+++ DC +   C    C + C    CG NAQC  + H   C C +GYTG+P                           S C +A            +   P+ +P C+ N +CPS   C   +C +PC   K C + A C+V++H  +C+CP    G P   C                                                 PP  +PEC ++ DC+   ACI +KC++PC   +CG ++ C+ +NH AIC+C   F+GDP+  C        FE  +         Q+PC  + CG NAEC       ICSCL  ++GDPY+ C+P EC    +C     C N+KCVDPC   C +N+ CD  NH  IC+C+  +TGDP+                                  AC+P  +  P   + EC    +C    AC+N +C +PC     C Q A C+V +  P    +C+C  G+TG    RC + E             +P+         NPC   +PCG  ++C+V N  + C C   FIG P     P+   EC+ + +C   + CI  +C DPC   + CG +A C   NH+P+C C  G  G+P   C K +         +++   +  V PC+   CG  A+CR       C+C     G+PY  C+  +C +  DC  N+ C  Q  KC   C G   C S A C   NH  TC C    +GD Y YC  + P +P    +    CR S                PC P+ +C+ L+        C C     IGL  NC     RPEC    +C +   C    C D C    CG+NAEC    H  +C C  G TG+    CY                 LP P                          P+  P C+   +CPS  +C    CIDPC     C   A C V+NH  +C CP G+ G P +SCRP   PE              Q +  +PC    CG NA C       +C+CL  + GDPY  C  P C  + +CP  +AC++  C +PC    CG+NA C   NH  MC C E   G  +  C P    V N                                           +C     C N +C DPC   C   A C   +H  +C+C   FTG+P+ I C P                                         I  P     EC+   DC S+  C +Q+C +PC     C  NAEC V        + C+C QG+ G         +P          +C   +A E  +   PC+   PCG  A C  +N    C C P Y GDPY  C+     EC  D DC ++  C Q +C DPC     CG NA C    H P C C  G  GDP+  C +                                                EC    +C  D+ C+ + CVDPC    CG  A C   +H  IC+CISG  G+ +  C  +          + K +     CI        C  N+ C ++N    C C  + IG          A     EC ++S+CP + ACIN++C +PC                             F N                    +PC ++ +CR  + S I        +  + EC  N DC     C+   CID C    CG  A C  N H   C C    +GN                       P SQC RVV            +  P +    C  +SDCP    C N KC +PC     C   A+C V+NH+PFCSC  G  G+   SCQ                                   LP+        +PEC  +SEC  + ACI QKC DPC   +CG NA CRV  H A+C+C   + GDP+S C         + P        E   PC    CG NA+C        C+CL  + G+PY  CR  EC+++SDCP + AC N+KC DPC   C + A+C+V NH   C C   YTGDPY +            C +  + P ++  +     NPC   SPC  N++C+  +        C+CL  +   G     R E      C ++S+ + + AC+ R+C  PC   N C   A C+V NH  IC+C  G TGDP   C          + + L           DPC V +PCG N++C   +    C C    +G P +     EC  N +CP  + C+ QKC +PC  + CG N  C    H  IC C  G  G P+  C  + I  K       ++ CN            P  C  N  C    +   C CLP Y+GD Y+ C        +P+C +  DC +  +C+  +C DPC     C     C V N +P     C C   E +  N     IQ     K+D               N C    CG NS+C+    QA C C   + G P                P C+ + +CP + ACRN KC +PC     C   A C V +H   C C + Y G+P   CQ  I+                                            PEC    ECP N+ACIQQ+C +PC  + CG++AECRV  H   C C  G  GDP+T+C E   K   E  Q          +PC    CG+NA C+ +   G C C+  + G+PY  C+P EC+++SDCP+N  C  +KC DPC   C +NA C + NH   C+C S ++GDPY  SC  +PEPV                             L EY         EC    +CP+++AC++ +C++PC     C D+A C+V +  P+    CSC  GYTG    +C                       V+   V+PC+  +PCG +S C++Q     C C +GYIG P     P    EC+ + EC S+QAC+N +C DPC  +  CGY AIC   NH   C CP G++GDP + C                                                 EC+++ DC  +  C   KC  PC  T C   A CTV  H  +C CP G  GN +V CK                                              ECT +S+CL++  C  +  KCN  C    SC ++A C    H   CTC   F G+    C +I++PP                                            P C  + +CPS+ ACI+++C++PC     C S+  C V     + T  C C   +  +    C+ I   VE                  ++ C+ + CG+ + C+       C C+  Y G+PY  C            P C  + DCPS  +C+ + C +PC     C  NA C V+NH P+C+C  G+IG P   C   P+P              I+ +  +PC  + CG N+ CR  N +A C C S + G P      P C S+ EC + +ACIN+ C+DPC    CGQ A C  RNH  +C+C     GDP+  C P   +     P  L+ D     DPC    C  YA+C  + ++  C+C+ +Y G P          P     C  +A+C S  ACI   C++PC     C +  +C+V   +P    +C C  GY G                                   +G+ KC  +   +P V     C    EC  +LAC    C +PC     C + A C V NH A C CP    G+ +  C PV+     Y + C+ +                PC   A C  QN + +C C P   G P +     EC +N DC    +CQN+ CV+PC    CG  AEC    H   C C  GY G+P + C ++      D    + C                C   ++C        C+C     G         P + +PEC  +S+CS    C N+ C++PC     C  +  C V +     S  C C  G+S           P  +C       S E+      +  C    CG  A C+  +   +C+CLP + G+P++ C              C +D+DCPS  AC N+ C DPC    C +NA+C V  H P C C  GY+G P   C +             PS                               PEC V  +C  D AC+   C  PC    CG +A C V +H  +C C AGY GDP+  C   P   + I        +    ++PC    CG NA+C     +A+C C   + G P  +C+P EC    +C   L C N++C DPC   CA  A C  RNH      PV   G     C  +   P +   +D  C NP     PC  NA C        +   CSC   Y G     C          C  + DC  + AC   +CV+PC     CA  A C+V  H + C CP  MTG+ +                                 ++C  IED          EC  +SDC    AC    CIDPC     CG NA+C  ++H P+C C     G+P   C+                                       EY         EC+ +++C  +KAC++Q+C DPC  T CG  A C    H  +C C  G  G PF  C +V   ++ +             C P     NPC   A C  + H   C C P   GN +  C        PEC  ++DCPS  AC  +KC++PC     C  +  C V++  P    +C C+ GF                  Y+        G N  C E + Q                 PEC + ++C +++ C    C D C   +CG NA C    H   C+CR  F+G+    CLP+ P     L                                    PP CR +     +CP++  CQ  +C DPC     CG +A C V  H P C+C  GF G+    C  P P+        D P +         DPC+   CG NA+C    ++  C C   F GNP V C + EC    +C   K C  N C +PC     C  N  C    H++ C CP +M G+ +S C  +  A   D            IDPC   +PC PNA C+ +   + C C+   IG            P     ECV +++CP  LACL  +C +PC  +  C  +A C V++ SP     C C   +      +C           PI+   P  C  + EC                                P N AC+N+ CR+PC   CG  A+C++  H P+C C  G  GNP + C       + +              PC +  PCG +A C+       C+C   F G+PY GC    C  +S+CP+  AC N+ C DPC     C + A C  RDH  QC C VGYQG+PY  C+V+                                          PP   PEC    +C   +AC+ + C +PC  +  C   A C VI   P     C C  G+    + GC+ +PP I+      D  N T       R PC    CG    C+   +Q +C+C PG+YG P   C    C  + +C    AC + +C   C      CG +A+C  + H   C CP+G  GNPFV C                       D+C+ S PCGS + C        CSC   F GN    C      C ++ DC   ++C   +C +PC     CGI A C V + +P    TC+C  G  G+A ++C  V++ P             N+    +  ++ VC    GF     +C P    N         LN + +  C  A G     +       C CP G   N F +C+R+P        P             NPC  +PCGPNA     +    C+C+K Y G P
Sbjct: 8451 NPCTVDTNCAPNEHCKL------------------GHCRKKEPPGSPKTPEPCQSNNDCIESEACYMGLCQDPCEFAKICAATAKCTAKSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTEACINQLCQHPCDVHDPCATNAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQEDSCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQAC--INGKCSSPC----QCGAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPKGLTGNPFKNCIPEGDECTPN-PCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHPV-CYCPDNKIGNPFRLCDKPAVTIE-LCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVC-----DPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNP-GIRCYAL--------------DHPKKNPCVP----------SPCGRNSECKLLNNR----AVCSCIPGYLGDPQSGC---QPECDI----NSDCGDTLSCINHKCVDPCAGAI-CGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGVALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGS--CGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETPPQPS------------CAKLHCGANAECKRQHSGLACVCRKGYFGDPHIGCRP-ECVLNSDCPAEKACLNSK--CVEAC--TGVCGVNAVCRVVNHAPVCICAEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCP--GICGGGARCEVLNHNP----ICSCEANFEGDPFVACSPIQD----------PGRDI---PVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSP------------PYCRPECTLSSECPSDKACINEKCQNPCANV--CGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITE---RPG---------DH--------IDPCYPNPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCRP---------ECIYSSECPSSLACIKQHCRDPCTAA--CGANAECTVVNHLP----SCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGT--CGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVINQDCPSNRACIRQRCEDPCIGI--CGFNAVCSTQNHQPKCSCIESFEGDPYTA-----CKMREIVVLDPP------TDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRP-ECVQNSDCPNNRAC--INMKCRDPCA--NACGFNAICRVAHHQPVCSCEPHLTGNPLRAC-------------VERPSNMYLPLPKDPCRPSPCGLFSTCH----------VVGERPVCACLPD-YMGAPPNC-----KPECMTSAECPSDRACINQRCKDPC-PGTCGYNARCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPP--------------------NPCVP-SPCGPNSQCQVSSSGAVCSCVTNYIGRP-----PGCRPECSINSECPARMACINARCADPCIG-SCGNNALCHVSLHAPVCMCEPGYSGDPF-----SGCYKIIETP-------IEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPYVEC-RPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPI-VGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGT--CGNNALCRVVNHNPI----CSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLACINLRCRDPCVGT--CGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKIN---------------VPVQVAQPCNPSP-CGANAVCKERNGVGSCSCLPEYNGDPYTEC-RPECVLNSDCSKNRACLNNKCRDPCPG-VCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPNCRPECTINTECPANLACINERCQDPCPGS--CGFNAFCSVVNHSPI----CTCDSG-YTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSRDKSCVNQKCVDPCP-GVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACRE-----IPQLPPPPERDE--------------NPCR-PSPCGPYSQCREVDGHAVCSCLQGFIGS-APNCR----PECIISSDCAQNLNCQNQKCVDPCPG-TCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCI--GACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETR-------------NPCNPS-PCGANAICRERNGAGSCACLPEYFGDPYSGC-RPECVQNDDCDRSRACINNKCQDPCPGA-CGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVT----IRPEPCKP------------SPCGPYSQCLDTNSHAVCSC-----LEGYI----GAPPSCKPECVVSSECPQNRACINQKCEDPCR--GSCGNNAKCQVVNHNPI----CTCQPGMTGDPISGCEPMPEVKNVE-----------------NPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRP------------PTCRPECTNNDECQNHLSCQQERCVDPCPGS--CGSNAICQVVQHNAVCSCADGYEGEPLFGCQ--LIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNI-CGDYAICTVDKHVPTCDCPPGYTGDPFFSCK------------PVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPN-CKP-ECVVSAECAPEKACVHKKCVDPCQHTCGIRAICTTKNHSPICTCPRTMTGDPF-VECTRV------AITNDNTTPSPAPASCVP----------SPCGPNAKCQIVGNSP----ACSCLPNFIGA--------PPRCRPECVLNSECGPTEACINQKCADPCSGS--CGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPC--PGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNKKCVDPC-AAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQ-----DPCVP-----SPCGPNSICKNDRNGPVCQCQPEFFGS---------PPNCRPECIINPDCQSTQACINNKCSNPCPES--CGTNAECRVIGHA----VSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCP-GICGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANPCA--KTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQACIAEKCRDPCDG-SCGVDSECRVQNHLAICTCRGGFTGDPFVRC--------FEFVEETTKSPPLTQDPCDLQPCGSNAEC----RNGICSCLADYQGDPYTGCRP-ECTLSTDCAPTKACLNKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGA--CGQFARCQVINHNP----SCSCNTGYTGDPFTRCYQEE--------RKPPTTPD---------NPC-QPSPCGPNSECKVLNGNAACSCAATFIGTP-----PSCRPECSINPECPPTKACIRQKCSDPC--VNACGFNARCNVANHQPICTCDVGYTGDPFTGCQKEQ---------ERIVNEQ--VTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRP-ECVRHSDCASNKACQQQ--KCRDPCPG--TCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPS----------------PCGPNSQCRELNG----QAVCSC-LELYIGLPPNC-----RPECVLSTECPTDKACISQRCQDPCP-GTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSPCGLNSQCRNVQGVPSCTCLPDFLGAPPNCRPECTISAECPSNLACIRERCIDPCPGS--CGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPE------------PTQSEYVDPCNPSPCGPNAQCNA----GICTCLAEFHGDPYSGC-RPECVLNSDCPRDKACHSSKCVNPCP-GTCGENAICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNPCRPSPCGPNSQCREVNQQAVCSCLPSFIGAPPSCRPECTSNSECAPTQACLNQRCGDPCPGTCGVGANCAVVSHSPFCTCPERFTGNPF-IRCQPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCRPECVTSSDCSSQLACVNQKCVDPCPGR--CGLNAECFVVS----HAVQCICQQGFNG---------DPFV--------QCKPEIAYE-NEIRTPCSPS-PCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCR----PECMLDSDCPSNRACQQLRCQDPCPGT--CGLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADTCGNNAICRVRNHSPICSCISGYTGDAFTRCFLIP-----PPIIETKDEPLRDPCI-----PTPCGPNSECRNINGVPACSCLVNFIGQ---------APNCRPECTINSECPSQLACINQKCRDPCPGACGQNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPRDRACVRNKCIDPCSGT-CGVNALCEVNNHIPICRCPEQMSGNAFFECRPVPPAKIQNPCQPSPCGPNSQC-RVVQQTAVCSCLANYVGSPPQCRPECVTNSDCPADQDCQNMKCRDPCPGT--CGFNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCGPNSECRVSGDSPSCSCLPEFVGAPPNCRPECISNSECPTNQACINQKCVDPCPG-LCGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPI-----RDSPP-------EVLQPCNPSPCGVNAKCEERGGAGSCQCLPDYFGNPYDGCRP-ECVLNSDCPSNQACVNQKCRDPCPGTCGQNAECQVVNHLATCNCLVGYTGDPYSI------------CRITVNEPPERVYV-----NPCQP-SPCGPNSQCREVN----EQGVCSCLPEF--IGSPPACRPE------CTSSSECAADKACVNRKCVDPC--PNVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPPVVEREPL-----------DPC-VPSPCGANSQCREIHGTPSCSCLPQYLGTPPN--CRPECSINAECPSHQACINQKCRDPCPGS-CGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPPEDPCN------------PSPCGSNTQC----NNGVCSCLPEYHGDPYTGC--------RPECVLHTDCDRSRACVRHKCVDPCPGT--CGTNAICEVLNHIP----NCRC--LEGMQGNAF---IQCSPVPKLDV------------VQNPCQPSPCGPNSQCRVVNQQAICSCITSFIGSP------------PFCRPECTTNSECPLNLACRNQKCSDPCPGV--CGRGAQCHVTNHSPFCRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVTSSECPTNQACIQQKCRDPCPGL-CGQSAECRVLSHTPSCVCPEGMEGDPFTLCKE---KRIQELDQ---------LDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCRP-ECVLNSDCPSNKACQQQKCQDPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYR-SC--VPEPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPCPNT--CGDQAICRVVNHSPI----CSCRAGYTGDAFFRCFPKP-------------PVPPTPVQKTPVDPCV-PTPCGPYSQCRSQGDAPACSCLVGYIGAP-----PNCRPECRINAECPSSQACINEKCRDPCPGS--CGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGT-CAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSNSECLSHLACVNQ--KCNDPC--PGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPC--PGLCGSSATCRVV----SHTAMCICDAGLTGDPFTQCQPIVQDVE-----------------IINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCR-----------PECVLNSDCPSNRACQQQKCRDPCPGS--CGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEP--------------IVHEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFEGAPPNC--RPQCTSSSECASNRACINQKCVDPCPG-VCGQQAICEVRNHSPICRCPTAMIGDPFVRCIPRPTIA----PPPLR-DVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFGTP----------PHCRPECSINAECPSHLACIGERCRDPCPGA--CGQQTECRVISHVP----SCVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICSNQGECKCVADYQGDPYVACRPECVLSSECPRNLACIQQKCTDPC--PGTCGTNAICDVVNHIAMCHCPDRMTGNAFVQCTPVQLD--VYRNPCNPS----------------PCGSYAECREQNGQAVCSCLPNYFGVPPSC--RPECSTNYDCSPSLACQNQRCVDPCPGA-CGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMI-IEPQRDITPKDPCQPS------------PCGPNSECRRVGETPSCSCLSNFFGT--------PPNCRPECVSNSECSQVHVCSNNRCKDPCP--GLCGTDAVCRVIS----HSAMCYCQPGYSGD---------PFVRCAPHIQRESIEI------VQPCNPNPCGAFAECRQQNGVGSCQCLPEYFGNPYEGCRPE-----------CVLDSDCPSQLACVNQKCRDPCPGS-CGQNAECFVRNHLPTCNCLSGYVGDPYRYCSIEPKPIREYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVGTPPGCRPECTVSSECNLDKACVRHKCLDPCP-GACGSSANCQVVNHAPLCSCQAGYTGDPFTRCYPIPSPPTHI--------VHDYARHPCQPSPCGANAQCRQSQGQAICSCIPNYFGVP-PNCRP-ECTQSSECLSSLACINQRCADPCPGSCAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPC-NP----SPCGANAVC--------QNGQCSCIPEYQGDPYTGCRP-------ECVLNADCPRNRACVRHKCVDPCPGT--CAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSLAPPDPCYPSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLACQRQHCIDPCPGT--CGFNALCHVVNHAPICSCPPKHNGNPFLGCFPEPVRRDEVIPKNPCQPSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNCRPECITNSECSFDKACLNQRCRDPCSGT-CGSNANCHVISHTAMCYCLPGFTGDPFTSCVQVPVIQQAEI---------VQPCSP-----NPCGANAVCRQEGHVGSCQCLPEYYGNPYETC-------RPECVTNNDCPSNKACQQQKCRDPCPGV--CALNALCRVINHLP----TCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCP-GVCGSNADCRVIQHAPICSCRAGFTGDAFSRCLPLPPSRPPQLDVYRNPCVPSPCGQYAECRDNQGTATCSCLPSYFGTPPNCRPECTINPDCPSHLSCQQQRCRDPC--PGACGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIV------RDPPQIS--------DPCDLITCGPNAVC----NQGQCNCLPEFVGNPLVGC-RPECVLSTECDWSKACVRNKCIDPCPGT--CGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRD-----------VIDPC-QPSPCGPNAQCRNINGQAVCSCLRDFIG-----------VPPSCRPECVSNAECPLHLACLQRHCRDPCPGV--CGLNAECRVINHSPN----CHCIGSFTGNPFAACHRPPPPPIKHEPIDPCQPSPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCRDPCPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQ-------------TPC-VPSPCGANALCSEGNGAGACKCLPEFYGNPYEGCR-PECVLNSDCPSHLACLNQHCRDPCPGT--CGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPACRPECTISSECDLTLACVQQHCVDPCPGV--CGNSAQCRVINHSP----HCSCLPGFTGDAISGCQRIPPAIT-----HDAPNETP------RDPCVPSPCGAFGQCRAQGNQAICSCLPGYYGAPP-NCRPE-CAINPDCASHLACISEKCRDPCPGS---CGLQAQCSVINHTPICSCPSGYEGNPFVRCQ-----------RTPPTPTPPLHDACNPS-PCGSNAICSPGGQ---CSCLPDFDGNPYVGCRP---ECVLNTDCARDKACQRSKCTDPCPGA--CGIGAVCEVRNHIP----TCNCPPGTSGNAFVQCTLVQSSPVVPLNPCQPSPCGNNAQCREVNDQAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQCRDPCPGACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPI------------NPCYPSPCGPNAECTNQNEQAICKCLKDYIGTP 17822          

HSP 5 Score: 2488.38 bits (6448), Expect = 0.000e+0
Identity = 2674/9553 (27.99%), Postives = 3703/9553 (38.76%), Query Frame = 0
Query:    1 MACTCI-EGYEEPIIA--SGCQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGD------------------------------AYSNCSPIN------------------EDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHN--AICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKV---VSIL-------------------------------------KPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVGGTCLNSCRVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRP-QPEPECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPYSYCNAYECLSDPECPDHLHCISEKCVDPCKCAANAECDARNHRGYCACIIDFTGDPYGIECTPIPEPVIEEVECVEDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPI------------------------ID-----------VG--------CRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQIS----------------------------------------------QGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREV--------------------------------------PSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCR---------------------PHPECPDR------------------------LKCENE------------KCVDPCE--CARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCECSPGFTGDPYSLCS-----------------------------------------------PTR-EDECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYE-----------------------------CQKN----------------EDCPFDKSCSSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYVACKEVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINPCAESSPCASSARCKVINHEPECTCPDGFIGSPTTDCRPR------------------------------------DPYSFCRPYECLSDPECPDHLKCENEKCVDPCE--CARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKIS-----------------------NSECKY--------------------------DTDCASNEACINDQCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSFECKKNEDCPFDKECKSESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNR--PVK----------------------------------PADKPECLVDSDXSRSEACISDTCKNPC-----------IVE------------------------------------SPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEI------------------------------------EPLLS--PGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNC--QPPE---------------------------------------------RPECRVDAECPLDRACIHQKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPC--ECARNADCKARNHRGYCTCIPNFTGDPYGIVCEPIP--EPVIEEV------------------------------------ECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYCY-------------------------------------------------KYECKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCR-EVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFE--------------------------------------CKEVELST------ECQVNNDCQQFEICVDGTCRKTCSINSCGANAVCTPVIHGFKCNCFDGYTGDPNSACY---QPVLNV--EPLLEP------------------------------------GCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINV-------------------------------------------PECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKY--------------------ECRISDD--------------------------CPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCIC-----------------PQGTFI--------GSNGICQEVET-----------------KVECEYNDDCSTNDICQDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYL--------------PITPNE--------------------------PSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINREC----------------------------------------------QNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPCE--CARNADCDARNHRGICTCILDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCYRYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPK-------------------------------------------KPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPYECLSDPECPNHLKCKNEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEV-----------------------------------------ECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVP----------------------------------------------KAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSG---------------------------TTIGLNYNCQR---------------VESRPECEKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYL-----------PLP-----------------------TVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPC---ACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQC-VKIEPI-----------------------------------TTIGCKS----NSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTK------------------------------------------------ECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQITIQTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQLPQKPECTKDSECANHLACIQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCRSYECLVDSDCPRHLACENEKCVDPCK--CAKYADCKVTNHQGYCTCNSYYTGDPYGL--------------ACEP--------------------IPEPIEV------ECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPC--KCARNADCEIKNHRGYCTCQSDFTGDPY---GISCDPIPEPV---------------------------LVEY---------ECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNF---------------------------------------------ECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYM---------------------------------NARGDCEAIKGLV--------ECQTDRDCPDSDVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITP---------------------------------GCQSD----QDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLS-PKPECIVDQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGDPYTFCRPYECLVD-RDCPDQLKCDHEKCVDPCQCAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKC--------------------------------------ELITEPVVVGCTSD----KECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHSYECLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLDCHNDNDCKDDEKCDRKTY-TCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVC-HTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCE-----------------------------------LPS--------EPECLVDDDCPSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEE 7937
             AC C+ E + +P +     C  + +C  ++AC N+ CV+PC     CG  A C+V NH   C C  G+TG+                               YSNC P+N                    EC   S+C  + +C+  +C DPC     CG  A+CR  +H P+C C  G +GDP   C+  E         ++  +    +DPC  + CG N++C V   N  A+C C Q   G    +C+  EC  + +CP N  C   N +C + C+  G C     C    HR  C C     GD +S C  K+   V +                                      +PEC ++SDC +  AC++ KC++PC     C ++ EC V++  P    SC CP     + +  C  I                       +  CR  PCGP +QC   +  + CSC   Y G P               +P C  + +C    +C N+ C +PC     C   A C+V NH P+C+CP GY G P   C P Q EPE    ++              PC  + CG N+QCRV     +CSCL  +VG   +    P C  + ECP    CIN  CQ+PC    CG NA CS  NH   C C+ G+ G+P++ CN       P  PD      +    P  C  NAEC  RN  G C C+ ++ GDPY   C P         ECV + DC   ++C++++C +PC     C  NA C+V + LP    +C C+ GYTG     C +I  +                        +D           +G        C    +C  NL C+NQKC++PC    TCG  ARC V NH   C+C  GFTGD +++C +I                                               + EC    DCP N AC++ +C++PC     CG +++CT   HR  C+C PG+  D  S C   + +   D          +  NPC  + CG  A C        C C     G PY  C+  EC +++DC     C  I+ KC+  C G   C  +A C   NH   C C     GD + SC   EV                                      PS KPEC V  +CP   AC+++KC+DPC  +  C ++ +C+V + +P  T       D + G +         P  E+ N   + + CV          +PCG N++C+   + + CSC  GY G P            P   P C N+D+C  +  C+   C++PC     C   A CQV+ HN VC+C +GY G P   C+                     PH EC +R                         +CEN             KCVDPC   C   A C    H   C C P +TGDP+  +C+P+P  V            P  N C      NP     PC  N+ C+  +        C+C  GF        I   P     C  ++EC    AC + KC++PC++   C   AIC T+NH P C C    TGDP+  C+                                               P R   EC  + +C     C + KC++PC  +  CG  A C V+NH P+C C+E + GDP   C K E                             CQ N                 DCP DK+C  N C+DPC   +CG NA C V  H  +C C  G +G P+V C+     +D                 + CS S  C +N++C        C C   Y G           P  + EC V  +C +  +C+++ C +PC+    C     C+V +  P     C CPP    + F  C  +            PD     +  C+ +    PCG N+ C    +  VC C   F G+P            P   P C  N DC S  AC + KC NPC ES  C ++A C+VI H   C+CP G+ G+    C P+                                    +PY  CRP EC+   +CP    C   KC DPC   C  NA C A NH   C C   +TGDP+                      C            +PC+   PC  N++C+V + L      C+C+E F G          P     C  N+EC    AC    C NPC +   C   AKC+V+NHN  C C +  TGDP+++C                           NSEC+                           +TDC+ ++ACI ++C D C  +  CG D+EC    H ++C C  G  GDP V C+ F  +  +  P  +        DPC    CG+ A C      GIC C + YQG+PY  CR  +C  ++DC   + C  K  KC   C     C +++ C   NH   CSC     GD +  C    PV                                   PA KPEC+V S+ S   AC++  C +PC           ++                                     SPC P+  C+VL        +C C   T +GT   C     + ECSI+ +C     C    C + C V  CG NA C    H+  C+C  GY GDP   C +    I                                    +P  S  P C    DC S   C+ + C +PC     C   A C V  H P CTC  G+ G P   C  +PP+                                             RPEC +  ECP D+ACI Q+CQ+PC   TCG NA+C+V NH  +C C +G+ GD ++ C        +  P     I R  ++PCL   CG   +C+       C CL    G A  NC R EC   ++CP++L C+ ++C+DPC   C   A+C   NH   C C   FTGDP+   C P P  EP   E                                     EC  + DCP   AC + +C NPC     C  NA C V + +P+    C C E   G    RC  ++  +   CR                       +PC  ++QC   + +A+CSC   + G P S C+     EC  +++C  TQAC+  +C +PC     CG GA C   +H   C CP  F+G+P   C                                                  + EC T +DC    AC  +KC+DPC    CG  AEC    H   C C QG  G+P+V C+ E+   N+          +R   CS      + C  NA C   N    C C  Q+ GD Y  C         PEC +D DCPS+ AC   RCQ+PC     C  N  C+V N+ P    +C C +G Y  D +                                       C  + + T      EC ++++C     CV+  C   C+ ++CG NA+C    H   C+C  GYTGD  + C+    P++    EPL +P                                     C+ + +CPS   C N++C +PC     C ++A+C  INH  +C C+DG++G P T+C P                                              PEC+L+ +CP   AC+  KC +PCS  TCG NA C V  H  IC C     G+    C   P   +                    NPC + +PCG ++QC+V +  A C C A Y G P   C P    EC  ++DC +++ C N +C DPC     CG NA C   NHR FC CP   +G+P  SC +                     ECR+S D                          CP ++ C+N+KCVDPC    CG  AIC+   H   C C  G  G+P+  C  +   +D+     + CN             + C   A CE       C C P + G+ Y  C        + EC ++ DC   +AC+   C+DPC     C +N EC+      L T +C+                  P+  ++        G N  C+EV                   + EC  + +C+ +  C +  C+D C  N CG    C    H   C CL G+TG+    CY               P  P+                           P+  P C+ + +CPS+ AC N++C +PC     C     C V+ H  +C+C  G+IG P + C    +PE + DP  P          ++PC+   CG N QC    +  +CSC   Y GDPYT C  P C    +C   +AC+  +C                                              QNPC    CG N++C   N +A+C+C+    G P  FC+P EC ++ ECP +L C N+KC DPC   C R A C   NH   C C+  +TG+P+ ++C+ I EP +           P +  C          +  PC   ++C+  +  P    +CTC+  + G          P     C +++EC  + AC    C  PC     CG  A+C V +H  +C CP G  GDP +L   +     D               +PC  + PCG NA C +      C+C P   G+P+  C R EC  N DCP +KAC  +KC DPC  T CG  A+CNV  H  SC C +G  G+PY +C     +++ +             C P     + C   + C   N Q  C C   Y+G           P   PEC +  +C +  AC+  KC DPC   N C     C+V+N SP+    C C +  Y G        +    C        T V  + + ++ C+   CG  +QC +      C C  GY G P            P+  P C  N +CPS   C N KC DPC     C   AIC V++H   CTCP G+ G P + C+P                                             +PEC    DC+   AC R KC +PC   TC  NAIC   NH  +C+C + ++G+ +  C+     +  +              PC    CG N++C     +A+CSC+ G+ G P   C+P EC S+ EC +HL C N+KC DPC   C RNA C   NH   CTC+P FTG+P+ + C+ I EP  +++                                         EC  + +CPS  ACIN++C +PC     C  +A C+V       T  C C  G TG    +C  I   V++                   +NPC   +PCGA A+C   N    C C   + G+PY  C P    EC  + DC  N+ C   +C DPC    +CG++A C   NH P+C C  G  G+P+ YC +         P + +    + V+PC  + CG  + CR    Q++C C    +G P   C+  QC    +C  N  C   N KC   C G   C  QA+CE RNH   C C + + GD +  C  +  + P                                              + EC  + +C   LACI + C++PC     C    EC+ +  +P    +CVC  G                           +  G N  C                 V  RPEC    +C  +  C +  C D C    CG NA C    H ++C C    TGN  + C             P P                        V PS  P CS + DC    +C+N+ C+DPC     C A A CR +NH   C+C  GY G+P   C   I+P+ R  T             ++PC    CG N+ CR       CSCL  + G P      P C S+ EC     C N  C+DPC    CG +A C   +H +MC C  G+ GDP+  C P           H++  + + V PC    C  +AEC  +N    C CL ++ G+PY   C P         EC+ D DCPS+  C +Q+C++PC  +  C QNAEC V + LP    TC C+ GY G     C ++ +PI                                   T  GC+     +SEC  + AC   KCL+PC     CGS A C V NH P CSC  GYTGDP+  C    +                                                 ECT   +C +S  CI  +C DPC  +  C  NA+C    H P C+CP G  GDP + C+            D         DPC  + CG  A C      G C+CI   QG+PY  C+  EC  N DC  +  C  +  KC+  C     CA NA C+ +NH   CRCP  M G+ +  C+    S+   +    S C       N RC    F NN   S     I +        + ECT N+DC     C    CID C    CG  A C    H   C+C   + GNP   C       P+ V      D   P+          NPC    PC   A C  +  +  CSC   YIG+         +PEC  +SEC+   AC+ Q+C+DPC+   CG NA C V  H A+C CL  + GDP++ C +                  E   PC    CG NA C    H   C+CL  + G+PY  CR  EC+ ++DCP + AC+ +KC DPC   CA  A C+V NH   C C + + GDPY                 C+P                    +PE +        EC    +CP  KACI Q+C +PC     C +NA+C+V    P+    C+C  G++G    +C  +   +           P L      C       +PC   A C+     A CSC     G P  +C P    EC  + DC +  SC   +C DPC     CG NA C   NH   C+C  G IGN  + C+       +           +  +PCD   CG NAVC    +Q  C+C     G+P V C+  EC    +C+  + C      C+  C  P  C  NA CE+  H   C C P   G+ +S C     +  +                     DPCQ + PC    +C   N        C C  + I    G+      + EC  + +C     C   +C + C  V CG N+EC+   H   C C   +TG+P   C+   P           H+              I+PC    PC   A+C+V    + C+C  G+IG+P        +PEC  + +CP N AC+ Q+C +PC  + CG NAEC V  H  +C+C +G  G+P+  C             Q      E Q PC    CG NA+CS  N  G C C+    G+PY  C+P EC+++SDCP++L C N+ C DPC   C  NA+C++++H   C C   + G+PY    +  DP+PEPV                           L  +         EC    +C    AC+   C++PC     C + A C+V +  P     CSC+ G+TG     C +I P I     ++               +PC+  SPCG F  C+ Q ++++C C  GY G P     P    EC  + +C+S+ AC++ +C DPC  +  CG  A C   NH  IC CP G+ G+P   C                                                EC+ N DC  DK C   KC  PC    CG  A C V  H   C CP G  GN +V C  V+ +            + L  C     + + C  +A C       +C+C   F G         V P   P C ++ DC    AC+++QC++PC     C    +C V   +P  +     S N +                                  N +  C+ +K  +        EC T  +CP    C    C D C    CG  +TC    H   C C+A Y GDPYT CY   P     I P                                 GC+ +     DC S+ +C N+ C +PC     C  NA C+V+NH P CSC  GY G P   C ++  +P  +V  +              PC  + CG N+ C  +  +A C C+  Y G P      P C +N EC   +AC+++ C DPC    CGQNA C    HRA C C  G+ GD +  C+        RD P   +   + CV P  C ++A C  +  +  C+C+  Y G P          P     C  ++DC S +AC+++ C +PC     C  NA+C V + +P    +C+C EGY G    +C                                       L      VGC  +     EC    AC    C++PC     C S A C V NH A C CP+G+ G+P+ LC            + +  Q+ +E    Q     +PC  +  C     + IC C  G  G P   C   EC+S+ +CP   +C N+ C +PC    CG  A+C V  H   C CP GY GSPY  C L+         D     R+    C         C   A+C+       C C    +G         P   +PEC  +S+C ++ AC+N  CQ+PC     C  N  C   N  P     CVC  G        C   T +P+   +    + +V  +    I  C    CG NA C       +C CLP++ G+P++AC              C +++DCP   AC  + C DPC    C  NA+C V+ H P C C  GY G+P   C                                    LP          PEC ++ +C  D AC+H  C  PC    CGINA C V  H  IC CI+ + GDP+  C E
Sbjct: 10247 AACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKCVDPCPGM--CGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGT--CGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQE---------KRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGR-APNCRP-ECTSDSECPGNLACI--NLRCRDPCV--GTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPCPGV--CGVSAECHVINHAP----SCSCPSGFTGNPSQFCREIPRLP-----------------APVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPA------------CRPECSVSSECAQDRACVNQRCADPCPGT--CGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNE-------------NPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPNC--RPECTINTECPANLACINERCQDPCPG-SCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNP----QPPAIPDERLTPCQ----PSPCGPNAECRERNGAGSCTCLPEYFGDPYS-GCRP---------ECVVNSDCSRDKSCVNQKCVDPCPGV--CGLNAQCRVSNHLP----SCSCLAGYTGNPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKCVDPCPG--TCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGA--CGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPD----------ETRNPCNPSPCGANAICRERNGAGSCACLPEYFGDPYSGCR-PECVQNDDCDRSRAC--INNKCQDPCPG--ACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDPCRGS--CGNNAKCQVVNHNPICTCQPGMTGDPISGCE---------PMPEVKN---VENPCVP---------SPCGPNSVCRQIGNQAACSCNAGYIGRP------------PTCRPECTNNDECQNHLSCQQERCVDPCPGS--CGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPF-FSCKPVP--VTPR---------PPLNPC------NP----SPCGPNSNCRAMN----NQAVCSCQAGF--------INQPPNCKPECVVSAECAPEKACVHKKCVDPCQHT--CGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFIGAPPRCRPECVLNSECGPTEACINQKCADPCSGS--CGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPCPG-ICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVED--------------PIIEACSPS-PCGSNSQCRDVNGHAVCSCLEGYIG---------APPQCRPECVVSSECSALQACVNKKCVDPCAAA--CGLEARCEVINHSP----ICGCPPGRTGDPFKQCVVLPPIA-------VPDVKSPPQDPCVPS----PCGPNSICKNDRNGPVCQCQPEFFGSP------------PNCRPECIINPDCQSTQACINNKCSNPCPES--CGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRP-ECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPNCVCNDGYTGDPFA--------------------SCRRVEVTTPSPVSDPCIP-SPCGANSKCRVANGL----AVCSCMETFIGA--------PPNCKPECTVNAECPSNRACHKFRCANPCAKT--CGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQACIAEKCRDPC--DGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQ--------DPCDLQPCGSNAEC----RNGICSCLADYQGDPYTGCRP-ECTLSTDCAPTKACLNK--KCVDPCP--GVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNG----NAACSCA-ATFIGTPPSC-----RPECSINPECPPTKACIRQKCSDPC-VNACGFNARCNVANHQPICTCDVGYTGDPFTGCQKEQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRPECVRHSDCASNKACQQQKCRDPCPGT--CGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLSTECPTDKACISQRCQDPCPG-TCGINAECRVRNHSPLCQCRQGFTGDSFTRC--------YPLPPPPPVIERVERDPCLPSPCGLNSQCRNVQGVPSCTCLPDFLG-APPNC-RPECTISAECPSNLACIRERCIDPCPGSCGYAAECSVVNHTPICVCPAGFTGDPFS-SCRPAPPPEPTQSEYVDPCNPSPCGPNAQCNAGICTCLAEFHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGT--CGENAICDVINHIPM----CRCPERTAGSAFIRCSPVQITVSNPCRP----------------------SPCGPNSQCREVNQQAVCSCLPSFIGAPPS-CRP----ECTSNSECAPTQACLNQRCGDPCP--GTCGVGANCAVVSHSPFCTCPERFTGNPFIRCQPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCRPECVTSSDCSSQLACVNQKCVDPCPGR-CGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENE----------IR-TPCSP-----SPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGC--------RPECMLDSDCPSNRACQQLRCQDPCPGT--CGLNANCQVVNHLP----TCTCLTG-YVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADTCGNNAICRVRNHSPICSCISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPACSCLVNFIGQAPNCRPECTINSECPSQLACINQKCRDPCPGA--CGQNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPRDRACVRNKCIDPCSG-TCGVNALCEVNNHIPICRCPEQMSGNAFFECRPVPPAKIQ-------------------NPC-QPSPCGPNSQCRVVQQTAVCSCLANYVGSP-PQCRP----ECVTNSDCPADQDCQNMKCRDPCPGT--CGFNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCGPNSECRVSGDSPSCSCLPEFVGAPPNCRPECISNSECPTNQACINQKCVDPCPGL-CGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPI---RDSPPEVLQPCNP------------SPCGVNAKCEERGGAGSCQCLPDYFGNPYDGC--------RPECVLNSDCPSNQACVNQKCRDPCPGT--CGQNAECQVVNH--LATCNCLVGYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTSSSECAADKACVNRKCVDPCP-NVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPPVVEREPLDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNCRPECSINAECPSHQACINQKCRDPCPGS--CGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPP----------EDPCNPSPCGSNTQC----NNGVCSCLPEYHGDPYTGCR-PECVLHTDCDRSRACVRHKCVDPCPGTCGTNAICEVLNHIPNCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPCGPNSQCRVVNQQAICSCITSFIGSP-PFCRP-ECTTNSECPLNLACRNQKCSDPCPGVCGRGAQCHVTNHSPFCRCLERYTGNPF-VSCQQIIEPPVP----------PPRQTC----------LPSPCGPYSQCREVNESP----SCTCLPEYIGA--------PPNCRPECVTSSECPTNQACIQQKCRDPCPGL--CGQSAECRVLSHTPSCVCPEGMEGDPFTLCKEKRIQELDQ-------------LDPCSPS-PCGINARCTSRQDAGSCQCLPDYFGNPYEGC-RPECVLNSDCPSNKACQQQKCQDPCPGT-CGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVN------------PCQP-----SPCGPNSQCREVNEQAICSCLPEYVG---------APPVCRPECTISSECPADKACVNQKCVDPC--PNTCGDQAICRVVNHSPI----CSCRAG-YTG--------DAFFRCFPKPPVPPTPV--QKTPVDPCVPTPCGPYSQCRSQGDAPACSCLVGYIGAP------------PNCRPECRINAECPSSQACINEKCRDPCPGS--CGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPG-TCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQ--------------PCQPSPCGPNSQCREVNQQAVCSCVPGYIGTP-PLCRP-ECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPF-VGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPCPGL--CGSSATCRVVS----HTAMCICDAGLTGDPFTQCQPIVQDVEI-------------------INPC-QPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRP----ECVLNSDCPSNRACQQQKCRDPCP--GSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQ---------PPEPIV--HEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFEGAP-PNCRP-QCTSSSECASNRAC--INQKCVDPCPGV--CGQQAICEVRNHSPICRCPTAMIGDPFVRCIPRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFGTPPHCRPECSINAECPSHLACIGERCRDPCP--GACGQQTECRVISHVP----SCVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICSNQGECKCVADYQGDPYVACRPECVLSSECPRNLACIQQKCTDPCP-GTCGTNAICDVVNHIAMCHCPDRMTGNAFVQCTPVQLDVYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECSTNYDCSPSLACQNQRCVDPCPGA--CGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQ-RDITP------------KDPCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNC--RPECVSNSECSQVHVCSNNRCKDPCP-GLCGTDAVCRVISHSAMCYCQPGYSGDPFVRCAP-----------HIQRESIEIVQPCNPNPCGAFAECRQQNGVGSCQCLPEYFGNPYE-GCRP---------ECVLDSDCPSQLACVNQKCRDPCPGS--CGQNAECFVRNHLP----TCNCLSGYVGDPYRYCSIEPKPIREYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVGTPPGCRPECTVSSECNLDKACVRHKCLDPCPGA--CGSSANCQVVNHAPLCSCQAGYTGDPFTRCYPIPSPPTHIVHDYARHPCQPSPCGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSECLSSLACINQRCADPCPGS--CAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALD---------DPCNPSPCGANAVC----QNGQCSCIPEYQGDPYTGCRP-ECVLNADCPRNRACVRH--KCVDPCP--GTCAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSLAPPDPCYPSPCGP-----NSRCR--VFNNNAVCSC----IEDFIGTPPNCRPECTHNSDCLPRLACQRQHCIDPCPGT-CGFNALCHVVNHAPICSCPPKHNGNPFLGC------FPEPVR----RDEVIPK----------NPCQ-PSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNC-----RPECITNSECSFDKACLNQRCRDPCSG-TCGSNANCHVISHTAMCYCLPGFTGDPFTSCVQV-----------PVIQQAEIVQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETCRP-ECVTNNDCPSNKACQQQKCRDPCPGVCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGV--CGSNADCRVIQHAPI----CSCRAGFTGDAFSRCLPLPPSRP----------PQLDVYRNPCV-----PSPCGQYAECRDNQGTATCSCLPSYFGTPP-NCRP----ECTINPDCPSHLSCQQQRCRDPCPGA--CGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDP---------PQISDPCDLITCGPNAVC----NQGQCNCLPEFVGNPLVGCRP-ECVLSTECDWSKACVRNK--CIDPC--PGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVR------------------DVIDPCQPS-PCGPNAQCRNING----QAVCSCLRDFI----GV--PPSCRPECVSNAECPLHLACLQRHCRDPCPGV-CGLNAECRVINHSPNCHCIGSFTGNPFAACHRPPPPP-------IKHEP-------------IDPC-QPSPCGANAECRVQGSNAQCSCLSGFIGTPPN-----CRPECVSNSDCPMNLACLNQKCRDPCPGV-CGSNAECYVINHTPMCTCLAGQTGNPFVSC-------------QVVRDVPEPQTPCVPSPCGANALCSEGNGAGACKCLPEFYGNPYEGCRP-ECVLNSDCPSHLACLNQHCRDPCPGTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPACRPECTISSECDLTLACVQQHCVDPCPGV--CGNSAQCRVINHSPH----CSCLPGFTGDAISGCQRIPPAITHDAPNETP------------RDPCV-PSPCGAFGQCRAQGNQAICSCLPGYYGAP-----PNCRPECAINPDCASHLACISEKCRDPCPGS--CGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSPGGQCSCLPDFDGNPYVGCRPECVLNTDCARDKACQRSKCTDPC-PGACGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTLVQSSPV----------VPLNPC-----QPSPCGNNAQCREVNDQAVCSCLPGFFG---------VPPKCRPECTINSDCAPHLACLNQQCRDPC--PGACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSPCGPNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLACIGQKCKDPC-SGLCGIAATCQVVSHVPSCICIADYIGDPYTGCYARPPIQREQINPCYQNPCGSNAVCRERGEAASCQCLPEYYGNPYEGCRPECVLNSDCSSHLACLNQHCRDPCPGS--CAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQVVHFN--------------PCQPSPCGPNSQCTESQGQAVCRCLPDYYGSPPAC--RPECTTNPECPNDKACVSRRCTDPCAGA-CGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYR---DPCV-PSPCGQFAQCRVEYEQAVCSCLTSYYGTP----------PYCRPECTQNSDCPSHRACVNQRCVDPCPGA--CGLNARCDVLNHVP----SCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNGVCSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPC--PGTCGSGATCQVHNHVAMCQCPVGYQGNPFVLC------------QQTPLQAPVELHPCQP----SPCGHHGECREVGSQAICTCRLGYYGSPP-ACRP-ECVSDPECPPSLACVNQKCRDPCPGA-CGHLAQCHVINHSPQCVCPAGYTGSPYSECHLIR-------ADSSPIQRQPIDPCLP-----SPCGPHAQCSNEGGNAVCRCLTEYLGV--------PPYCRPECIANSECPSDRACINRKCQDPCP--GLCGYNAICRTYNHQP----NCVCAPGLVGNPFNSCLPPT-RPEIPATPPTTAIQVLQYEEPFINGCEPNPCGANAQCNQRRGVVSCVCLPDYFGNPYEACRPE-----------CILNSDCPLSRACVQQKCRDPCPGT-CGLNAECHVMDHLPQCRCFSGYTGNPLAYCSPVPIIQESPLTPCDPSPCGPNAQCHPSLNEAVCSCLPEFYGTPPNCRPECTLNSECAYDKACVHHKCVDPCP-GICGINADCRVHYHSPICYCISSHTGDPFTRCYE 18757          

HSP 6 Score: 2438.3 bits (6318), Expect = 0.000e+0
Identity = 2662/9553 (27.87%), Postives = 3680/9553 (38.52%), Query Frame = 0
Query: 1569 PASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINACKSR-PCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACK--DRKCINPCAESSPCASSARCKVINHEPECTCPDGFIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKIS-----------NSECKYDTDCASNEACI-----NDQCVDHCVVNL------PCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSFECKKNEDCPFDKECKSESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNCQP--------------------------------------------PE-RPECRVDAECPLDRACIHQKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPCE--CARNADCKARNHRGYCTCIPNFTGDPYGIVCEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYCYKYECKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFE-CKEVEL----------------------------------------STECQVNNDCQQFEICVDGTCRKTCSINSCGANAVCTPVIHGFKCNCFDGYTGDPNSACY----QPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCY------------------------------------------------KYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQG--------------TFI-----------GSNGICQE------------------VETKVECEYNDDCSTNDICQDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYL-PITPNEPS-LVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACE---------------------------------------------------EPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPCECARNADCDARNHRGICTCILDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCY-------------------------------------------------RYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPC------------------------FTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTS-----------------ECIVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPG---------------------------------------CSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPY------------------SFCKPY---------------------------ECLSDPECPNHLKCKNEKCVDPCE--CARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSC--VPASN-----------------------------------------------EECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCY----------------------------------------------KYECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVES-----------------------------------------RPECEKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCD--EPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPC--ACAKYAECDARNHKAYCSCLVDFTGDPYGIACDP----IPEPLKV----------------------EY----------ECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTK---DDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECR------IAELSQITIQT-QAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRV---------------------------------VILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQLPQK--------------------------------------------PECTKDSECANHLACIQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCRSYECLVDSDCPRHLACENEKCVDPC--KCAKYADCKVTNHQGYCTCNSYYTGDPYGL-ACEPIPEPIEV------------------------------------------ECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKC----------TRVEE-------------------------IKEY---------GCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECP----SNEIIS-----------------------------------------ENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEA-------------------------------------SINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDC-QLPIQPECTRDYECPDNKACIQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSF----------------------------------------------------CKPYECLIDSDCPTNLQCNNEKCVDPC--KCARNADCEIKNHRGYCTCQSDFTGDPYG----------------ISCDP----------------IPEPVLVEY-----ECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNF----------------------------------------------ECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPT---------------RTISCQCSDNMYMNA-----------------RGDCEAIKGLV--------ECQTDRDCPDSDVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFP---------------VPQP-------------------------EPSITPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLSPKPECIVDQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGDPYT----------------------------------------------FCRPYECLVDRDCPDQLKCDHEKCVDPCQ--CAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVV----------------------------------------EEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCE--LITE------------------------------PVVVG---------CTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHSYECLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLDCHNDNDCKDDEKCDRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTP------------------------------------------QPQCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCELPSEPECLVDDDCPSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEEPGCKSDIECPFDKACISRECQNPCLYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPCQ--CAKYAECDARNHRGIFPEPVEVEGCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEYECLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYK--CFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLVVDSSPSKSVSCSCREGFYV---------------------------GKNGDCIE---------------VDGQPECRSHSDCRYNEQCQSGSCLDACRIRLCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVE------------------------------ALPPGCR----SDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECK---------------PPTP-------LSIG---------------------CSADSDCPVVEACLNTKCVDPCN--CGENALCRKINHKAVCFCPSGFSGNPEVLCEKLECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEV--------------------------------------EKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNP---------------------------------------------PGCVKDDECPSNEACVNRMCRNPC--NCGGGAKCFLSGHRPICQCPEGFIGNPQIECNPAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESC-----TVIPP-------------------------------------PECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECP--------------------------------DGYVK----GELKGCKTLPPIISG-------CERNDDCSNSTSCINAICRSPCA--CGLNADCKIIDHQPVCTCKPGFYGDPEIECTDTVCQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNIVSCSDNSDCPTDKECINKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFIGNKGT-------------------------------------SCVKVSV--------TCEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECFPVKTCPANSGLILDNREECV---------------------CPTGFGFTEN-KDECIPCLKENGFILNNEGKCV--CNDARGYE-------YNPDSGKCECPPGERLNNFGICERVPDCEEDPDCPTQKYCEKTNGTCSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIPPVKTDF 9488
            P +   C  + DC    +C    CQ+PC     C+ + +C      P     C CP     N    C   +T+ EC  ++DC  T+ C    C + C    PC  NA C    H++ CSC DGF+GN    C       +P +   C  N+DCP    C   +R+CINPC E S C  +A C  +NH  EC C  GF+G+    C P           C SD EC     C N KC  PC+C   A CD  NHRG+C C P + G+P  + C P  +P                       CD       PC  NA C++ +  P+    C C +G TG   + C+              EC+P                +PC   + C+ +  N  C C   Y G P S   ++            N++C   ++  S   C+     +   +  CV  +      PCG  A C++ RH  VC CP    G+P   C                 K    ++ C    CG  A C V  ++  C C SGY G+ Y  CRE          S+  C+         C  N NC       A + +  C CP  L GD  S     V      EC VD+D   S+AC+   C +PC     C    +C+V E + +    C C  G       +C  +    +                   N C    CG N+EC    +R+ CSC PGYLGDP++ C            P CD++ DC     C N  C++PCA  + C + AIC V QH PVC C DGF+G     C P                                            P  RPEC  +++CP DRAC+ Q+C +PC   +CG+NA C V  H  +C C  G  G+PY  C     +S  E P   +C    C         G   ECK ++    C C  G+ G  ++ C R EC+ +SDCP    C+N KCV+ C   C  NA C+  NH   C C   ++GD   I C P   P  E                      +PC    PC  N+ CK     P     C+C+  F G          P+ +  C   SEC     C +  C +PC     C   A+C V +H  +CSC   + GDP+  C  I         D  R     +N C     +   CG  +IC+ + +R VC C   + G P  YC + EC   ++CP DKAC  EKC +PC +  CG  A C    H + C C +  +G+ ++ C +       D       D  Y          N CA NA C   N+  RC C   + GD Y+           PEC    +CPS +ACI   C++PC     C  N  C V N+ P    SC C  G +E + F+ CK V +                                          EC V+++C Q   C++  C   C + +CG NA C    H   C+C   Y G+P   C     +P  NV+P L                            SPC  ++IC+ +N++A C+C  G  G P  +CRP    EC+++ +CP + ACI ++C++PC  + CG NA C  Q H+  C+C+  + G P+T C+ + +V +         PT         +PC  + PCG +A C+V+    +C C   Y GDPY NC P    EC  ++DC +N ACIN +C DPC     CG NA C   +H+  C C P+  G+P  +C                                                 K EC  S +CP D+ C+N++C DPC  T CG  A C+   H   C C +G  G+P+  C  V  RK    A      +    C+      + C   + C+ S+    C C   + G          P   + EC I+ +C    ACI   C DPC  I  C  N  C      P+    C+C  G              T I           G N +C+E                  VE + EC  N DC  +  C +  C+D C    CG N  C    H   C CL GYTGN  V C++ P +P  P  +VP                    NPC +  PC   +NC+ V   A+C+C   +IGSP N C+    PEC+S  EC    +C+ ++C++PC   TCG NA CRV NH  ICSC  G+ GDP+  C                                                     P C SD ECP   ACIN  C++PC+   CGI   C   NHR +C C+ G+ GDP+S C P           ++  +  +  +P  C  NA C  RN  G C+C+ ++ GDPY   C P         EC  + DC    AC+N +C +PC     C  +AEC V +  P    +C+C  GFTG   + C +I  +                      + PC + +PCG  +QC   N  A C+C   + G P    A + EC+  ++C  ++AC+N +C +PC     CG+ AIC    H P+C CP G +GDP   C                                                  R EC  N +CP + AC +E+C DPC  + CG  A C+V  H   C C +G  G+P+  C           +     D     C P     + C   A C   N    C C   Y GD YS C         PEC V+ DC    +C+  KC DPC                        +T NP    +E   L   P +  +   PS    G   QC  V+G +                 ECI++ DC     C    C++ C    CG  A+C  I H   C C  G+TG+P + C   ++   P+ + G                                       C  + DCP+   C N++C +PCI    C + ++C V+ H   C C  G+ G P + C   ++      PD          + +NPC+   CG NAIC+ RN    C+C+  + GDPY+ C  P C  + +C  ++ACIN +CQ+PC    CG+NAEC    H   C+C  G+ GDP+                  S C PY                           EC+   ECP +  C N+KC DPC   C  NA C   NH  ICTC P  TGDP    CEP+PE  ++ VE                   NPC+   PC  N+ C+           C+C  G+ G+         P          EC  +L+ + + CV+PC     CG+ A CQV  H + C C  G+ G+P   C  +PA                                                  EC  + DC+  Q C   +C+DPC   + CG  AIC  + H P C CP G  G+P   C                                               K EC  + +C  +K C  +KCVDPC  T CG++A+C T+ H  IC CP+ + G+P+VEC  V    D     N   +     C P     + C   A C+   +   C C  +  G          P   + EC  + +C  + ACI++ C +PC  +  C    +C  L+ LP     C C  G        C + E                                          RPEC    DC     C    CVD C    CG NA C    H  +CSC  G+ G+P + C +  P VE  +   CS                       +PC + + CR +N  +VC+C +GYIG+P     P  +PEC   +EC    AC+ +KC +PC +  CGL A C V NH  +C C  G  GDP+K C    P    D + P          QDPC+   CG N+ C  + +  +C C     G P   C+P +C+++ DC     C N KC +PC  +C   AEC    H   CSC   + G+ + + C P     P+P +                       EY          EC+   DCP+ + C   +C++PC     C  NA+C   + +P     CVC  GYTG     C ++E +TT    S+                PC    PCG+ +KC V N    CSC   + G P          ECT + +C ++  C +++C +PC   K CG NA C    H P+C CP  + GDP + CY           D P  +         PC+ + CG+ + C     Q  C+C+    G P   C+  EC  N DC+ D+ C     KC   C  S  C +++ C   NH   C C     GD +  C + +     +        P  Q        +PC L  PC S+ ECR      +A+         + ECT + DC  T  CL+  C+D C    CG  + C  + H   C+C  GYTG+P   C                                    ++  P   +  C   S+C  +TAC N+KC++PC     C   A C+VINH P CSC  GY G   T C   ++                                            PEC+ + EC    ACI+QKC DPC +  CG NARC V  H+ IC C   Y GDP++ C++   R           I  E   PC    CG NA C   N    C+CL    GDPY  CR  EC+  SDC  + AC+ +KC DPC   C   ADC VTNH   CTC   YTGDPY     EP   P  V                                          EC L  +CP  KACI Q CQ+PC     C  NAEC+V +  PL    C C +G++G    +C           RVE                          + ++          C  +++   NLACI  +C  PC     C   A C V+NH  IC CP G TGDP  SC P    E               ++  DPC   +PCG NA+C A     +C C     G+P+S C   EC  N DCP DK C   KCVNPC  T CG NA+C    H  +C CP    GS ++ C  ++      C                   P  C  N+ C   N +  C CLP + G   S          +P+C  + +C    +C++ RC DPC     C VG  C+V +  P     C CP     N  I                                          E  I      + EC   +DC+    C +  CV+ C   +CG N+EC    H   C C +G+ GDP  +C   I  +                                          P C  D DCP + AC+ L+C +PC     C + A+C+VV+H   CTC  GY+G P   C +LP  P               Q + +NPC    CG N++CRV+  +A+CSC   ++G P +    P C    EC   +AC+N++C +PC  + CG NA+C  +NH  ICSCI G+ GD ++                                                     C+P EC I+S+CP+ L C N+KC DPC   C +NA C + NH   C C   + G+P+                   C+P                IPE     Y     EC+ + DCP ++AC+  +CI+PC     C   A C+V + +P+    C C E  +G    +C  + P                        NPC   SPCG  S C+     +VC C   Y+G P     P    EC  + +C ++Q C N +C DPC     CG+NA+C   NHR  C CP G +G+P  SC                                                 EC+SN +CP ++ CI++KC+ PC   +CG  A C V  H+++C C  G  G+P+  C  +   +DS     + CN             + C  +A CE       C C   + G+    C         P C ++ DCPS+ AC++++C++PC     C    +C V + L T               R    +  + +Y+N                  +G C  +   +        EC +  +C     C +  CVD C  N CG  + C    HN  C+C++G+TGDP+T CY                 VP P                          P+  P C  + +CPS+ +C N+ C +PC     C +N  C VINH P+CSC  GYIG P + C   P PE I D   P          E PC+ + CG N  C    +   C C+  Y GDPYT C  P C  + +C  ++AC+   C+DPC    CG NA C   NH   C+C EG +G+ +                                               FCRP EC  + +CP  L C ++KC DPC   C + A C   NH  +C C+  YTG+P+ ++C+ I EP V                                           C + ++C + QACI ++C++PC     C ++A+C+V    P    +C C EG  G     C+   I E                              P   G         C  + +C ++ AC    C +PC     C   A C+V NH  +C+C  G++GDPY  CVP   KE  Y + C  +                PC  N+ C   N + IC C P  +G P   C   EC  + +CP DK+C N+ CV+PC  T CG  A C V  H  +C C  GY G  +  C                 D    T          C   ++C ++     C+C   L+G      I  P + +PEC+I+++C ++ AC+N  C++PC  +  C     C V N  P    +C CP G+S     +C+ V P                                          +P+C  S+DC     C    C   C    C  NA+C   +H   C C   + G+    C   P    P+L                     + PC   PC  N++CR +  + VC+C  GYIG+P         PEC  + +C S LAC++Q C  PC  S CG NA+C+V +H   C C+  + G+P+      GC+  IE P          Q+PC    CG N+EC      A C C     G+P  +CKP EC+ + +CP +L C N+KC DPC   C   A C   +H  +    +   G   D     Q    D E  NPC    PC  NAEC   N        C C   Y G   E C          C  + DC ++ AC+  +C +PC     C Q A C V  H   C C  G  GDPY  C    +               + +E ++PC +  PCG N+ C+ ++ + VC C+S   G P +     +C   ++C  N+AC++QKC DPC    CG +A C+   H  IC C   + G PF+ C           +     D+  Y+  C P     +PC   ASC  Q ++  C C P   G              PEC I+ +CPS  ACI  +C++PC     C     C V+   PS    C C  G+                             G N  C                 V  +PEC   S+C  N  C    C D C    CG NAIC   NH + C C  R +GN  V C P+   V                                 +PP CR    ++ +C     CQN +CVDPC     CG  A C+   H P C C  G+ G+P ++C                 P+P         +G                     C ++S+C  V  C N +C DPC   CG +A+CR I+H A+C+C  G+SG+P V C        E     + C+ N          PC    EC   N V  C+C  +  G+PY  C   EC ++ DC S+ AC   KC DPC     C  NA C    H  +C C+   +G+P+  C   EP PI                                          EC V S+C    AC+   C +PC     C +SA C VV+ +P     C+C+ G+       C PI +P                                               P C +  EC S+ AC+N+ C +PC  +C   A C +  H P CQCP G++G+P   C+P      K     + C      NP     PCG +A C     N QC C   ++GDPYTGC    C  +++CP  +AC    C+DPC     CA  A C   +H A CRC     G+ +  C     ++ PP                                     PEC  + DC   +AC  + C +PC     C   A+CHV+   P+    C CP                                  Y K    G+   C  LP  I         C  N +CS   +C+N  CR PC+  CG NA+C +I H  +C C PGF GDP   C            +    +  E  Q C  +  PCG  A CR   H  +C C     GNP+ TC    C  N+DCP++K C  + C D C     C   + C+V NH   C C  GF+G+                                        SC+   V         C    +CP  ++CI ++C +PC     CG NA C V    P+    CSC  G+ GDA   C P+   P+    +   R  CV                      P+ FG   N + EC         +   + +C   C  A G+        +NP    C+C PG   N F  C   P    DP               S+PC    CGPNA  +       C C+  + G+P +GC P  +   + D+
Sbjct: 8479 PKTPEPCQSNNDCIESEACYMGLCQDPCEFAKICAATAKCTAKSHRP----VCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTEACINQLCQHPCDVHDPCATNAVCINSNHAADCSCADGFQGNGFVGC-------QPARSHVCQYNEDCPPTKLCDRLNRRCINPCQEDS-CGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQ--------GCRSDSECDSSQACINGKCSSPCQCGAYALCDVVNHRGVCKCPPGYNGNPK-VGCSPPQDP-----------------------CDP-----NPCGLNALCELDNGNPI----CYCPKGLTGNPFKNCIP----------EGDECTP----------------NPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRH-PVCYCPDNKIGNPFRLCD----------------KPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCRE---------PSRTVCDPNP------CGPNANCV-----VAGDGQTACVCPDGLSGDPTS-----VIGCHGYECQVDADCPNSKACMGYRCYDPC--PGACGQGAHCQVEEHHPV----CSCNSGLTGNPGIRCYALDHPKK-------------------NPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGC-----------QPECDINSDCGDTLSCINHKCVDPCA-GAICGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGVALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPG-SCGRNAICNVYEHNPVCACPTGLFGNPYEQCTT---KSVVETPPQPSCAKLHC---------GANAECKRQHSGLACVCRKGYFGDPHIGC-RPECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGD-ASIACNPFYLPPPER--------------------PHPC-EPSPCGPNSRCKA---TPDGYAACSCLPNFKGA--------PPVCQPECVVSSECAPNQACLNQRCTDPCPGI--CGGGARCEVLNHNPICSCEANFEGDPFVACSPI--------QDPGRDIPVPKNPC-----VPSPCGPNSICQIKQNRPVCSCVANYIGSP-PYC-RPECTLSSECPSDKACINEKCQNPCAN-VCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGD-----HIDPCYP---------NPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCR-------PECIYSSECPSSLACIKQHCRDPCTAA--CGANAECTVVNHLP----SCSCTRG-FEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPC-VGTCGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLP---------------------------SPCGSNSICRNVNNRAECSCAPGMFGAPP-NCRP----ECVINQDCPSNRACIRQRCEDPCIGI-CGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLD-------PPT---------DPCYPS-PCGANAICRVRNGAGSCSCIQNYFGDPYINCRP----ECVQNSDCPNNRACINMKCRDPCA--NACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCPGT-CGYNARCRCTNHSPICSCYDGYTGDPFHQC--VPERKPPPIADPI---VPPNPCVP-----SPCGPNSQCQVSSSGAVCSCVTNYIGR---------PPGCRPECSINSECPARMACINARCADPC--IGSCGNNALCHVSLHAPV----CMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKCVDPCP-GMCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPE-------------------NPC-QPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPN-CR----PECMSSSECAQDKSCLNERCKDPCPG-TCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLACINLRCRDPCVG-TCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKI---------NVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPY-TECRP---------ECVLNSDCSKNRACLNNKCRDPCPGV--CGVSAECHVINHAP----SCSCPSGFTGNPSQFCREIPRLPAP-------------------VEPC-RPSPCGPYSQCREVNGHAVCSCVTNYIGTP---PACRPECSVSSECAQDRACVNQRCADPCPGT--CGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPNCRPECTINTECPANLACINERCQDPCPGS-CGFNAFCSVVNHSPICTCDSGYTGDPFAGCNP---------QPPAIPDERLTPCQP-----SPCGPNAECRERNGAGSCTCLPEYFGDPYSGC--------RPECVVNSDCSRDKSCVNQKCVDPCPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPPPERDENPCRPSP--CGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKCVDPCP-GTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGA--CGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQ---IAPPD----------ETRNPCNPSPCGANAICRERNGAGSCACLPEYFGDPYSGCR-PECVQNDDCDRSRACINNKCQDPCPG-ACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPIS-GCEPMPE--VKNVE-------------------NPCVP-SPCGPNSVCRQIG----NQAACSCNAGYIGR--------PPTCRPECTNNDECQNHLSCQQERCVDPCPGS--CGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCN--NICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDPCQHT-CGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITND-----NTTPSPAPASCVP-----SPCGPNAKCQIVGNSPACSCLPNFIG---------APPRCRPECVLNSECGPTEACINQKCADPCSGS--CGFEAKCHVLNHLPI----CNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPCP-GICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRV-KPVVEDPIIEACS----------------------PSPCGSNSQCRDVNGHAVCSCLEGYIGAP-----PQCRPECVVSSECSALQACVNKKCVDPCAAA-CGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPP---------QDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPN-CRP-ECIINPDCQSTQACINNKCSNPCPESCGTNAECRVIGHAVSCSCPTGYAGNAF-VQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPC--PGICGLNAQCYAVNHVP----NCVCNDGYTGDPFASCRRVE-VTTPSPVSD----------------PCIPS-PCGANSKCRVANGLAVCSCMETFIGAP-----PNCKPECTVNAECPSNRACHKFRCANPCA--KTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRR---------PCQPSPCGLNSECRVRDEQASCSCLPNFIGAP-PNCRP-ECVVNTDCSPDQACIAE--KCRDPCDGS--CGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSP-------PLTQ--------DPCDLQ-PCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVDPCPGV-CGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCP--GACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCRPECSINPECPPTKACIRQKCSDPCVN-ACGFNARCNVANHQPICTCDVGYTGDPFTGCQKEQER-----------IVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRP-ECVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLSTECPTDKACISQRCQDPCP--GTCGINAECRVRNHSPL----CQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSPCGLNSQCRNVQGVPSCTCLPDFLGAPPNCRPECTISAECPSNLACIRERCIDPC--PGSCGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQ------------SEYVDPCNP-SPCGPNAQCNA----GICTCLAEFHGDPYSGCRP-ECVLNSDCPRDKACHSSKCVNPCPGT-CGENAICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNPCR------------------PSPCGPNSQCREVNQQAVCSCLPSFIGAPPSC---------RPECTSNSECAPTQACLNQRCGDPCPGT--CGVGANCAVVSHSPF----CTCPERFTGNPFIRCQPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCRPECVTSSDCSSQLACVNQKCVDPCPG-RCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRACQQLRCQDPCPGT--CGLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPP---------------QNEYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSC--RPECTISSECSADRACVNQKCVDPCAADTCGNNAICRVRNHSPICSCISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPACSCLVNFIGQAPNCRP-ECTINSECPSQLACINQKCRDPCPGACGQNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPRDRACVRNKCIDPCSGT--CGVNALCEVNNHIPI----CRCPEQMSGNAFFECRPVPP--------------------AKIQNPC-QPSPCGPNSQCRVVQQTAVCSCLANYVGSP-----PQCRPECVTNSDCPADQDCQNMKCRDPC--PGTCGFNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCGPNSECRVSGDSPSCSCLPEFVGAPPNCRPECISNSECPTNQACINQKCVDPC-PGLCGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPI---RDSPPEVLQPCN------------PSPCGVNAKCEERGGAGSCQCLPDYFGNPYDGCR--------PECVLNSDCPSNQACVNQKCRDPC--PGTCGQNAECQVVNHLATCNCLVGYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTSSSECAADKACVNRKCVDPC-PNVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPPVVEREPLDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNCRPECSINAECPSHQACINQKCRDPCPGS--CGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPP----------EDPCNPSPCGSNTQC----NNGVCSCLPEYHGDPYTGCR-PECVLHTDCDRSRACVRHKCVDPCPG-TCGTNAICEVLNHIPNCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPCGPNSQCRVVNQQAICSCITSFIGSPPFCRP-ECTTNSECPLNLACRNQKCSDPCPGVCGRGAQCHVTNHSPFCRCLERYTGNPF-VSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVTSSECPTNQACIQQKCRDPCPGL--CGQSAECRVLSHTP----SCVCPEGMEGDPFTLCKEKRIQELDQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCRPECVLNSDCPSNKACQQQKCQDPC--PGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKE--YVNPCQPS----------------PCGPNSQCREVNEQAICSCLPEYVGAPP-VCRP-ECTISSECPADKACVNQKCVDPCPNT-CGDQAICRVVNHSPICSCRAGYTGDAFFRC-FPKPPVPPTPVQKTPVDPCVPT---------PCGPYSQCRSQGDAPACSC---LVGY-----IGAPPNCRPECRINAECPSSQACINEKCRDPCPGS--CGYGAICNVINHTP----SCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCP-GTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTP---PPAL---------------------VQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLC-----RPECTSNSECLSHLACVNQKCNDPCPGS-CGRNAQCSVVNHNPFCTCLPRFTGNPFV-----GCQQIIEPPRQDIVP----QDPCRPSPCGPNSECRAAGETATCTCLGDFVGSP-PYCKP-ECVANSECPSNLACINQKCRDPCPGLCGSSATCRVVSHTAMC---ICDAGLTGDPFTQCQPIVQDVEIINPCQP-SPCGANAECIQRNG----AGACQCLTDYFGNPYEGCRP-------ECVLNSDCPSNRACQQQKCRDPCPGS--CGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEP--------------IVHEYVNPC-QPSPCGPNSNCREVNEQAVCSCRSEFEGAPPNC--RPQCTSSSECASNRACINQKCVDPCPGV-CGQQAICEVRNHSPICRCPTAMIGDPFVRCIPRPTIAPPPLR-----DVAPYRDPCLP-----SPCGLYASCRNQQNQAVCSCLPNYFGTPPHC--------RPECSINAECPSHLACIGERCRDPCP--GACGQQTECRVISHVPS----CVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICSNQGECKCVADYQGDPYVACRPECVLSSECPRNLACIQQKCTDPCP-GTCGTNAICDVVNHIAMCHCPDRMTGNAFVQCTPVQLDVYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECSTNYDCSPSLACQNQRCVDPCP--GACGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNCRPECVSNSECSQVHVCSNNRCKDPCPGLCGTDAVCRVISHSAMCYCQPGYSGDPFVRCAPH--IQRESIEIVQPCNPN----------PCGAFAECRQQNGVGSCQCLPEYFGNPYEGCRP-ECVLDSDCPSQLACVNQKCRDPC--PGSCGQNAECFVRNHLPTCNCLSGYVGDPYRYC-SIEPKPIREYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVGTPPGCRPECTVSSECNLDKACVRHKCLDPCPGA--CGSSANCQVVNHAPL----CSCQAGYTGDPFTRCYPIPSPPTHIVHDYARHPCQPSPCGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSECLSSLACINQRCADPCPGSCAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPC------NP----SPCGANAVC----QNGQCSCIPEYQGDPYTGCRP-ECVLNADCPRNRACVRHKCVDPCPGT--CAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSLAPPDPCYPSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLACQRQHCIDPCPGT--CGFNALCHVVNHAPI----CSCPPKHNGNPFLGCFPEPVRRDEVIPKNPCQPSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNCRPECITNSECSFDKACLNQRCRDPCSGTCGSNANCHVISHTAMCYCLPGFTGDPFTSCV-----------QVPVIQQAEIVQPCSPN--PCGANAVCRQEGHVGSCQCLPEYYGNPYETCR-PECVTNNDCPSNKACQQQKCRDPCP--GVCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGV--CGSNADCRVIQHAPI----CSCRAGFTGDAFSRCLPLP--PSRPPQLDVYRNPCVPSPCGQYAECRDNQGTATCSCLPSYFGTPPNCRPECTINPDCPSHLSCQQQRCRDPCPGACGFNALCTVINHNP---TCQCAPGFIGNAFTSCHVPPPIVRDPP------------QISDPCDLITCGPNAVCNQG----QCNCLPEFVGNPLVGCRPECVLSTECDW 16984          

HSP 7 Score: 2306.56 bits (5976), Expect = 0.000e+0
Identity = 2518/8784 (28.67%), Postives = 3467/8784 (39.47%), Query Frame = 0
Query: 1924 NSECSPTLACRNGECLNPCIEN-----------------------------------------------DP------CSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKISNS-ECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCY---SFECKKNEDCPFDKECK--SESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQ-CRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEA-----CISDTCKNP---CIVE------SPCHPSQNCRV---------LESYLLKTVSCECL------EGTQVGTNGQC-ITVQSQNECSIDNDCNQDDMCYEGTC--VNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPG-CDVDRDC-------------------------PSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPST--NCQPPERPECRVDAECPLDRACIHQKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPCE---CARNADCKARNHRGYCTCIPNFTGD------PYGI----------------------------VCEPIPEPVIEE-----VECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYCYKYECKTDNDCPFDKACAKEKCIDPCKDTFCGTRAEC-VTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTCRKTCSINSCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTP-STDCRPINVPECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGS------------PHTVCEEQP----------------VVDVG-----------CRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQ-------------------------------------------DLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPCE--CARNADCDARNHRGICTCILDFTGDPYGIACEPIPE------PVIEE-------------------------------------VECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCV-----------KIEPIIHTGCRSNTECAVS----------------------------------LACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCYRYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPS----DMYI------------------------GSSGQCERVEGTS-----------------ECIVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPYECLSDPECPNHLKCKNEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPYG----IACEP----------IPEPVIEEVECNEDR--------------------------DCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPG-------------------------------------------CSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRP-PIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPCACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTI-----------------------------------GCKS----NSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETST-------------------------------------------KECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFC----DKKIASVDTAECKVDSDCPKKQA-----CINERCENPCFLNNPCSSSQECRIAELSQITIQTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQLPQKPECTKDSECANHLACIQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCRSYECLVDSDCPRHLACENEKCVDPC--KCAKYADCKVTNHQGYCTCNSYYTGDPYGLACEPIPEPIEV----------------------------------------ECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEEIKEYGCKAN-------------------------------------SDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPCKCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCY-------------------------------------------------NFECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRT-ISCQCSD-------------NMYMNA-----------------RGDCEAIKGLV--------ECQTDRDCPDSDVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQP------------------------------------------EPSITPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQ-------------------------------------------LSPKPECIVDQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGDPYTFCRPYECLVDRDCPDQLKCDHEKCVDPC--QCAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHSYECLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLDCHNDNDCKDDEKCDRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCELPSEPECLVDDDCPSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEEPGCKSDIECPFDKACISRECQNPCLYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPCQ---CAKYAECDARNHRG--------IFPEPVEVEGCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIV---------------------------------VG--------CSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHECEQ--------------------------------------------DSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCY-----EY---------------------------------------ECLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLVVDSSPSKSVSCSCREGFYV----------------------------GKNGDC--------IEVDG------QPECRSHSDCRYNEQCQSGSCLDACRIRLCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVE------------------------------ALPPGCR----SDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECK----PPTPLSI--------GCSADSDC--------------------------------PVVEACLNTKCVDPCN--CGENALCRKINHKAVCFCPSGFSGNPEVLCEKLECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGW--IPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCN--CGGGAKCFLSGHRPICQCPEGFIGNPQIECNPAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDP---YTGCSIIGCKSDSECPNKKACRNRDCIDPCL----KDNPCAVFANCVS--------RDHF---------------------------------AQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTL---------------------------------------PPIISGCERNDDCSNSTSCINAICRSPC--ACGLNADCKIIDHQPVCTCKPGFYGDPEIECTDTV------------------------------------------------CQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNIVSCSDNSDCPTDKECINKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFIGNKGTSCVKVSVTCEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECFPVKTCPANSGLILDNREECVCPTGFGFTENKDECIPCLKENGFILNNEGKCVCNDARGYEYNPDSGKCECPPGERLNNFGICERVPDCEEDPDCPTQKYCEKTNGTCSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIPP--VKTDFPR 9490
            N+  +P +   +   +NPC  +                                               DP      C+ TAKC   +H   C C  G+ G+P  +CV    S EC  D+DC   EACIN  C   C V+ PC  +A C    H + C C  G  G+  V C    S  C+ NEDCP  K C   +  C++PC +  CG  A C    H   C+C  G+ GN Y+ C   Q CR +S+CDS + C     KC+  C+    C   A+C   NHR  C CP    G+    C+ P  P D   C +++            C      NP   CI E      +PC P+  CR          L  Y  +  S  C       + +  G N QC +     ++C+   +  +      G    +N C    CG  A C ++ H   C C    +G+P   C +    IE L  PG C  + +C                         PS T+C      NPC  ++ C V         +  C CPDG  G P++   C      EC+VDA+CP  +AC+  +C +PC    CG+ A C+V  H  +C+C  G  G+P   C                 ++   +NPC+   CG   ECK  N+RA+C C+ G+ G     C+  EC  +SDC + L C+N KCVDPC    C  NA C  R H   C C+  F GD      P GI                            +C+P   P  ++      EC  + DCP   AC+ + C +PC     C  NA C VY+  P+    C C  G  G   E+C   + ++ET  +                   C K + C  +A+C  +     C C  GY GDP+  C+     EC  ++DC   +AC+ ++C E C+   +CG  A+C   NH  VC C  G+SGD    C  +        P ++         PC+ + CG  + C  T    + C C    +G P V   + EC   ++CA N+ C     +C+  C    +C   A+CE +NH   C C + F GD +  CS I     +P     +D P          +NPC V  PC  N IC+++ N P+    C C +    S  + C+      EC ++++C   + C++  C+  C+ N CG NA CT + H   C+C + Y GD    C + +                     T R    I+PC   +PCA++A+C P N+ A CTC++ + G P ST CR    PEC+  +ECP  LACI + C++PC T  CG NA+C V  H   C+C  G+ G+            P TVCE  P                   VG           C  +SEC+  L+C N +C++PC+    CG +A+C+V  H   C CPA Y G+P+  C P                                               EC  + DC SN ACI  +C DPC     CG NA C T NH+  C C  +  GDP+ +C   E  + D              DPC  + CG+ AIC+     GSC C     G+PYI C+  EC +++DC +N  C   N +C   C+  N C   A C  ++H+  C C P   G+    C E+ P    L                   KDPC   +PC     C      P+    C C    ++G+   C     K EC  + +C ++  C +  C D C    CG N RC  + H   C C  GYTG+    C        P   P   +D   P           NPC    PC P + C+V    A+C+C   +IG P   C+    PEC  + ECP  +ACI  +C +PC   +CG NA C V  H  +C C  GY GDP++     GC    E P        E   PC    CG+NA C   N  A C CL  + GDPY  C+P EC+ + +CP    C N+KCVDPC   C  NA C   NH   C C+  +TG+P  + C  +PE      P++ E                                      EC    +C    +C+NE C +PC     C  NA C+V +  P+    C+C  GF+G    RC            +I+P + + C  N+EC VS                                  LAC N  C  PC+    CG    C V NHR  C C  G+ GDP S      EC+   + P        Q   PC  + PCG+NA+C        C C P   GDP++ C R EC  N DC  ++AC + KC DPC   +CG  A C+V  H  SC CP+G  GNP            Q CR+  +       C P     + C   + C   N    C C +NYIG           PA  PEC V  +C    AC+  +C DPC     C     CKV N +P+    C CP+    D ++                        G + QC  V  T                  EC +N +C +   C    C + C    CGFNA CS + H   C C  GYTG+P +GCN      +P   P                 + + PC +  PC   A C+  +    CTC   + G P + CR    PEC ++ DC+   +C+ QKC +PC  + CG NA C+  NH   CSC+  ++G+P + C E         RD         +NPC    CG  ++C      A+CSCLQG  G     C+P EC+   +C  +L C+N+KCVDPC   C   A C   NH   C+C P FTGDP+     I  EP          IP P     +C + R                          DCP+  AC+N+ C NPC+    C  ++ C V    P     C C+ G+TG     C  ++ +           +P    R     NPC N +PCGA A C+  N    C C   + GDPYS C P    EC  + DC  ++ CINN+C DPC     CG +A CR  NH P C C  G  G+PH  C   E  T +              +PC  + CG  + C      ++C C +G  G P   CK  +C    +C  N  C   N KC   C G  +C + A C+  NH   C C   ++GD  S C E  P V                   K  +NPC +  PC P+  C+ +         C C +G  IG    C     RPEC  + +C +   C +  CVD C  S CG NA C    H+++CSC  G+ G P   C L +P V P+ +P                                            C N+ DC +  +C    C+DPC  +  C   A C V  H   C CP GY G P  SC+P P+ P                +   NPC    CG N+ CR  N++AVCSC  G++  P     +P C    EC   +AC +K C DPC    CG  A C   NH  +C C     GDP+  C       DN            CV P  C   A+C    +   CSCL +F G            P +   EC+ + +C   E C +Q+C +PC  +  C   A+C V + LP+    C C++GY G    +C K E   +                                    GC+     +++C  + AC   +C++PC     CG+ A C V NH P CSC  GY GDP+  C+                                                EC    +C   + C+  +C DPC     CG  A C    H P+C CP G  GDP   C     +   D       +     DPC  + CG  + C  + +  +C C     G+P   C+  EC  N DC   + C  N  KC   C +S  C  NA C  + H   C CPT   G+ +  C    ++       + C  +++C ++       CI+E   NP          + CR             EC  ++DC     C+   C D C    CG  A C    H   C C  GYTG+P + C RV +  P  V   C                      +  PC + + C+V N    CSC + +IG+         KPECT ++EC ++ AC + +C +PCA   CG+NA+C V  H  IC C  +  GDP++ C  A          +        + PC    CG N+EC V + +A C CL +F G P   CR  EC+V++DC    AC  EKC DPC   C   ++C+V NH   CTC   +TGDP+    E + E  +                                         EC L  DC   KAC+ ++C +PC     C  N++C V + +P+    C+CL+GY+G     C     + +  C+ N                                     S+ S + AC+ R+C  PC     C   ARCQV+NH   CSC  G TGDP               + C   E       ++PC+  +PCG N+EC   N  + C C    IG P S     EC  N +CP  K C+ QKC +PC    CG NA C    HQ IC C  G  G P+  C+            KE+  + N    P   +P  C  NA C   N   +CQCLP ++GD Y  C        +P+C    DC    +C   +C+DPC     C     CSV+N LP    TC C           C     +   +V                  C    CG NS+C++   QA C C   Y G P             +  P C    +CP   AC + +C +PC     C I A+C+V +H  LC C  G+ G   T C           Y  P     I++   +PC    CG N++CR  +    C+C   ++G P      P C    ECP   AC+   C +PC    CG  A CS  NH  IC C  G  GDP+S C+P      +  P   Q       +P  C  NA C    + G CTC ++F GDPY   C P         EC+ + DCP ++AC  ++C+NPC     C + A C V + +P+    C C E   G   ++C  +   +   C+                       SPCG  S C+  N ++VC C   +IG P S C P    EC  + EC+  QAC+N +C DPC     CG  A C   +H   C CP+ F G+P   C                                                    EC+++ DC     C+++KC+ PC    CG  AEC V  H   C C  G  G+P+V CK                 +      R     + C  +A+C        C C   + GD    C         P C +D DCPS+ AC   +CQ+PC     C     C V + LPT T ++    D             N Y+N                  +  C  +   V        EC    +C     C +  CVD C  ++CG+ + C    H+  CSC++GYTGD +T C+  +P P                                           P+  P C  + +CPS  +C N+ C +PC     C  NA C VINH P+C+C +GYIG+P T C                                            +S +PEC+++ DCP  +AC+  KC  PCS   CG+NALC  NNH   C C     G+ +  C  P   + ++             +PC    CG N+QC      A+C C   + G P   CRP EC+ + DCP    C + KC DPC   C   A C+  NHR +C+C    +G+P+ ++C+                   Q    D   QNPC    PC  N++C+V    P    +C+C   + G     C          C S+ EC T+ AC N  CV+PC     C   A C V +H A C C  GF GDP+S C P+ D                  + +Q CN  +PC  NA C  +     C+C P   G+P++ C   EC+ N DCP +++C N+ C +PC  T CGQNAEC V  H A C C  GY G PY  C++           +E  +R     Y        C   ++C   +    C+C    IG         P + +PEC   S+C+ + AC+N  C +PC     C    +C V N  PI    C C  G +     +C +                        +  C+   CG N+ C+    + +C CLP ++G P            P+    C+I+ +CPS+ AC N+ C DPC    C  N +C VI H P+C+C  GYIG P + C     PE + D   P D          PC+ S CG N +CN      +C C+  Y GDPY  C  P C    +C   +AC+  +C +PC    CG NA C   +H   C+C +G +GN ++ C P               K +   +PCQ   C   ++C   N +         I   P     C  + +CP   AC +++C +PC     C   A+C V N  P     C C E Y+G     C+ I EP V                                 +G        C    +C T+ AC   +C +PC     C Q+A C V  H   C CP GM GDP+++C      E +Q                                            +SDC  NKAC + +C DPC     CG+NA+C  ++H P C C SG +GDP+  C      EY                                       EC   ++CP +KACV+QKC DPC  T CG +A C+   H  IC C  G  G  F  C              +K  ++   C P      PC   + C +Q     C C    +G              PECRI+ +CPS  ACIN KC++PC     C     C V++ +P    SC+C  G+                              G N  C         E  G      +PEC + +DC     C    C D C    C  NAIC   NH   C C   ++GN  V C P  P  +                                 PP CR    S+SEC ++  C N KC DPC  +  CG++A C V  H P C C   F G+P + C+    PP    +         C  +S+C                                P   AC+N KC DPC   CG +A CR ++H A+C C +G +G+P   C+ +               +    NPC   +PC  N ECI  N    C+C +D  G+PY  C   EC +N DC S RAC Q KC DPC     C  NA C  V H   C C    IG+P+  C  + P PI                  +++Y  NPC   +PC  ++ C  V+       VC+CR  +   P   R          P C    EC SN AC+N+ C +PC   CG  A C +  H PIC+CP   IG+P + C P    +    R       A   +PCL + PCG++A C    + A C C   + G P      CSI     ++ECP+  AC    C DPC     +   C V ++  S         D F                                  +C+C   YQGDPY +C     PECV   +C   +ACI +KC +PC     C   AIC V+  +      C CPD         C  +                                       P     C  N DCS S +C N  C  PC  ACG  A+C+ ++H P C+C+PG+ G+P ++C   +                                                C S++EC + H C N  C   C      CG +A CR ++H A CYC  G +G+PFV C              +E I  +    C+  NPCG+ +EC+ +N    C C   + GN    C      C +D DCPS+ +C+ ++C +PC  +  CG NA C V + +P    TC+C+ GY GD      P + C      I +    C  P+  G          C ++NG        C C      E+         PPG R          P+C    +C   K C +    C +PC    CG +A     +H   C C  GY+GDP   C P+  PP  +  D+ R
Sbjct: 8435 NTMFAPVVNTTDTSLINPCTVDTNCAPNEHCKLGHCRKKEPPGSPKTPEPCQSNNDCIESEACYMGLCQDPCEFAKICAATAKCTAKSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTEACINQLCQHPCDVHDPCATNAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQEDSCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQAC--INGKCSSPCQ----CGAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPKGLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRH-PVCYCPDNKIGNPFRLCDKPAVTIE-LCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCD----PNPCGPNANCVVAG-----DGQTACVCPDGLSGDPTSVIGCH---GYECQVDADCPNSKACMGYRCYDPCPG-ACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYA---------------LDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQP-ECDINSDCGDTLSCINHKCVDPCAGAICGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGVALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGS--CGRNAICNVYEHNPV----CACPTGLFGNPYEQCT-TKSVVETPPQPS-----------------CAKLH-CGANAECKRQHSGLACVCRKGYFGDPHIGCRP----ECVLNSDCPAEKACLNSKCVEACT--GVCGVNAVCRVVNHAPVCICAEGYSGDASIACNPFYLP-----PPERP-------HPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVC--QPECVVSSECAPNQAC--LNQRCTDPCP--GICGGGARCEVLNHNPICSCEANFEGDPFVACSPI----QDP----GRDIPVP--------KNPC-VPSPCGPNSICQIKQNRPV----CSCVANYIGSPPY-CRP-----ECTLSSECPSDKACINEKCQNPCA-NVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKI---------------------TERPGDHIDPC-YPNPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCR----PECIYSSECPSSLACIKQHCRDPC-TAACGANAECTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGT--CGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVINQDCPSNRACIRQRCEDPCIGI--CGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLD-----------PPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRP-ECVQNSDCPNNRAC--INMKCRDPCA--NACGFNAICRVAHHQPVCSCEPHLTGNPLRACVER-PSNMYLPLP----------------KDPC-RPSPCGLFSTCHVVGERPV----CAC-LPDYMGAPPNC-----KPECMTSAECPSDRACINQRCKDPCP-GTCGYNARCRCTNHSPICSCYDGYTGDPFHQCV-------PERKPPPIADPIVPP----------NPCVP-SPCGPNSQCQVSSSGAVCSCVTNYIGRPPG-CR----PECSINSECPARMACINARCADPCIG-SCGNNALCHVSLHAPVCMCEPGYSGDPFS-----GCYKIIETP-------IEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPYVECRP-ECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPI-VGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGT--CGNNALCRVVNHNPI----CSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLACINLRCRDPCVGT--CGIQTTCLVNNHRPICRCIDGYAGDPFS------ECSPKINVPV-------QVAQPCNPS-PCGANAVCKERNGVGSCSCLPEYNGDPYTEC-RPECVLNSDCSKNRACLNNKCRDPCP-GVCGVSAECHVINHAPSCSCPSGFTGNP-----------SQFCREIPRLPAPVEPCRP-----SPCGPYSQCREVNGHAVCSCVTNYIG---------TPPACRPECSVSSECAQDRACVNQRCADPCPGT--CGNEAICKVTNHNPI----CSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPNCRPECTINTECPANLACINERCQDPCP-GSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCN-----PQPPAIPD----------------ERLTPC-QPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCR----PECVVNSDCSRDKSCVNQKCVDPCPGV-CGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPPPERD---------ENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGS-APNCRP-ECIISSDCAQNLNCQNQKCVDPCPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGA--CGLHSVCTVIKHRP----ACECVPGYTGDPFSGCAIVQQI-----------APPDETR-----NPC-NPSPCGANAICRERNGAGSCACLPEYFGDPYSGCRP----ECVQNDDCDRSRACINNKCQDPC--PGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRP-------------EPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAP-PSCKP-ECVVSSECPQNRAC--INQKCEDPCRG--SCGNNAKCQVVNHNPICTCQPGMTGDPISGC-EPMPEV-------------------KNVENPC-VPSPCGPNSVCRQIG----NQAACSCNAG-YIGRPPTC-----RPECTNNDECQNHLSCQQERCVDPCPGS-CGSNAICQVVQHNAVCSCADGYEGEPLFGCQL-IPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPC--NNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTP----------------RPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNC--KPECVVSAECAPEKACVHKKCVDPCQH-TCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSP---APASCV-PSPCGPNAKCQIVGNSPACSCLPNFIG-----------APPRCRPECVLNSECGPTEACINQKCADPCSGS--CGFEAKCHVLNHLPI----CNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPCPGI--CGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNKKCVDPCAAA--CGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPD-------VKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSP-PNCRP-ECIINPDCQSTQACINN--KCSNPCPES--CGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNP---------YEGCR------------PECVLSSDCPTDKTCIRNKCQDPCPGI-CGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPC----------------------IPSPCGANSKCRVANGLAVCSCMETFIGAPPNC-----KPECTVNAECPSNRACHKFRCANPCAK-TCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPV------RRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAP-PNCRP-ECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDPCDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVDPCPGV--CGQNSQCDVSNHIPI----CSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPC--PGACGQFARCQVINHNPSCSCNTGYTGDPF--------------TRCYQEERKPPTTPDNPCQP-SPCGPNSECKVLNGNAACSCAATFIGTPPS--CRPECSINPECPPTKACIRQKCSDPC-VNACGFNARCNVANHQPICTCDVGYTGDPFTGCQ------------KEQERIVNEQVTPC--EPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSC--------RPECVRHSDCASNKACQQQKCRDPCPGT--CGSNADCSVTNHLP----TCTCRIGYTGDPYRYCHVEPPQLPARVTEP------------SQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLP------------PNCRPECVLSTECPTDKACISQRCQDPCPGT--CGINAECRVRNHSPLCQCRQGFTGDSFTRC-----------YPLPPPPPVIERVERDPCLPSPCGLNSQCRNVQGVPSCTCLPDFLGAPPNC--RPECTISAECPSNLACIRERCIDPCPG-SCGYAAECSVVNHTPICVCPAGFTGDPFSSCRP------APPPEPTQSEYVDPCNPSPCGPNAQC----NAGICTCLAEFHGDPYS-GCRP---------ECVLNSDCPRDKACHSSKCVNPCPGT--CGENAICDVINHIPM----CRCPERTAGSAFIRCSPVQITVSNPCRP----------------------SPCGPNSQCREVNQQAVCSCLPSFIGAPPS-CRP----ECTSNSECAPTQACLNQRCGDPC--PGTCGVGANCAVVSHSPFCTCPERFTGNPFIRCQPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCRPECVTSSDCSSQLACVNQKCVDPC-PGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKP---------------EIAYENEIRTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCR--------PECMLDSDCPSNRACQQLRCQDPC--PGTCGLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADTCGNNAICRVRNHSPICSCISGYTGDAFTRCFL-IPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPACSCLVNFIGQAPNCRPECTINSECPSQLACINQKCRDPCP--GACGQNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPRDRACVRNKCIDPCSG-TCGVNALCEVNNHIPICRCPEQMSGNAFFECR-PVPPAKIQ-------------NPCQPSPCGPNSQCRVVQQTAVCSCLANYVGSPPQ-CRP-ECVTNSDCPADQDCQNMKCRDPCPGTCGFNALCNVVNHRPFCSCPTGMSGNPF-VSCQ-------------------QLIIRDERPQNPCQP-SPCGPNSECRVSGDSP----SCSCLPEFVG-APPNCRP-------ECISNSECPTNQACINQKCVDPC--PGLCGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPIRDS---------------PPEVLQPCNP-SPCGVNAKCEERGGAGSCQCLPDYFGNPYDGCRP-ECVLNSDCPSNQACVNQKCRDPCPGT-CGQNAECQVVNHLATCNCLVGYTGDPYSICRIT---------VNEPPER----VYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGS--------PPACRPECTSSSECAADKACVNRKCVDPCP--NVCGQQAECRVRNHNPI----CTCLSGFTGDPFTRCYRQP------------PPPPVVEREPLDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTP------------PNCRPECSINAECPSHQACINQKCRDPCPGS-CGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPPED----------PCNPSPCGSNTQCN----NGVCSCLPEYHGDPYTGC-RPECVLHTDCDRSRACVRHKCVDPCP-GTCGTNAICEVLNHIPNCRCLEGMQGNAFIQCSPVP-------------KLDVVQNPCQPSPCGPNSQCRVVNQQAICSCITSFIGSPPFCRPECTTNSECPLNLACRNQKCSDPCPGV--CGRGAQCHVTNHSPF----CRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVTSSECPTNQACIQQKCRDPCPGL--CGQSAECRVLSHTPSCVCPEGMEGDPFTLCKEKRIQELDQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCRPECVLNSDCPSNKACQQQKCQDPCPGT--CGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPCPNT-CGDQAICRVVNHSPICSCRAGYTGDAFFRCFPKPPVPP---TPVQKTPVD--PCVP-----TPCGPYSQCRSQGDAPACSCLVGYIGA--------PPNCRPECRINAECPSSQACINEKCRDPCPGS--CGYGAICNVINHTP----SCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCP-GTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSNSECLSHLACVNQKCNDPCPGS--CGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPI-------------VQDVEIINPC-QPSPCGANAECIQRNGAGACQCLTDYFGNPYEGC-RPECVLNSDCPSNRACQQQKCRDPC--PGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYC-SQPPEPI------------------VHEYV-NPCQP-SPCGPNSNCREVN----EQAVCSCRSEFEGAPPNCR----------PQCTSSSECASNRACINQKCVDPCPGVCGQQAICEVRNHSPICRCPTAMIGDPFVRCIPRPTIAPPPLRDV-----APYRDPCLPS-PCGLYASCRNQQNQAVCSCLPNYFGTPPHCRPECSI-----NAECPSHLACIGERCRDPCPGACGQQTECRVISHVPSCVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICSNQGECKCVADYQGDPYVACR----PECVLSSECPRNLACIQQKCTDPCPGT--CGTNAICDVVNHI----AMCHCPDRMTGNAFVQCTPVQLDVYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECSTNYDCSPSLACQNQRCVDPCPGACGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNCRPECVSNSECSQVHVCSNNRCKDPCPGL---CGTDAVCRVISHSAMCYCQPGYSGDPFVRCAPH---------IQRESIEIV--QPCN-PNPCGAFAECRQQNGVGSCQCLPEYFGNPYEGCRP---ECVLDSDCPSQLACVNQKCRDPCPGS--CGQNAECFVRNHLP----TCNCLSGYVGD------PYRYCSIEPKPIREYVNPCQ-PSPCGPNSQ------CREQNGV-----ATCSCLP----EF------VGTPPGCR----------PECTVSSECNLDKACVRHK--CLDPCP-GACGSSANCQVVNHAPLCSCQAGYTGDPFTRCYPIPSPPTHIVHDYAR 16193          

HSP 8 Score: 1982.22 bits (5134), Expect = 0.000e+0
Identity = 1315/3535 (37.20%), Postives = 1792/3535 (50.69%), Query Frame = 0
Query: 6728 VNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNF------------------------------------------------ECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRL--CQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTDRDCPDSDVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLSPKPECIVDQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGDPYTFCRPYECLVDRDCPDQLKCDHEKCVDPCQ---CAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCEL-----------ITEPVV-------------------------VG--------CTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGF----------------------------------------------NGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQIC-----------NVNN-------------------------------------PCSRNALCIMQNHRPICKCPPGTIGDPHNFCHSYECLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLL----------------------DCHNDN---DCKDDEKCDRKTYTCYKVCNSNDECA-------------------IGAKCTARDHLKKCTCSHPLIGDGYSVCIEPP----------------------------------------------ESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKC-KKVTP------------------------------------------QPQCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHA-------PITIEPSLTAG---------------CTIDTDCPSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSC--ELPS---EPECLVDDDCPSDLACIHQSCKTPCSTS-TCGINAKCNVKSHRAICVCIAGYDGDPYQICEEPGCKSDIECPFDKACISRECQNPCLYDECGVNAECIPK-SHRAMCKCKKGHKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPCQCAKYAECDARNHR-------GIFPEPV--------EVEGCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHE--CEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEYECLRDNDCPLNKACVSQKCTDPCL--TTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLVVDSSPSKSVSCSCREGFYVGKNGDCIEVDGQ---PECRSHSDCRYNEQCQSGSCLDACRIRLCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECKPPTP-LSIGCSADSDCPVVEACLNTKCVDPCNCGENALCRKINHKAVCFCPSGFSGNPEVLCEKLECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPL-IGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCNCGGGAKCFLSGHRPICQCPEGFIGNPQIECNPAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPI--ISGCERNDDCSNSTSCINAICRSPCACGLNADCKIIDHQPVCTCKPGFYGDPEIECTDTVCQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNIVSCSDNSDCPTDKECINKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFI-GNKGTSCVKVSVTCEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECFPVKTCPANSGLILDNREECVCPTGFGFTENKDECIPCLKENGFILNNEGKCVCNDARGYEYNPDSGKCECP--PGERLNNFGIC--ERVPDCEEDPDCPTQKYCEKTNGTCSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIPPVKTDFPRPEMVVNCLSDGVLVNVDLKDGGNFRGVMYVKGHSKDSNCIKHIDSGGSLKPID--FQVSFGKCGLFHSQGEANFVLVVQKHPKLETYKAQAYRIKCLYDVGETNINVNFNVSMITTAGTVRNDGPPPNCTMKICNENGEDISSANVGEKLMLKVIVSPREIYGGLARSCIARSLDDSKFEEEYAVTDANGCATDPEIFQEWKLDRNTGYLTALFDAFKFPDSINLKFKCIVRICFGQCQPQNCGGRNAFGRRRKRESSHIIDGKVYT------GQLREETDVYSNAIETLESSPQNEPFNSATLGSGLESEGDEEVCVSKIGFIISLVITALLALVAVAIAVSCWLMAYRKRPKSSGPLPHPREFPNPLFSSPEPPIHHLDEPDPDYL 9870
             NPC   SPCG +S C  +   + C C   Y G P     P    EC  + +C S+ AC+N +C DPC  +  C YNA+C    H   C C  G+ G+P  SC                                                   EC+ N DC  DK CI +KC +PC  T CG +A C V  H + C CP G+QG+ +V C      +             + +   +  CQ    C  ++ C A     IC C   FIG           P   P C  + DCP    C++ +C++PC     C     C V +  P     C C  ++  N    C+ I   V    +RD            V+ C+ + CG  S C  +   ++CSC+  Y G P            P   P C +  DCP+  +CRN  CI+PC     C  +A C+V+ H PVC CP GY+G+  T C    +PE       P   A +I     PC+ + CG+NA C+ +N  + C C+ GY G+P  +C  P C  N +C + +AC+++ C DPC    CG NA C   NH  +C+C  GH G+PY  CR    +  R+ P        + V+PCQ   C   + C     +  C+C+ ++ G P          P     C   A+C + +ACI+++CQ+PC     C  NA+C V +  PL    C+C  G++G    +C             I +P V                         VG        CT + EC ++LAC N  C +PC     C   A+CSV NH  +C+CP G+                                              +GDPY+ C P    EC  + +C R ++C+  +C+  C            VN+                                     PC  NA C+ +N   IC C  G  G P N     EC S+ DC    SC N  CV+PC    CG NA C    H+A C+C   Y G+ ++ C  +                       C N N   +C+  ++       C   C S+DECA                     A+CT   H+  C C   + GD + +C+  P                                              E  +PEC  +S+C  N AC+ S CQ+PC     C     C + N IPI    C CP G++     +C ++VTP                                          +P+C  SSDC     C    C+ AC V  CG  AVC++ +HS  C C  N VG+P   C          P    P  + G               C I+ DC    AC ++ C DPC+N  C  NA CR I H+ VC+C   + GSP   C  +LP    +PEC+ D DC +D ACI+Q C+ PC  S  C   A+C+V+ HR +CVC  GY G+  Q C   GC+SD EC  ++AC++++C +PC + +CG  A C    +HRA C C  G++GNP V C+  EC  D +C  HL C+NE+C DPC C   A+C   NHR       G    P         + EGC MD +CPS+ AC   EC+NPC    PC  NA C V +TLPLRTM CSC  GY G+ D  C     P   GC++   C  + ACR   CVNPC    PCA++A+C   +H++ C+CP    GDP++ C    + +  C  DS+C    AC+   C DPC +  PC  NA C+  + RP+C C +G  GDP   CY+ EC  + DCP +K C+++ C DPC      CG  A+C  + H+ +C+C  G QG+PFI C    C+   DC  +E CD     C P+CD E  CA  A C+ + H+ +C C+P   GN  V C +PVKT +P+C  D DCPSK ACIN +C +PC+  + C P +TC V+D+ P ++++C C        + +C+ +        C+ +S+C   E C +G+CLDACR+  CG+NA C A +H + C C   F GNP + C      V     PGC  + +CP    C+N  C+ PC  +D CG  A+C V     +CRCP G+ G+P   C PP+  + +GC + +DCP  EAC+NT+C  PCNCG NA C   NH  +C+C  GFSGN +  C  + C SD++CS DK C    C NPC+  +PCA+N EC   NH + CRCP  + GDP+  C+ +EC  + DC S  AC  ++C+ PC   NPCA NA+C+ +QH + C C   L +GNP+  C   EP P  VE  C  D DCPS+LAC++D C++PC  L+PCH +A CSV+++ P RTMVC C E  +P    +C  +  P  PGC  D +CP  EAC++  CRNPCNCG  A C ++ HR +C C +GF GNP   C   GC  D EC S +AC+   C+NPCLINDPCG +A+C    + AQC C  G+ G+PY  C +IGC S+++CP  K C+N  C++PC+  NPCA  A C +++H A CRC V + G+PY  C   P P C  D DC    ACINE+C +PC VL+PC   AIC V  + PV+ M C CPDGYV     GCK  P I  + GC  + DC    SC+N++CR PC CGLNA+C+I DH+PVCTC+ GF G+PE EC+   C  +++C  TH CRN  C   C  +   CG  A+C  + H+A C C  G  GN  + C  + C  + +CPTDK C+N  C D C+ +  C     CKV +H+  C+C  G + G  G    +    C  D DCPS+++C+  EC+NPC   +PCG+NA+CSV DT+PVRTM C C+EGY G+ +++C     C    G + D   +CVCP G    +  + C PC +E GF ++  G CVC   RG   + + G+C CP   G RL   G C  E  P+C  +  C   ++C     TC +PC    CG NAF +  +H   CQCI GY+G+P+L C        +TDFPRP+MVV+CL+DGV V + + + G F GV+YVKGHSKD  C + ++  G   P    F+V FG CG+   +  A+FVLV+QKHPKL TYKAQAY IKC+Y  GE N+ + FNVSM+TTAGT+ N GPPP C M+I    GE+I+SA +G+ L L+V V P  IYGG ARSCIA++++D+  + EY VTD NGCATD  IF  W+ + +T  L A F+AFKFP S N++F+C +R+CFG+CQP NCGG NAFGRRR+  + +  D           GQLREE  + SNAI T E     +  N A +    +    E++CVS +G II+LVITALLALVAVA+AVSCWLMAYR+RPK+  PLPHP EFPNPLFS+P+     + EP PDY+
Sbjct: 19550 FNPCY-PSPCGPYSHCHNRFGVAACVCLPNYRGTP-----PNCRPECVINSDCPSSLACINEKCRDPCPGS--CAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSICGPNAVCNNGKCSCIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPCPGT-CGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQ-PTPCGPNSQCRAYHEQAICYCLPNFIG---------TPPGCRPECTSNSDCPLDKYCLNLRCRDPC--PGACGIRAICHVQNHGPL----CVCPPHLTGNPLLACQPI---VIPPVERDE-----------VNPCQPSPCGPNSECQATSGGARCSCLPQYHGTP------------PFCRPECVNSADCPADKACRNYKCIDPCPGS--CGFSALCRVVAHSPVCYCPEGYVGNAYTLCS---RPE-------PSPPAVVI----LPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICR-PECTVNSDCPSHRACMSEKCRDPCPG-VCGLNALCQVINHSPVCECHTGHVGNPYHSCR----IPQREPP------APEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTP----------PSCRPECVISAECPADRACINQKCQDPCPGA--CGLNAQCHVRNHSPL----CSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPC--PGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRP----ECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNC--RLECYSSSDCSQVHSCINNKCVDPCPGK-CGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCP--GVCGLEAICTMNNHIPI----CSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDAC-VGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNA-CGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHK-EPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQET-CALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADD-CGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYC---EPRP--VEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQGEQ--CGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTAL-DIYEYCTPCREEQGFRIDESGHCVCALERGMVID-ERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNHTNF---RTDFPRPDMVVSCLADGVQVEIHITEPG-FNGVLYVKGHSKDEECRRVVNLAGETVPRTEIFRVHFGSCGMQAVKDVASFVLVIQKHPKLVTYKAQAYNIKCVYQTGEKNVTLGFNVSMLTTAGTIANTGPPPICQMRIITNEGEEINSAEIGDNLKLQVDVEPATIYGGFARSCIAKTMEDN-VQNEYLVTDENGCATDTSIFGNWEYNPDTNSLLASFNAFKFPSSDNIRFQCNIRVCFGRCQPVNCGGYNAFGRRRRSIADNSTDATAIATNSGVEGQLREEITISSNAILTFEKR-SGQGLNDANIKPAAQRV--EDICVSMVGLIIALVITALLALVAVAVAVSCWLMAYRRRPKTIAPLPHPPEFPNPLFSNPD----AVPEPTPDYI 22948          

HSP 9 Score: 1355.5 bits (3507), Expect = 0.000e+0
Identity = 1069/3214 (33.26%), Postives = 1464/3214 (45.55%), Query Frame = 0
Query: 4470 PCECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVK--IEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKC---------------------------------PQGQAGNP-----------------HAYCY------------KYECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSV------------------------------------------------QCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGD-----------------------------PYKFCD---------------------EPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCK----------------------------------------PY-----DCLVDNDCLDHLRCTNTKCVDPCA--CAKYAECDARNHKAYCSCLVDFTGDPYGIACDPI----------------------------------------PEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQ--GNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACI--NER--CE-NPCFLNNPCSSSQECRIAELSQITIQTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQE--------------VEIG--------CSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSC--QLPQ---KPECTKDSECANHLACIQQKCQDPC-ASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVN-NHEARCKCLSSFKGDPYVKCRSYECLVDSDCPRHLACENEKCVDPCKCAKYADCKVTNHQGYCTCNSYYTGDPYGLACEPIPEPIEVECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLP---ISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQKCVNPC--DTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKI---QIKTECKVDTDCARSDMCKDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLP---IQPECTRDYECPDNKACIQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPC-HFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPC----KCARNADCEIKNHRGYCTCQSDF-TGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNFECLSNDDCPFDKKCISEKCISPCL-ETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCK---EVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATR----HTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTDRDCPDSDVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITP-GCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLSPKPECIVDQDCPLTKACIIGKCESPCSA-NICGINALCRANN----HRATCVCVSGYVGDPYTVCEXPGC----KSNLECLTTQ-ACINKDCLD------PCLFEQ---CGQNAQCNPRNHRAM---------CKCKEGHKGDPYTFCRPY---ECLVDRDCPDQLKC--DHEKCVDPCQ---CAKYANCDAKNHRGYCNCIADYTGDP 7336
            P  C   + C  R     C C+P++ G P    C P         EC  + DCPS  ACINE+C +PC     C  NA C+V++ +P     C C  G+TG     C +  I PV          C P++                CG  A C    +  +C C   + GDPY  C P    EC  + DC+ ++ CI  +C +PC    TCG  A+C   NH   C C                                 PQ    NP                  A CY            + EC +N DCPLDK C + +C DPC    CG++A+C  + H  +C CP  L GNP + C+ +                                                +C    DC  ++ C  +N+KC   C G  +C   ALC    H   C+C     G+ Y+ C    P  P                I     +PC +N  C P  +      LP              G   N   +  RPEC  + DC S   C    C D C    CG+NA C    H  +C CH+GH GNP  +C +P                  P Y        ++PC + +PC A + CR    +++C+C   ++G+P     P  +PEC    ECP   ACI QKCQ+PC    CGLNA C V+NH  +CSC  G+ GD                             PY  C                       P C  + ECP++ AC N+ C+DPC    CG  A+C   NH   C C  G+ GDP+T C+                                        PY     +C++++DC  +  C N KCVDPC   C   A CDA NH A C C    TG+ + ++C PI                                         +P     EC +  DC     C + +C +PC     C  NA C+           C C+  YTG    QC  I P+  +       C  +                PCG  ++C   N Q EC C   + G P          EC S D+C  +  C+  +C DPC  +  CG++A C+   H P C+CP G+ GDP   C           P D+        +PC  + CG  A C  +    +C C S L+  GNPY  C+  EC  N++C  ++ C  +  KC   C    +C + A C   NH   C CP    G+ ++ C +++     ++    S C     C   NE+  CE  P F  NP +  Q CR             ECT ++DC     C++  C+DAC V  CG  A C    H   C+C     GNP  QC       P +              V  G        C  + DC R  AC ++KC +PC     C   AIC+ INHK  CSC   + GS    C  QLP+   KPEC  D +C N  ACI Q C++PC  S IC   ARC V+ HR +CVC E Y G+    C   GCRSD EC +++AC+N++C DPC   QCG  A C  + NH ARC CL  ++G+P V+C   EC  D +C  HLAC NE+C DPC C   A C+V NH+  C C + ++G+P  + C+ +P   E  C +D +CP + AC   EC+NPC +  PC  NA C+V DTLPLRT+ C+CL GY G+ D  C + E  ++ GC ++       AC G  C +PC + +PC+ +A+C    H AICSCP  T GDP  +C     I TG C HDS+C  + +CI+ +C+DPC    PC  NAEC   N R +C C  G  G+P  QCY  ECK N DCP+DK C+ + CV+PC      CG  A C ++ HQ++C CP G QG+P+++C    C+ + DC   E C+  N +C P+C D + CA+NA C    H+  C+C P Y G+ +  C    ++  KPQC  D DCP +++CI++RC DPC     C   Q C+V ++LP R++ C+CP + +   +  C  I   ++ + C+ +++CA +++C +GNC++AC + +CG N++C    H A C C +G+ G+P  EC           NPGCS +DDCP    CRN  CI+PCA D+ C I A C V   +++C CP GY G+PQ  C  P   I   C    +CP N+ACI  QC +PC    CG NAEC V  H  +C C+ G+ G+    C   GC+SD EC   + C+NREC NPC   + C +NA C  +NHR  C C  G +GDP+  C   EC  D DC +NL C + +CV PC     CA+NA C+   HR  C C      G+PY   C+P P    VE  C +D DCPS  ACID +C +PC    PC   A C V +++P+RTM C C E         C K+ P    GC+SD  C    AC+   C NPC     CG  + CQ   H++VC C  G+ G+PY++C  +    C+ D EC S +AC+N  C +PC   + CG NA C  +++RA C C  G+ G+P+  C    C SN+DCP DK C +E+C++PC+    C  +AEC  + H +VC+CP    GNPYV C+   +  C  D+DC   + C     +C   C     C + AICE T      T +C CP  ++  GK  C          GC  D DCP+  +C++  C++PC     C    +C + D  P     C C      N   +C  I    EC  + DCP + VC +  C+ AC+   CGS + CL   H + C C+ G+ G+   AC           TP GC+SD +CP+  +C N  C +PC    +C  +  CKV +H P C+CP G +            P CI D DCP  KAC+ G+C +PC+A   CG+NA C   +        C C+ GY G+P   C+        K  +  +  Q  C     LD      PC  EQ     ++  C     R M         C    G++  P   C+P    EC  +  C D   C  D + C DPC    C   A C+A NHR  C CI  YTG+P
Sbjct: 19555 PSPCGPYSHCHNRFGVAACVCLPNYRGTPPN--CRP---------ECVINSDCPSSLACINEKCRDPCPGS--CAYNAVCRVHEHVP----NCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSI----------------CGPNAVC----NNGKCSCIPEYRGDPYVGCRP----ECVLNTDCARDKACIQQKCKNPCP--GTCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTPPGCRPECTSNSDCPLDKYCLNLRCRDPCPGA-CGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPFCRPECVNSADCPADKAC--RNYKCIDPCPG--SCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAV-------------VILPCNPSPCGVNAFCQPHNDLSVCQCLP--------------GYYGNPSEI-CRPECTVNSDCPSHRACMSEKCRDPCP-GVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIP------------QREPPAPEY--------VNPC-QPSPCGANSQCRESQGQAICSCLPEFVGTP-----PSCRPECVISAECPADRACINQKCQDPCPGA-CGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCP-GACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAF-VSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGK--CGLNAVCQAIQ----HRAHCECIPRYTGNAFVQCNPI-PVPRVPEPVRDPCQPS----------------PCGPNSQCTNVNGQAECRCLQEFQGTP-----PNCRPECVSHDECANTLACMNQKCRDPCPGS--CGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPK--------PRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCEC-SQLEYIGNPYEGCRP-ECVGNSECPANQACIRS--KCQDPCP--GVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLA--QGCR------------PECTLSSDCAKDRACINSKCVDAC-VGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCL--NACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNP-AVRCDLVPTQPE-GCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHK-EPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTG-CTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVC-DQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKT-PKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADD-CGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCN---CGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAY-CEPRP----VEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCN----CGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIG---CRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINE--QCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCN----CGLNAECRIKDHKPV----CTCRQGFEGNPEFECSKI----ECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIAC-----------TPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITGYTGNP 22554          

HSP 10 Score: 1345.1 bits (3480), Expect = 0.000e+0
Identity = 1096/3321 (33.00%), Postives = 1513/3321 (45.56%), Query Frame = 0
Query: 4962 PRIACYLPLPTVE---PSLTPGCSNHQDCPSYTSCRNRLCID--PCI-EDTPCAAGATCRVINHKSV-CTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPC---ACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKK--------IASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQITIQTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQLPQKPECTKDSECANHLACIQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCRSYECLVDSDCPRHLACENEKCVDPC--KCAKYADCKVTNHQGYCTCNSYYTGDPYG---------------LACEPIP--------------------EPI---EVECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGN---------------------------PHSQCYSY---------------------ECKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPF-YYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSN---------------------------------EIISENGICEKIQI----------KTECKVDTDCARSDMCKDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASIN------------------------PGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDC--QLP---IQPECTRDYECPDNKACIQQQCLNPC-TSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPK-NHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPCKCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCV--PVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNFECLSNDDCPFDKKCISEKCISPCL--ETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAI---KGLVECQTDRDCPDSDVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLSPKPECIV----DQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDCLDPCLF-EQCGQNAQCNPRNHRAMCKCKEGHKGDPYTFCRPYECLVDRDCPDQLKCDHEKCVDPC----QCAKYANCDAKNHRGYCNCIADY-TGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHSYECLSNKDCPLDKSCQNKICVNPCS-KTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLD---CHNDNDCKDDEKCDRKTYTCYKVCNSNDECAIGAKC----TARDHLKKCTCSHPLIGDGYSVCIEPPESIKP--ECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVNDP-CVKNAKCRVIYHEPVCTCSDGYIGSPQTSCELPSE-PECLVDDDCPSDLACIHQSCKTPC-STSTCGINAKCNVKS----HRAICVCIAGYDGDPYQICE-------EPGCKSDIE----CPFDKACISRECQNPC------LYDECG------VNAECIPKSHRAMCKCKKGHKGNPYVHCKPY---ECLYDPDCPDHLTCK--NEKCVDPCQ---CAKYAECDARNHRG 8036
            P ++  + +P+V    PSLTPG  N    PSY++   +  I   P I E  P       + + H +       G +  P      P +P   YD   PD          NPC    CG  + C  +   A C CL  Y G P      P C  + +CP+S AC N+ C+DPC    C  NA C  + H   C C  G+ G+P+  C+          +  ++    +  DPC    C   A C+       CSC+ ++ GDPY + C P         EC+ + DC   + C  Q+CKNPC     C   A C VY+ +     TC C +G  G    +C              +     +       +NPC    PCG  ++C   + Q  C C P + G P          ECTS+ DC   + C+  +C DPC     CG  A+C  + H P+C CP  L G+P   C           P     + ++ V+PC+ + CG  + C A      C+C+    G P   C+  EC  + DC  D+ C   ++KCI  C  S  C  +A C  V H   C CP   +G+ Y+ C +         I   + + C V++ C         +C  P +  NP   S+ CR             ECT N+DC     C+S  C D C    CG  A C    H   C C TG+ GNP   C      +PQ        +   P Y        +NPC    PC + + C+    +  CSC   ++G+   SC    +PEC   +EC    ACI QKCQDPC    CG+NA+C V+ H  +C C   + GD  + C         +        + + +DPC+   CG  ++C V N  A C CL ++ G     CR  EC ++++CP +LAC NEKC DPC   C   A C V NH   C+C + YTGDP+                  C+P P                    +P      EC L+ DCPR +AC+ Q+C +PC  +  C  NA C   + + +    C C +  +G     C  + +        N                   + +PC + A+C   N  AICSC  G  G P     P    EC   SDC    SCI+N+C DPC     CG NA C A  HR+ C+C     GN                           P+SQC +                      EC ++++C     C+ QKC +PC  + CG +A C    H   C CP G+ G P+  C     K   +           Y        P  C  NA C +      C+C    Y G+ Y  C        +P+C  + +CP   +CI  +CQDPC     C +   C+++N +P+    C CP                                    I +E  +CE +            + EC + +DCA+   C +  CV+AC V +CG+ + C+   H   C C     G+P  +C    P Q   I+                        P C  ++DC    AC + KC +PC     C I A C+ ++H+++C+CP  + GSP   C  QLP    +PEC  D +C ++KACI Q C NPC  S  C   A C V  HR LC C  GY G+    C   GC+SD EC   +AC+N++C +PC F +CG  A+C    NHR  C C++G++G+P   C+  EC  D +C  +L C NE+C DPC C   A C ++NHR  C C + F+G+P  + CD +P        C  D +CPS  AC   EC NPC    PC   A C+V DTLPLRTM CSC+ GY G+ D+ C K +P    GC S ++C    AC  GNCVNPC++ SPC   + C  Q H+++C C     GDP++ C   P  +  C  D EC    AC+N +C+DPC  AN C  NA C  +N R IC CP G+ GDP   CY  EC  N DCP+DK C++E C+ PC   +  CGN A+C  + H +VC CP+G QGNP++ C    C  + DC ++E C+     C  +C +E +C  +AIC   RH   C C   + G+    C   VK P  P C  D DCPS  ACI+++C +PC   + C+  Q C V DTLP R ++C+C  +   +   +C  I   K +  CQ + +C +++VC +G C+DACR   CG  + C    H ++C+C  G+ G+P   CY           PGC  + DCP    CRN +CI+PCA DD C I A C V   + +C CP GY G+P   C L P    +V      DCP  +ACI  +C SPC+   CG NA C   NH   C C  G+ G+    C   GC+S+ EC   + C+N++C++PCL  + C  NA+C  RNHRA C+C  G +GDP+  C   EC  D DC   L C   +CV PC     CA+ A C A  HR  C C      G+PY   CEP P   VE  C  D DC S+ ACID +CQ+PC    PC   A+C V +++P+RTM C C E         C  +  P + GC SD++C    AC +  C NPC     C + A C V  H+A C+C  GF G+PY+ C  +    C  D EC   ++CI   CI  C +N+PC  NA C +Q++R  C+C  G  G+P+  C    C SN DCP DK+CQN+ CVNPC     C   AEC  + H AVC+CP  + G+PY+ C+      C  D DC   + C  +   C   C   + C   A C    T+      C C    +  G   C +P   IK    C  DSDC T+ +C+NSVC++PC     C  N +C +++  P+    C C  G     + +C K+    +C  +SDC  + VC    CI AC   +CG NA C + +H   CEC+P   G+   AC             GC  D +CP+  AC N  C DPC     C ++  C+V +H P C C  G +   +  CE     P C+ D DCPS  AC+   C  PC +T  CG+NA C+V+        IC C+ GY G+P   C+       E G   D++    CP   A    E   PC        DE G           I +  R  C    G++  P   C+P    EC  +  C D+  C    + C DPC    C   A C+A NHR 
Sbjct: 19451 PPVSGIINIPSVPQPVPSLTPGVINLPSEPSYSAPIPKPGIINVPSIPEPIPSIPQNPVQEVYHDTQKPQAIPGVVNVPSAPQPTPGRP--YYDVAKPDFEF-------NPCYPSPCGPYSHCHNRFGVAACVCLPNYRGTPPNC--RPECVINSDCPSSLACINEKCRDPCP-GSCAYNAVCRVHEHVPNCYCQTGYTGNPFISCQ-------RTPIAPVQREPIEAKDPCYPSICGPNAVCN----NGKCSCIPEYRGDPY-VGCRP---------ECVLNTDCARDKACIQQKCKNPCPGT--CGLQALCHVYNHV----ATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAP--INPCQPT-PCGPNSQCRAYHEQAICYCLPNFIGTPPGC-----RPECTSNSDCPLDKYCLNLRCRDPCP--GACGIRAICHVQNHGPLCVCPPHLTGNPLLACQ----------PIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTP-PFCRP-ECVNSADCPADKAC--RNYKCIDPCPGS--CGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCL-PGYYGNP---SEICR------------PECTVNSDCPSHRACMSEKCRDPCPGV-CGLNALCQVINHSPVCECHTGHVGNPYHSC-----RIPQR-------EPPAPEY--------VNPCQ-PSPCGANSQCRESQGQAICSCLPEFVGTPP-SC----RPECVISAECPADRACINQKCQDPCPG-ACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPK--------SNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGA-APNCRP-ECTINAECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGH--CGLNALCDAVNHIAM----CHCPERMTGNAFVSCQPIRDDPPPPTTPNP-----------------CQPSPCGANAQCLERNGNAICSCLAGYFGQP-----PNCRLECYSSSDCSQVHSCINNKCVDPCPGK--CGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCPGS-CGQSAQCTVSLHIPNCQCPVGMTGDPFRICLP---KPRDEPKPPPTPKNPCY--------PSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGC--------RPECVGNSECPANQACIRSKCQDPCP--GVCGLEAICTMNNHIPI----CSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDAC-VGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEE--PRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCL--NACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNP-AVRCDLVP---TQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHK-EPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQE-TCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTP-KPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADD-CGIGAYCHVQQRKAICRCPPGYTGNPQERC-LPPSDVILVGCKSSTDCPSNEACINTQCASPCN---CGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAY-CEPRP---VEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCN----CGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSI---GCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINE--QCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGC-KPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCN----CGLNAECRIKDHKPV----CTCRQGFEGNPEFECSKI----ECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIAC----------TPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPG-KNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRA 22542          

HSP 11 Score: 1335.09 bits (3454), Expect = 0.000e+0
Identity = 1072/3241 (33.08%), Postives = 1494/3241 (46.10%), Query Frame = 0
Query:  977 FKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPT----------KTVAC----ICPTD------------TVVGIDGRCNRVQTS--------------PECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRP----HPECPDRLKCENEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYVACKEVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINPCAESSPCASSARCKVINHEPECTCPDGFIGSPTTDCRPR-------------------------------------DPYSFCRPYECLSDPECPDHLKCENEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKIS---------------------------------------------NSECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSFECKKNEDCPFDKECKSESCVDPCIDTQCGTLATCTVEYHKGICKCSS-GYQGNPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPL-----------------------LSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNC-----QPPERPECRVDAECPLDRACIHQKCQNPCSRL-TCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXE-NHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPCECARNADCKARNHRGYCTCIPNFTGDPYGIVCEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKI--LTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYCYKYECKTDNDCPFDKACAKEKCIDPCK--DTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEV---ELSTECQVNNDCQQFEICVDGTCRKTCSINSCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRP---INVPECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNH-AGDPHASC----YKYECRISDDCPFDKTCLNEKCVDPCDT-TRCGSKAICKA----EYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGSCIDACRV-NKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQ----HKALCTCPDGFIGSPTNDCK-KPIVPE---CLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPCE----CARNADCDARNHRGICTCILDFTGDPYGIACE---PIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEP-IIHTGCRSNTE----CAVSLACENANCISPC-----LKNNPCGN----IAQCSVRNHRATCTCPV--GFTGDPNS--LHAHQGECNFDTDCPDNKAC--INNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCYRYECKTN 4000
            ++   P+ +PEC ++ DCP  LAC++EKC+DPC  +  C+ +  C+V +  P             ++C    I P              ++ G +  CN  + S              PEC +  DC     C+   C + C    CG+ A+C   +H + CSCP G  G+    C        P   P        P  +       INPC + +PC P + C+  +   +C C   +IG+P   CRP    + +CP    C N +C DPC   C   A C  +NH  +C C P  TG+P  +AC+PI  P +E  E N                  PC    PC  N+EC+           C+C+  + G          P     C ++++C  + AC N KCI+PC  +  C  SA+CR   H P C C  G+ G+ Y+LCS          E  P  +V        PC   S CG NA C+  N   VC+CL  + G+P   C + EC  N DCP  ++C S  C DPC   VCG NA C V  H  +C+C +G  G+PY +C+  Q R+         C              + C AN++C  S+ +  C C   + G           P+ + EC +  +CP+  +CI+Q CQ+PC     C  + +C V +  P     C C P    +    C  V      +SN      D+ D       C   PCG  ++C      + CSC   + G              P   P C  N +CPS+ AC + KC +PC  +  C  +A+C VINH P C+CP G+ G P T CR                                       DPY+ CRP EC+ + +CP +  C N+KCVDPC   C  NA CDA NH  +C C    TG+ + ++C+PI          ++D   P+                 PC  NA+C   +        C+C+ G+ G+         P   + C S+S+CS   +C N +C++PC     C   A CQ + H A C C   YTG+ + QC  I                                                EC    +CA+  AC+N +C D C  +  CG+ A+C    H   C+CP G+ GDP   C           P D+     +  +PC  + CGT A C V+    +C+CS   Y GNPY  CR  +C  NS+C + + C     KC   C     C   A+C   NH   CSCP    G+ ++ C R V                     +    +     SPC P+  CR+     +    CECL G      G  +    + EC++ +DC +D  C    CV+AC V  CG  A C    H   CSC    +G+P   C + P + EP+                         P C ++ DC     C ++ C +PC     C + AIC+ I HK VC+CP  F GSP   C     +P  +PEC  D +C  D+ACI+Q C+NPC +   C   A C V  HR +C C +GY G+    C L GC SD EC  ++AC+N++C +PC F +CG    C+ + NHRA CHCL G++G   V C+R EC  D +C  HL C N++C DPC C   A C+  NHR  C C   F+G+P  + C+ +P    +   C  D +CPS+ AC   EC NPC +  PC  NA C+V DTLPLRTM C+C+ G+ G+ D  C K EP  + GC S  +C     CR G+C+NPC+  +PC  SAQC  + H+A+CSCP    GDP++ C +   +   C +D++CQ T ACI  +C +PC+    C   A C  +N R +C CP G+ GDP   CYK ECK + DCP+DK C  E C+DPC      CG  A+C+ + HQ+ C C  G QGNP++SC    C+ + DCA +E CD     C  +C D   CA NA C    HQ +C C   + G+ +  C   V+ P +P+C  D DCPS +ACI+ RC +PC     C   Q C V +  P + ++C+CP  T       C  +   ++ + CQ N++C   E+C +G C   C +  CG NA CT   H  +CNC  G+ G+P   CY   ++V  +  PGCS +DDCP    CRN  CI+PC+    C   A C     KA+C C  G+ G P   C P   + +  C    +CP + ACIN +C +PC+   CG NA+C V+ H  IC C  G+ G+    C       +GCRS+ ECS    C N ECINPC+ ++PC  +A+C  + H ANC CP G  GDP+  C     LEC  D DC+SN AC++N+C+ PC    PC  NA C    HR+ C+CP     G+P+A C     +  CR   DCP    C+++KC DPC   + C   A C            CEC      +    C+++   +   C S++ C  Q       C +  NC   A C+ + HR  C C   FEG+ Y+ C         + C++D +C   KACI   C +PC   +PC  N EC     V      C C      G  G   E    + C  N+DC T+  CQ+  C++ C   N C     C +  H + C C   + GN  V C        P   P C  D DCP   AC N QC++PC   +PC   A C+V         LC CPDG++      CK  P + E   C+SD +CP   +C+   C++PC+   CG NA+CR+++H+ +C+C  G+ G+P   C +  C  + +CP    C N+ C   C  E CG NA+C    HRAVC C+ GH G+    C P  C SD ECP    C N KC DPC     CA++  C   +HR  C C         G   E   PI         C  D DCPSQ AC+  EC NPC   +PC  NA C V DTLP+RTM C C+EG+TG    +C K    +I  G   + +    C    A +     +PC      + +  G+    + +  V + R  CTCP+  G+   P          EC  +  C DN+ C      C++PC+  K CG NA C    HR  C+C  G  G+P   C     +T+
Sbjct: 19579 YRGTPPNCRPECVINSDCPSSLACINEKCRDPCPGS--CAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSICGPNAVCNNGKCSCIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPCPGT-CGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAP------INPC-QPTPCGPNSQCRAYHEQAICYCLPNFIGTPPG-CRPECTSNSDCPLDKYCLNLRCRDPCPGACGIRAICHVQNHGPLCVCPPHLTGNPL-LACQPIVIPPVERDEVN------------------PC-QPSPCGPNSECQATSG----GARCSCLPQYHG--------TPPFCRPECVNSADCPADKACRNYKCIDPCPGS--CGFSALCRVVAHSPVCYCPEGYVGNAYTLCS--------RPEPSPPAVVIL------PCNP-SPCGVNAFCQPHNDLSVCQCLPGYYGNPSEIC-RPECTVNSDCPSHRACMSEKCRDPCPG-VCGLNALCQVINHSPVCECHTGHVGNPYHSCRIPQ-REPPAPEYVNPCQ------------PSPCGANSQCRESQGQAICSCLPEFVG---------TPPSCRPECVISAECPADRACINQKCQDPCP--GACGLNAQCHVRNHSP----LCSCQPGFTGDALTRCLPVPPPQPPKSN------DIRD------PCVPSPCGPYSQCRVVNGGASCSCLPNYVG------------AAPNCRPECTINAECPSNLACINEKCRDPCPGA--CGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRP-ECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAF-VSCQPI----------RDDPPPPTTPNPCQP---------SPCGANAQCLERNG----NAICSCLAGYFGQ--------PPNCRLECYSSSDCSQVHSCINNKCVDPCPGK--CGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCPGS--CGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPK--------PRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRP-ECVGNSECPANQACIRS--KCQDPCP--GVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQV---------------------TPPPPSDPCYPSPCGPNSICRIQNEKAV----CECLPGF----FGNPLAQGCRPECTLSSDCAKDRACINSKCVDAC-VGECGFGAVCQTINHSPVCSCPANMVGNPFVQC-EEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNA--CGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNP-AVRCDLVP---TQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHK-EPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVC-DQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTP-KPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADD-CGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCN---CGPNAECTVKNHHPICYCKPGFSGNAQFGC-----APIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCL---RLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCR-------SIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECY----VQSNRAQCRC----LSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDC-------RPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCN---CGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPI---------CISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLT-KVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNHTNFRTD 22566          

HSP 12 Score: 1143.64 bits (2957), Expect = 0.000e+0
Identity = 1050/3364 (31.21%), Postives = 1447/3364 (43.01%), Query Frame = 0
Query: 2011 PCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSFECKKNEDCPFDKECKSESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCRE--VQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNCQPPERPECRVDAECPLDRACIHQKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPCECARNADCKARNHRGYCTCIPNFTGDPYGIVCEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCV--KIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGD-----------------------------PHSYCY---------------------KYECKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTCRKTCSINSCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAP----------------------------IQD---------------------LECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAE---------------------KIPQAAKL----ECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGIC----QEVETKVECEYNDDCSTNDICQDGSCIDAC-RVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKV-VQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTAC-----EEPGCKSDFECPNKQACINRECQNPC-LFENCGINAECSPEN----HRAVCACLKGHKGDPYSFC-----KPYECLSDPECPNHLKCENEKCVDPC----ECARNADCDARNHRGICTCILDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNN-PCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKAC--INNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTC------YRYECKTNEDCPFDKACASEKCIDPCQTT-LCGSKAICNV----EYHQSSCKCPAGLQGNPYINCKELECRKH-QDCRDNEKCDMTTYKCTPLCTGSN--------KCASKATCEATNHQEKCFCPSNYIGDGYSFC---SLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIV-----NEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTIT-CGRNAICQARNHRAICSCIKSFS-GDPYTFCE----EPGCKSDFECRDNQACINRECQNPC-LFEKCGLNAECNANG----HRAICSCLQGHKGDPYSFCKPYE------CLSDPECPNHLKCKNEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPV----CKCPQGQAGNPHAYCYKYE-------CKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSN-CGVNAECATT----LHDSICSCHSGHTGNPRIAC-YLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCA---------AGATCRVINHKSVCTCPD--GYIGSPETSCRPPIKPECRYDTECPDHLAC--IQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNS-QACYNKNCQDPCLFDECGQNAKCFANNH 5142
            PCG  + C      + C C     G P  +C   EC  N DCP    C +E C DPC  + C   A C V  H   C C +GY GNP++SC+   +   +    ++K+ C                C  +AVC    +  KCSC     GD Y  C        +PEC++++D +R +ACI   CKNPC     C     C V         +C C EG Q     +C         +         +  +   +N C    CG N++C A   ++ C C P ++G P            P   P C  + DCP    C N  C +PC     C + AIC V  H P+C CP    G+P   CQP   P        P++R  +     NPC    CG N++C+  +  A C+CL  Y+G P   C+   C +  +CP  +AC N +C +PC    CG    C+   H  +C+C  G+ G AY  C R E       P+    V   C +P  C  NA C+  N    C C+P + G+P  I C P         EC  + DCPS  AC++E+C +PC     C LNA C+V +  P+    C C  G  G     C   + EP                     + +NPC + +PC  ++QC     +A+CSC   + G P S C+     EC    +C   +ACI  +C +PC     CG  A C  RNH  +C C  GF+GD                             P+S C                      + EC  + +CP + AC  EKC DPC    CG  A+C    H  +C C  G  G+P+ SCR V          ++ C        + C  N LC N           +C C  ++ GD Y  C         PEC ++ DCP + AC++ +C +PC  +  C  N +C   N+  +    C CP     +    C+ +               +     T    C  + CGANA C        C+C  GY G P      P   +E      C +  DC    +C N +C++PC     C  +A+C+ I H+A C C+  + G     C PI VP              +    ++PC    CG N+QC     +A C CL  + G+P       P     C S+ EC+ TLAC N +C +PC  +  CG SAQC V  H  NC CP G  GDP+  C P                            +Q                       EC  +++C +N+ACI ++C DPC     CG  A C   NH   C CPP + G+  A C +                     DPC  + CG  +IC+ +  K  CEC  G  GNP       EC   +DCA +  C   N +C+  C     C   A C+  NH   C CP    G+ +  C E                     ++   A      EC I++DC   +AC+   C+DPC  +N C  N  C+A          C CP   +      C     E E K EC  + DC+ +  C +  C + C + N C    RC    HR  CVC +GYTGNA   CYL           GC SD +C +  AC N+QC++PC   + C   A C+    H+A C C DG+ G+P   C++P   EC SD EC  HLAC  ++C++PC+   CG  AQCRV+NHRA C C  G+ G+P   C     +  GC  D ECP+K AC   EC+NPC +   CG NA C   +       +C+CL G+ G+    C     +   C S  +C +   C    CV+PC     CAR+A C A+ HR IC+C     GDP+    EP   P I+   C  D +C    ACIN+ C +PC    PC  NAEC+V ++ P+    C C  G+ G    +C K E      C+ N +C     C N NC+ PC      CGN AQC  +NH+A C CP G  G+P  +    G C ++ DC D++AC  +N  C+ P    + C  NAIC+   H+P C+C PG  G+PH  C       + +C  + DCP   AC +E+C DPC T  +C  +  C V         +CKCP     +   NC  +   K    C+ N +C  T      +C+  N        +C   A C A +H  +C CP  + G+    C    + +     P C  + DC     C  + C  PC  ++ C     C V      +   C CP   Y G+    ER    S+ I+     + DC S + C    C + C    CG NA+C+   H   C C  G++GN + GC             GC  +D+C    QC NR+CI+PC+   PC + A C   +H + C CP G  G P   C    + EC  D DC    AC+  +C +PC     C +NAICQA  HRA+C C      G+PY +CE    EP C+ D +C    ACI+ +CQ+PC +   C   A+C+          +C C +    D    C+         C SD +CP+   C + +C +PC C  NA C    HR +C+C   F G+PY              + C  D +C S  ACIN +C NPCL+  PC  NAEC V          C C+ G+ G   ERC  I      G    ++C  +   + + CVNPC+  NPC   A+C+  NH + C C + F+G+PY  C P     C  D DC   Q CIN QC+DPC     C + AIC      PV    C CP G        C           C ++ DCP DK C +  C DPC+   CGL A CR + H+ +C C QG +GNP  EC  ++C  + DC     C  +N  C P C G+  C S A C A  H+  C C     G+    C    PL     C++D +C    AC++  C +PC     C+  + CK     P     C CP GT  G N  C+     P C  D DC S   C  G CV+ C+ +  CGVNA C+      +   IC C  G+TGNP + C    L  +E            CP  T+        PC E+             A     VI+ +  CTCP   GY  +P   C+P   PEC  + +C D+  C    + C++PC +  CG+NA C   NHRA C C+ GY G+P   C+    ++DF  P+   +C     Q      E G N   +   H
Sbjct: 19557 PCGPYSHCHNRFGVAACVCLPNYRGTPP-NCRP-ECVINSDCPSSLACINEKCRDPCPGS-CAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSI------------CGPNAVC----NNGKCSCIPEYRGDPYVGC--------RPECVLNTDCARDKACIQQKCKNPC--PGTCGLQALCHVYN----HVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTP------------PGCRPECTSNSDCPLDKYCLNLRCRDPCP--GACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIP--------PVERDEV-----NPCQPSPCGPNSECQATSGGARCSCLPQYHGTP-PFCRPE-CVNSADCPADKACRNYKCIDPCPG-SCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPE-------PSPPAVVILPC-NPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEI-CRP---------ECTVNSDCPSHRACMSEKCRDPCPGV--CGLNALCQVINHSPV----CECHTGHVGNPYHSCRIPQREPPAP------------------EYVNPC-QPSPCGANSQCRESQGQAICSCLPEFVGTPPS-CRP----ECVISAECPADRACINQKCQDPCP--GACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGA-CGFAAQCSVINHTPSCSCPAGYTGDPFTSCR-VLPPPPPPKTPSDPCQ------PSPCGANALCNNG----------QCSCLPEYHGDPYTGC--------RPECVLNSDCPRNRACVNQKCVDPCPGH--CGLNALCDAVNHIAM----CHCPERMTGNAFVSCQPIR--------------DDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQP------PNCRLE------CYSSSDCSQVHSCINNKCVDPCP--GKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPR-------------VPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTP-------PNCRPECVSHDECANTLACMNQKCRDPCPGS--CGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCPGV--CGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQ-------------VTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRAC--INSKCVDACV--GECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPC--LNACGINAICRAIN----HKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLL----------GCRSDGECAANEACVNQQCVDPCGFTQ-CGTGAICRADFNHRARCHCLDGYRGNPLVRCERP---ECRSDDECAFHLACRNERCEDPCN---CGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEP---PEIK-TGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPI----CFCPAGWGGDPQVQCYKPE------CKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNP-FISCITGHCQYNEDCADHEACDRLNRVCR-PVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTE-----VCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADD-CGIGAYCHVQQ----RKAICRCPPG-YTGNPQ--ERCLPPSDVILVGCKSSTDCPSNEACINTQCASPC---NCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPI----------GCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCL---RLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYA---------SCRSIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNR----AQCRCLSGYRGNPYERCRVI------GCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCN---CGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVC--RNQLCIPACQGEQ-CGSNAQCLAIEHRAVCECIPGHGGNARIAC---TPL----GCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRP----QCACPPGTVPGKN-GCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNHTNFRTDFPRPDMVVSCLADGVQVEIHITEPGFNGVLYVKGH 22601          

HSP 13 Score: 1130.16 bits (2922), Expect = 0.000e+0
Identity = 1027/3309 (31.04%), Postives = 1408/3309 (42.55%), Query Frame = 0
Query: 2398 NPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPCECARNADCKARNHRGYCTCIPNFTGDPYGIVCEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYCYKYECKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTCRKTCSINSCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCY---------------------------------------------KYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQ---------DGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDC-KKPI------------------------------------------------VPECLSDPECPDHLACIQQKCQNPCSSI----------------------------------------------TCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPY-----------------------SFCKPY---------ECLSDPECPNHLKCENEKCVDPC--ECARNADCDARNHRGICTCILDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVR-NHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCYRYE-----CKTNEDCPFDKACASEKCIDPCQTTL-CGSKAICNV----EYHQSSCKCPAGLQGNPYINC-----KELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVCYEGSCINACLIK--KCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQC-RNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPP---KKPECTIDPDCNDAYACIRQKCQNPCSTI-TCGRNAICQARN---HRAI-CSCIKSFSGD------PYTFCEE-PGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPYE----------CLSDPECPNHLKCKNEKCVDPC---ECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCP-QGQAGNPHAYC----YKYECKTNQDCPLDKVCTSEKCVDPCD-------TTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQ------CRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSN-CGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSV----CTCPDGYIGSPETSCRP-PIKPE---CRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPCA----CAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYE-----CLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVK-----IEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCG---------SYAKCNVQNHQPECSC--SPGYTGDPYALCQETSTKECTSDDDCQTSETC--IQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYC 5422
            NPC    CG  + C      A C CL  Y G P + C+   C  + +CP+  ACIN +C++PC    C     C+   H   C+C +G+ G  +++C+R         P       D C  P  C  NA C    + G C+CIP + GDPY + C P         EC  + DC    ACI ++C NPC     C L A C VY+ +     TC+C EG  G    RC              +     +  R    INPC +  PC  ++QC     +A+C C   + G P   C+     EC  ++DC   + C+  +C +PC     CG  AIC  +NH  +C CP   +G+P   C           P      +   ++PC+ + CG  +EC      + C C     G P   CR  EC N  DC +++ C  R  KC   C  +  C  +A C  + H   C CP  + G+ Y  CS    RP+          PS  A +   C NP     PC  N  C+  N+  +    C+C  G Y +    C+      EC VN+DC     C+   CR  C    CG NA+C  + H   C C  G+ G+P  +C  P              +   P Y        +NPC   SPC  ++ C+    +A+C+CL  FVGTP + CRP    EC++ AECP   ACIN+KCQ+PC    CG NAQC V+ H  +C+C  G+ G   T C                 P    K+ +  +PC+ + PCG  +QC+V    A+C C   Y G    NC P    EC  + +C SN ACIN +C DPC     CG  A+C   NH   C CP  + GDP  SC                                              + EC ++ DCP ++ C+N+KCVDPC    CG  A+C A  H   C CP  + GN ++ C+ +   +D           Q           + C   A C   N    C C   + G          P   +LEC    DC    +CI + C DPC                                 G N +CQ ++ +  CE     + N   Q              D C+ + CG N++C +   ++EC CLQ + G              P+  P C S  +C +  AC N++C +PC     C  +A C V  H   C CP G  G P   C  KP                                                  PEC+ + ECP + ACI+ KCQ+PC  +                                               CG N+ CR+QN +A+C C  G+ G+P      P C    +C   +ACIN +C + C+ E CG  A C   NH  VC+C     G+P+                         C+ Y         EC+ + +C     C ++KC DPC   C  NA C A NH+ +C+C  +F G PY      +PEP   + EC  D DC +  ACIN+ C NPC     C   A C V    PL    C C EG+TG   + C  +      GCRS+ ECA + AC N  C+ PC     CG  A C    NHRA C C  G+ G+P  +   + EC  D +C  + AC N +C++PC     CG  A C  E HR  C+CP G +G+P   C         C  + +CP   AC   +C +PC  T  CG+ AIC V          C C  G  G   I C     ++  C  H  C+D E C      C   C  ++ CA  A C A  H+  C CP    GD ++ C  P  P I+  C  D +CQ   ACI  +C DPC   NPC    EC+V NS P+    C CP+        QC +     EC +N DC     C   +C++ C     +CG  AQC    H A C C  G  GNP   C              C YN+DC  +  C R  +   P  + + C + AIC    H+  C C  G+ G+P   C  P    KP+C  D DC    ACI ++C +PC+T   C     C   +    RA+ C C      D      P T  +   GC+ + EC + + C N  C + C  E+CG+NA+C A  H A C+C +G +G+P   C   E          C  + +CP    C+NE C+ PC   +C   A C  +  + IC C P +TG+P       +P   +  V C    DCPS  ACIN +C +PC     C  NAEC V +  P+    C C  GF+G     C  I      G R   ECS +     + C+NPC+  +PC   A+C   NHR+ C C +G  GDP+  C+     EC+ D DC+ N  C++N+C+ PC +++ C ++AIC+   HR VC+CP Q   GNP+AYC     +  C+ + DCP    C  +KC DPC        T QC +  L        +CEC +    +    C+ +       C  DQDC D E C          C    NC + A+C+   H+  C C     G+ Y+ C           C+ DG+C    ACI+  C NPC +NDPC P+ EC            C C SG        C+ +     C  + DC +   C    CV+ C   N C   AEC    H ++C C     GNP + C        P   P C    DCP   +C N  C+DPC+   PC   A C V     V    C CPDGY+   +  C+P P   E   C  D++CP   +C+   C++PC    CGLNA CR+++H+ VC+C  G+ G+P   C +  C  + +CP +  C N+ C   C  ++CG NA+C A  HR++C C  GH G+    C P  C  D++C     C N KC DPC     CA+   C   +H+  C+C       P G     +P     E E     C++D DCPS++ C   EC NPC   +PC  NA C V DTLP+RTM C C++GYTG    QC K     IE            C    A +I +   PC  ++            +  +  V + +  C+C    GY   P   CQ     ECTS+D C  +  C      C DPC   K CG NA C++  HR  C+C  G  G+P  +C
Sbjct: 19551 NPCYPSPCGPYSHCHNRFGVAACVCLPNYRGTPPN-CRPE-CVINSDCPSSLACINEKCRDPCPG-SCAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIE---AKDPCY-PSICGPNAVC----NNGKCSCIPEYRGDPY-VGCRP---------ECVLNTDCARDKACIQQKCKNPCPGT--CGLQALCHVYNHV----ATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAP--INPC-QPTPCGPNSQCRAYHEQAICYCLPNFIGTPPG-CRP----ECTSNSDCPLDKYCLNLRCRDPCP--GACGIRAICHVQNHGPLCVCPPHLTGNPLLACQ----------PIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPF-CRP-ECVNSADCPADKAC--RNYKCIDPCPGS--CGFSALCRVVAHSPVCYCPEGYVGNAYTLCS----RPE----------PSPPAVVILPC-NP----SPCGVNAFCQPHNDLSV----CQCLPGYYGNPSEICRP-----ECTVNSDCPSHRACMSEKCRDPCP-GVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIP------------QREPPAPEY--------VNPCQP-SPCGANSQCRESQGQAICSCLPEFVGTPPS-CRP----ECVISAECPADRACINQKCQDPCPG-ACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPV-------------PPPQPPKSNDIRDPCVPS-PCGPYSQCRVVNGGASCSCLPNYVGA-APNCRP----ECTINAECPSNLACINEKCRDPCPGA--CGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPG-HCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPI---RDDPPPPTTPNPCQP----------SPCGANAQCLERNGNAICSCLAGYFGQ---------PPNCRLECYSSSDCSQVHSCINNKCVDPC-----------------------------PGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTP------------PNCRPECVSHDECANTLACMNQKCRDPCPGS--CGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGE-CGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPE-PKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPL----CVCNEGYTGNALQNCYLL------GCRSDGECAANEACVNQQCVDPCGFTQ-CGTGAICRADFNHRARCHCLDGYRGNP-LVRCERPECRSDDECAFHLACRNERCEDPCN----CGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGG--NCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEP--PEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPI----CFCPAGWGGDPQVQCYK----PECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGH----------CQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERC---LPPSDVILVGCKSSTDCPSNEACINTQCASPCN----CGPNAECTVKNHHPI----CYCKPGFSGNAQFGCAPI------GCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCL---RLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSV--LNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQ------CRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCR-------SIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNR----AQCRCLSGYRGNPYERCRVIG----CSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDC-------RPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCN---CGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCAC-------PPGT----VPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPC-LTKVCGVNAFCNAVNHRAQCQCITGYTGNPDLHC 22558          

HSP 14 Score: 1109.36 bits (2868), Expect = 0.000e+0
Identity = 1012/3256 (31.08%), Postives = 1402/3256 (43.06%), Query Frame = 0
Query: 3177 INPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPCE--CARNADCDARNHRGICTCILDFTGDPYGIACEPIPEPVIEEV---------------------------------------ECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGD-PNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCY---------------------------------------------RYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPC----FTNNPCLPLQ-----EC-------KVLNSSPLKTVSCICP-----SDMYIGSSGQCERVEGTSEC-----------------IVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGC--------------------------NIAMVHVEPSL----------------EPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQ----KCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPY-----------------------SFCKPY---------ECLSDPECPNHLKCKNEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQV-TNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYC-----YKYECKTNQDCPLDKVCTSEKCVDPCDTTQ-CGLKALCRT----EYHQSICECPQGLQGNPYVEC-----KSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSN--CGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSC--RNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIK---PECRYDTECPDHLACIQQKCQNPC-TSVTCGLNAVCRVQN---HRAV-CSCLGGYVGDPYKFCDE-------PGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYD----------CLVDNDCLDHLRCTNTKCVDPCA---CAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGL-AGDPHSYC--YKYECVTKDD--CPFDKTCLAKNCVDPCKN-TICGVRASCNAEH----HQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAE-------LSQITIQTQAEC-----TTNNDCRXTDVCLSGTCIDACKVF-PCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKP----FCSCRDGYIGSSETSCQ----LPQKPECTKDSECANHLACIQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCRSYECLVDSDCPRHLACENEKCVDPCK----CAKYADCKVTNHQGYCTCNSYYTGDPYGLACE---PIPEPIEVECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEE-IKEYGCKANSDXS----PNLACIGRQCTSPCREKNPCS---------STARCQVLNHLAICSCPV--GTTGDPNYSCLPISTGECKHDSDCLNSESC-IDNQ-CEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYECKTN 6123
             NPC  + PCG  + C  +   A C+C   Y G P  NC P    EC  ++DC S+ ACIN +C DPC  +  C  NA C    H   C C   + G+P  S     C+ +   P  +  +  K  DPC  + CG  A+C    + G C C    +G+PY+ C+  EC  +TDCA ++ C  Q  +C   C     C   A C   NH   C CP   +GD +  C  K                      +    +PC    PC  N +C+A+    +    C C    FIG+   C     + EC  N DC  +  C +  C D C    CG    C    H   CVC    TGN  +AC       +P ++P    D+             +NPC +  PC P + C+     A C+C   + G+P   C+    PEC++  +CP   AC   KC +PC   +CG +A CRV  H  +C C  GYVG+ YT C  P        P+  A +      PC    CG+NA C P N  +VC CL G+ G+P   C+P EC  + +CP+H  C +EKC DPC   C  NA C   NH  +C C     G+PY     P  EP   E                                        EC    +CP+  ACIN++C +PC     C  NA+C V +  PL    C+C  GFTG    RC+ +                    ++ +   PC+ + PCG  +QC V N  A+C+C   + G  PN     + EC  + +CP N ACIN +C++PC     CG  A C    H P C CP G  GDP ++C                                              R EC  N DCP ++AC ++KC+DPC    CG  A+C+   H + C CP  + GN +++C+ +        RD+     T   C P     + C + A C   N    C C + Y G           P    EC    DC  V +CI +KC DPC      N  C  +Q     EC         +  +P+       P          G + QC  V G +EC                 + +++C +T  C    C + C    CG +AQC+  LH   C+C  G TG+P   C                           +  V  E  +                 P C  N +CP+   C   KC DPC     C + AIC + +H  +C+CP G+ G                    N    C RQ       +PC    CG N+IC+ +N +A+C C+  F G+P      P C    +C  ++ACIN +C + C+ E CG  A C    H  +CSC     G+P+                         C+ Y         EC+ + +C     C ++KC DPC   C  NA C A NH+ +C+C P+F G PY      +PEP   + EC  D DC +  ACIN+ C NPC     C   A C V    PL    C C EG+TG   + C  +      G R   EC+ N A   Q CV+PC     CG  A C+   NHR++C C  G+ G+P   C      EC  D +C+ +  C N +C DPC     CG  A CR ENHR  C+CP G +GNP   C         C  + +CP    C   +C +PCD T  CG  A+C           +C C  G  G   + C     +   C     C+D E C   N  C   CL  + CA  A C A+ H+  C C     GD ++ C+E  P   K  C  D +C+ + ACI+K CQ+PC   +PC+ + EC+  ++ P     C CP+G        C +    PEC+ + DC     C    CVD C+     CG  A+C    H ++C C +G  GNP I+C          +T  C  ++DC  + +C   NR+C   C ++T CA  A C    H+  C C  GY G+P   C  P+K   P+C  D +CP  LACI ++C +PC T   C     C V +    RA+ C C G  V D  + C          GC+ + EC N++ C N NC D C  + CG NA+C A +H + C C +G +G+P   C   +          C  ++DC     C N  C+ PCA   C   A C  +  KA C C   +TG+P       +P    +   C +  DCPS E C + +C +PC     C  NAEC V +  P+    C C  G++G     C  I      GC+S+ EC  +  C   +C+NPC    PC   A+C  +NH+  C C  G  GDP+  C      EC SD DC ++  C+  +C  PC    PC +NA+C + +HR VC+CP+ L  G+P++YC     E V +DD  CP    C+   C DPC   + C   A C+  +       +C C      +    C+++   R   C  D+ C          C     C  NA C+   H+  C C     G+ Y+ C        +  C+VD +C   +ACIN  C NPC +N+PC  + EC +         LS         C     ++NNDC     C +  C++ C    PC   A+C    H A C C   + GNP   C       PQ +   C  D+DCP   AC N++C++PC V +PC   AIC+V    P     C C DGY+   +  C+    + +   C  DS+C    +C+   C+DPC    CG+NA CR+K H+ +C C + + G+P   C +  C  + +CP    C N+ C   C  EQCG NA+CL   H A C+C+    G+  + C    C  D +CP   AC N KC DPC     CA+   CKV +H+  C C         G   E   PI       C  D DCP QKAC+  EC NPC    PC  NA C V DTLP+RT+ C CL+GY+G    +C +    + E G   + D      P  A    +  +PCRE+             +  R  V++    C+CP+  G    P   C P    EC  +  C ++  C +D + CEDPC     CG NA C A NHR+ C+C  G  GNP   C     +T+
Sbjct: 19550 FNPCYPS-PCGPYSHCHNRFGVAACVCLPNYRGTP-PNCRP----ECVINSDCPSSLACINEKCRDPCPGS--CAYNAVCRVHEHVPNCYCQTGYTGNPFIS-----CQRTPIAPVQREPIEAK--DPCYPSICGPNAVC----NNGKCSCIPEYRGDPYVGCRP-ECVLNTDCARDKACIQQ--KCKNPCP--GTCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPK---PKPQPPAPAPPTTLPAIVPQRAPINPC-QPTPCGPNSQCRAYHEQAI----CYC-LPNFIGTPPGC-----RPECTSNSDCPLDKYCLNLRCRDPCP-GACGIRAICHVQNHGPLCVCPPHLTGNPLLAC-------QPIVIPPVERDE-------------VNPC-QPSPCGPNSECQATSGGARCSCLPQYHGTPPF-CR----PECVNSADCPADKACRNYKCIDPCPG-SCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPE-------PSPPAVVIL----PCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRP-ECTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPCPGA--CGLNAQCHVRNHSPL----CSCQPGFTGDALTRCLPV--------------PPPQPPKSNDIRDPCVPS-PCGPYSQCRVVNGGASCSCLPNYVGAAPNC----RPECTINAECPSNLACINEKCRDPCP--GACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPG-HCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPI--------RDDPPPPTTPNPCQP-----SPCGANAQCLERNGNAICSCLAGYFGQ---------PPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCP-GSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPC--PGVCGLEAICTMNNHIPICSCPPGYTG--------------------NAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGE-CGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPE-PKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPL----CVCNEGYTGNALQNCYLL------GCRSDGECAANEACVNQQCVDPC-GFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRC---ERPECRSDDECAFHLACRNERCEDPCN----CGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGN--CVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYE--PPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPI----CFCPAGWGGDPQVQCYK----PECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISC----------ITGHCQYNEDCADHEACDRLNRVCRPVCDQET-CALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERC---LPPSDVILVGCKSSTDCPSNEACINTQCASPCN----CGPNAECTVKNHHPI----CYCKPGFSGNAQFGCAPI------GCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRL---ECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCR-------SIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPP----PQPI---CQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCN---CGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPI-------CISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKV-CGVNAFCNAVNHRAQCQCITGYTGNPDLHCNHTNFRTD 22566          

HSP 15 Score: 1108.98 bits (2867), Expect = 0.000e+0
Identity = 1046/3362 (31.11%), Postives = 1444/3362 (42.95%), Query Frame = 0
Query: 1651 PDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINPCAESSPCASSARCKVINHEPECTCPDGFIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCENEKCVDPCE---CARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKISNSECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSFECKKNEDCPFDKECKSESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNCQPPERPECRVDAECPLDRACIHQKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPC--ECARNADCKARNHRGYCTCIPNFTGDPYG---------------IVCEPIP--------------------EPVIE-EVECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYCYKYECKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFE-CKEVELSTECQVNNDCQQFEICVDGTCRKTCSINSCGANAVCTPVIHGFKCNCFDGYTGD------------------------PNSACY----------QPVLNVEPLLE---PGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDC------RPIN-----------------------VPECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQ---PVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLT-TNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVE-----CRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASN----HRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQE-VETKVECEYNDDCSTNDICQDGSCIDAC-RVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDK-PCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLAC--IQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACE------EPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPEN---------HRAV-CACLKGHKGDPYSFCKPYE-------CLSDPECPNHLKCENEKCVDPC---ECARNADCDARNHRGICTCILDFTGDPYGIAC--EPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCYRYECKTNEDCPFDKACASEKCIDPC-QTTLCGSKAICNVEYHQSSCKCPAGLQ-GNPYINCK----ELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATN----HQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDP--CFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVCYEGSCINACLIK-KCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTI-TCGRNAICQARN----HRAICSCIKSFSGDPYTFC-------EEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPYECLSDPECPNHLKCKNEKCVDPC---ECARNADCDARNHRGICTCIPDFTGDPYGIACEPI-----------------------------------------------PEPVIEEVECNEDRDCP---------SQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEP-VVDVGXRXXSE----CSPNLAXRXQNCVNPCINENPCG---------AYAKCQVTNHRSQCDCGI--GFIGDPYSSCVPASNEECNYDGDCSDNQVC--INNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYECKTNQDCP-LDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICEC 4755
            P  DV       N C   PCG  + C  R   + C C   + G P            P   P C  N DCPS  AC + KC +PC  S  CA +A C+V  H P C C  G+ G+P   C+ R P +                ++ E  +  DPC    C  NA C+     G C+CIP++ GDPY + C P         EC  + DC    ACI ++C NPC     C   A C VY+ +     TC+C EG  G    RC              +     +  R    +NPC +  PC   ++C+  +  A C C   + G P          EC  ++DC  ++ C+N +C D C     CG  A C    H  +C CP  L G+P ++C        E        + E  V+PC  + CG  + C        C C   Y G P   CR  +C  ++DC + + C  + YKC   C    +C  SA+C+   H   C CP   +G+ Y+ C+RP             + S     I     +PC V + C P  +  V          C+CL G     +  C     + EC++++DC     C    C + C    CG+NA C    H   C C+ G++G+P ++C + P    P            P Y        +NPC + SPC   + C+  Q + +C+C   F+G+P     P  RPEC + AECP DRACI+QKCQ+PC    CG NA C V NH  +C+C  G+ GD  + C         +        + + ++PC+   CG   +C+  N  A C CL  + G A  NC R EC  +++CP++L C+N+KC DPC   C   A C   NH   C+C   +TGDP+                  C+P P                    +P      EC  + DCP   AC+N++C +PC  +  C LNA C   + + +    C C E  TG     C   +PI +         D         C     + +PC  +AQC  R+  A+CSC  GY G P + C+     EC   +DC +  +CI N+C +PC     CG  A+C+   HR+ C+C   ++G+    C        N  P  +    E   DPC+ + CG  ++C     Q+ C+C Q  QG P  +CR  EC + ++CA+   C     KC   C  +  C  +A+C    H   C CP   TGD +  C    R   +P       C                   PC  N +C+VQ  +      CEC    Y  + +E C+      EC  N++C   + C+   C+  C    CG  A+CT   H   C+C  GYTG+                        PNS C            P     PL +   P C+   DC     C N +C++ C +G  C   A+C+ INH  VC+C    VG P   C       PI+                        PEC+++ +C    AC+++KC++PC    CG NA CR   H+A+C+C   + GSP+  C  Q   P     C S+ +C+   AC N  C NPC ++N C   A+C V+ H   C+C  GY G+   NC     L C+ D +C++NEAC+N QC+DPC   + CGT A C    NHR+ C C   + G+P   C + ECR  D+C F   C NE+C DPC+   CG  A C+ E H+  C CP G  GNP + C  V      C  D +C S   C      C   C   + C   A CE  +        C C P + G+    C ++ P+     C     CQ T+AC    C +PC   +PC+ + +C A     +    C CP+ T       C E  E K  C ++ +C     C +  C D C   N C  N  C     R  C C  G+ G+ QV CY           P C  + DCP    C N  C++PC   +  C   A C    H+A+C CP G  G+P   C   I   C  + +C DH AC  + + C+  C   TC  NA C  + H+  C C  GY G+P+  C+      +P C  D +CP+K ACIN  C +PC   +      C+P+           RA+ C C      D    C P         C  + EC N   C N  C+D C    C  NA C AR+H   C C   F G+P  I C    +  P I    C+ + DCP    C NE C +PC     C   A C V      R   C C  G+TG   ERC+    +I  GC+S+T+C  + AC N  C SPC     CG  A+C+V+NH   C C  GF+G+     A  G C  D +C  +K C+N +C NPC+ + PC  NA C    HR  C+CP GL GDP   C R EC ++ DC  + AC S +C+ PC Q   C   AIC    H++ C+CP  L  GNPY  C+    E  CR   DC     C     KC   C+  + C   A C   N        C C    + D    C   + P + P C  DQDC    ACI  +C +P  C TN  C   Q   V          C C           C  +     C V+ +C S   C  G CIN CLI   CG NA+C    + AQC+C  GY GNP   C +           GCS N+DCP+   C+N +C++PC+   PC   A C+  +H +VC CP  F+G+P  +CRPP +P C +D DC    ACI ++C +PC  +  C R AIC+          +C C   +       C       E  GC SD +C  +++C+N  C++PC    CGLNAEC    H+ +C+C QG +G+P   C   EC  + +CP    C+N+ C+  C   +C  NA C A  HR +C CIP   G+   IAC P+                                               P  V  +  C  +R  P         SQ AC+  EC NPC   +PC  NA C V DTLP+RTM C C+EG+TG    +C K    V++ G     +    C P  A        PC  E             A  +  V + R +C C I  G+   P   C P    EC  +  C+DN+ C      C DPC  K  CG +A C   NHR  C+C  G  GNP  +C     +T+   P +   C ++        T+ G   +   + H    EC
Sbjct: 19539 PYYDVAKPDFEFNPCYPSPCGPYSHCHNRFGVAACVCLPNYRGTP------------PNCRPECVINSDCPSSLACINEKCRDPCPGS--CAYNAVCRVHEHVPNCYCQTGYTGNPFISCQ-RTPIA---------------PVQREPIEAKDPCYPSICGPNAVCN----NGKCSCIPEYRGDPY-VGCRP---------ECVLNTDCARDKACIQQKCKNPCPGT--CGLQALCHVYNHV----ATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAP--INPC-QPTPCGPNSQCRAYHEQAICYCLPNFIGTPPG-----CRPECTSNSDCPLDKYCLNLRCRDPCPGA--CGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVE--------RDE--VNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPF-CRP-ECVNSADCPADKAC--RNYKCIDPCP--GSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRP-------------EPSPPAVVILPCNPSPCGVNAFCQPHNDLSV----------CQCLPGYYGNPSEIC-----RPECTVNSDCPSHRACMSEKCRDPC-PGVCGLNALCQVINHSPVCECHTGHVGNPYHSC-RIPQREPPA-----------PEY--------VNPC-QPSPCGANSQCRESQGQAICSCLPEFVGTP-----PSCRPECVISAECPADRACINQKCQDPCPG-ACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPK--------SNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAA-PNC-RPECTINAECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGH--CGLNALCDAVNHIAM----CHCPERMTGNAFVSC---QPIRD---------DPPPPTTPNPC-----QPSPCGANAQCLERNGNAICSCLAGYFGQPPN-CRL----ECYSSSDCSQVHSCINNKCVDPCPGK--CGLNAVCQAIQHRAHCECIPRYTGNAFVQC--------NPIPVPR--VPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTP-PNCRP-ECVSHDECANTLAC--MNQKCRDPCPGS--CGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPC----------------YPSPCGTNAVCRVQGEN----YVCECSQLEYIGNPYEGCRP-----ECVGNSECPANQACIRSKCQDPCP-GVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDAC-VGE-CGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLN-ACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNC---YLLGCRSDGECAANEACVNQQCVDPCGFTQ-CGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCN---CGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACF--GGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPR--DQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAI----CSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYK----------PECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISC---ITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHV-----CTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPR-IECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADD-CGIGAYCHVQQ----RKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCN----CGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIG-CRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLAC--IDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRL-PGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAV----------CSCQDGFEGNPYASCRSI----GCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVI----------GCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPC---NCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGN-ARIACTPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTK-VCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNHTNFRTDFPRPDMVVSCLADGVQVEIHITEPGFNGVLYVKGHSKDEEC 22607          

HSP 16 Score: 1105.89 bits (2859), Expect = 0.000e+0
Identity = 992/3302 (30.04%), Postives = 1415/3302 (42.85%), Query Frame = 0
Query: 3249 PCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPCECARNADCDARNHRGICTCILDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCV--KIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGD-----------------------------PHSTCY---------------------RYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDM----YI-----------------------GSSGQCERVEGTS-----------------ECIVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMV--------------------------------------HVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIK-SFSGDPYTFCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPYECLSDPECPNHLKCKNEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERC---VKIEPV---------------VDVGXRXXS--------ECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCV-----PASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEY-HQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPE-CEKDRDCDSSSICNEGTCVDAC-SLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCT--SVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQAC--YNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFC-------KPYDCLVDNDCLDHLRCTNTKCVDPCA----CAKYAECDARN----HKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQC----VKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETS---TKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTKDDCPFDKTCLAKNCVDPC-KNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDM-IGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQITIQTQA------------------------ECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQLPQKPECTKDSECANHLACIQQKCQDPCA-SPICGINARCRVKRHRAICVCLENYIGDPYSVCK---EAGCRSDYECPSDKACINRECQDPCL-LEQCGENAECLVNN----HEARCKCLSSF--------KGDPYVKCRSYECLVDSDCPRHLACENEKCVDPCKCAKYADCKVTNHQGYCTCNSYYTGDPYGLACEPIPEPIEVECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATN----HRSVCKCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQKCVNPCDTTLC------------------GTNAVCKSEYHQSI-----CHCP--RGLQGSPYVTCKE---IECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVG 6280
            PCG  + C      + C C PN+ G P  +C + EC I+ DCP    C+NEKC DPC  + C   A+C+   H  +C C  G  GNP+I C+    R        E    ++     +C  N  C          +  +C C P + GD Y  C        + EC ++ DC   KACI+  CK+PC     C     C  +  V     +C CP+G    +   C               +   I    + I+ C+   CG N++C +   ++ C CL  + G              P   P CTS+ DCP    C N +C +PC     C   A C V  H  LC CP    G+P   C+  ++P              +++   NPC    CG N++C+  +  A CSC   Y G P      P C +  +CP  +AC N +C +PC   +CG +A C    H  VC C +G+ G+ Y+ C   E    P     L C      +P  C  NA C   N   +C C+  + G+P  I C P         EC  + DCPS  AC++E+C +PC     C  NA C+V +  P+    C C  G  G     C   + EP                       ++PC + +PCG  +QC     +A C+C   F G P S      EC    +CP ++ACIN +C++PC     CG NA C    H P+C C PG  GD                             P+S C                      R EC  N +CP + AC +EKC DPC    CG  A C+V  H  SC CPAG  G+P+ +C+ L                 +  C P     + C + A C    +  +C C   Y GD Y+ C         PEC ++ DC    AC+  KC DPC  +  C     C  +N        C CP  M    ++                       G++ QC    G +                 EC  + DC+    C    C++ C   KCG NA C  I H A C+C   YTGN    CN   V                                         P+  P C  +D+C +   C N+KC DPC     C  +A C V  H   C CP G  G P   C P  + E                  +NPC    CG NA+C+ +    +C C +  + G+PY  C  P C  + EC  NQACI  +CQ+PC    CGL A C  N H  ICSC  G+ G+ ++ C                        P  C  N+ C  +N + +C C+P F G+P    C P         EC    DC    ACIN +C + C+    C   A C+  +  P+    C+C     G    +C    + EP+               V  G    S        +CS + A   Q C +PC+N   CG  A C+  NH++ C C   F G PY+ C+     P    EC  DGDC++++ CIN  C +PC++ + C   A C  + HRP+C C +G  GN    CY   C+++ +C  ++ C +++CVDPC  TQCG  A+CR ++ H++ C C  G +GNP V C+  +CR D +C  +  C  +N +C   C    NC   A C   NH+  C C +  SG+    C +  P  P+  C  D +C   LAC    C+NPC +  PC  +  C+ +DTLP RT+ C C  G     +  C +   R + C     C  +  C  G CV+ C   S C  +A+C    H +ICSC     G+P   CY P     P +  GC++  +C   T+C N+ C DPC E  PCA  A CRV N + +C CP G+ G P+  C    KPEC+ + +CP    C+ + C +PCT   V CG  A C  QNH+AVC C  G  G+P+  C    C+ + +C + +AC   N+ C+  C  + C  NA C    H+  C C  G++G+P+  C       KP  C+ D DC   L C N +C DPCA    C     C   +        C C  D   D     C PI  P KV   C  + +C + EVC +  C + C   + C  NA+C   D        C C +G+ G    +C    V +  I   GC  N +C  +  C    C++PC     CG  A C+VQ  +  C C PGYTG+P   C   S      C S  DC ++E CI  QC  PC     CG NA C+ + H P+C C  G +G+    C    C + D+C  DK C+ + C++PC  +  C + A C   +H+  C C  GL+G+P++ C  +EC  + DC  +  C  N  +C+  C Q N CA NA C+++ H+  CRCP  + +G+ Y++C+ +        C+ D DCP K ACI+++C++PC + +PC  + +C +  L+ + ++T                           C ++ DC   + C+   C + C    CG  A C    H A C+C  G+ GNP + C            IGC  D +C    AC N  CINPC ++ PC   A C V +++  C C  GY G+    C++     C+ +++C     C  ++C +PC     C   A CR + H A+C C  +++G+PY  C+   +  C+ D +CP  +ACIN +C DPC+ LE C   A C V          C C   +        K  P +K     C+ DSDCP   +C N  C DPC C   A+C++ +H+  CTC   + G+P    C       ++EC ++ DCP    C  Q C   C     C +NA+C   +        C C+ G+ G     CT +      GC+++ +   + AC+  +C  PC     C+    C+V +H   C+CP GT    N          C  D+DC + ++C+  +C +PC    PCG NA C   +       +C+C +G  GNP  QC        E   F +   GQ CV P  T L                     + VC  E    I     C CP   G + +P   C+     EC S+  C     CNL+   C   C   K+C VNA C   NH+  CQC+  Y G+    C         P+  +       +SC+ D  Q    + +P   G
Sbjct: 19557 PCGPYSHCHNRFGVAACVCLPNYRGTP-PNC-RPECVINSDCPSSLACINEKCRDPCPGS-CAYNAVCRVHEHVPNCYCQTGYTGNPFISCQ----RTPIAPVQREPIEAKDPCYPSICGPNAVC----------NNGKCSCIPEYRGDPYVGC--------RPECVLNTDCARDKACIQQKCKNPCPGT--CGLQALCHVYNHV----ATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTP------------PGCRPECTSNSDCPLDKYCLNLRCRDPCPGA--CGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPP-------------VERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPFC--RPECVNSADCPADKACRNYKCIDPCPG-SCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPE--PSPPAVVILPC------NPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEI-CRP---------ECTVNSDCPSHRACMSEKCRDPCPGV--CGLNALCQVINHSPV----CECHTGHVGNPYHSCRIPQREP------------------PAPEYVNPC-QPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRP---ECVISAECPADRACINQKCQDPCP--GACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGA-CGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLP--------PPPPPKTPSDPCQP-----SPCGANALC----NNGQCSCLPEYHGDPYTGC--------RPECVLNSDCPRNRACVNQKCVDPCPGH--CGLNALCDAVN----HIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCP-GKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCPGS--CGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDE-----------PKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCR-PECVGNSECPANQACIRSKCQDPCPG-VCGLEAICTMNNHIPICSCPPGYTGNAFAQCTR----------QVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRP---------ECTLSSDCAKDRACINSKCVDACVGE--CGFGAVCQTINHSPV----CSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNA--CGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLAC--RNERCEDPC----NCGIGAQCRVENHRAQCRCPAGFSGNPAVRC-DLVPTQPEG-CTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEP-----PEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQC---YKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKP-QCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTD-ISRNCVPITVP-KVISGCQHNSECANTEVCSNGNCLDACRLER-CGVNAQCTARD----HYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADD-CGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCN----CGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSN--ECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVE---PVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSV--LNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCN---CGTNAVCQVTQHRAVCSCQDGFEGNPYASCR----------SIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIG---CSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIK-EVGGCISDSDCPTDKSCLNSVCRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPE-FECS------KIECSINSDCPGTHVCRNQLCIPACQGEQ-CGSNAQCLAIE----HRAVCECIPGHGGNARIACTPL------GCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKG-FVRDVDGQ-CVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLT-KVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNHTNFRTDFPRPDM------VVSCLADGVQVEIHITEPGFNG 22594          

HSP 17 Score: 1087.4 bits (2811), Expect = 0.000e+0
Identity = 1066/3434 (31.04%), Postives = 1436/3434 (41.82%), Query Frame = 0
Query: 1117 PTSEPLLTPGCRNDDDCPTYSLC---KNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRPHPECPDRLKCENEKC---VDPC---ECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERC-------IKIEPVVD-------------------------------VGCRS----NSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADNKCS-NPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYVACKEVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINPCAESSPCASSARCKVINHEPECTCPDGFIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCENEKCVDPCE---CARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQP-------------------------VVDVG-------------------CRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKIS------------------------------------------NSECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSFECKKNEDCPFDKECKSESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPD-GFIGSPSTNCQPPERPECRVDAECPLDRACIHQKCQNPCSRL----------------------------------------------TCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXENHRAICHCLSGHKGQAYVNCKR--------------------------------YECLRDSDCPNHLHCVNDKCVDPC--ECARNADCKARNHRGYCTCIPNFTGDPYGIVCEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVR-SHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYC-----YKYECKTDNDCPFDKACAKEKCIDPCKDTF-CGTRAEC----VTEFHQSTCKCSQGLQGNPYVSC-----REVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPE--CRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTCRKTCSINS--CGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTC--RNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCR-PINV--PECLLDAECPDHLACINRKCQNPCST-LTCGDNAQCRV----QRHRAICTCLSGYIG--SPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAP-------IQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYK------YECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGS-NGICQEVETKVECEYNDDCSTNDICQDGSCIDACRV-NKCGANTRC----ISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCS-SITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFEN-CGINAECSPENHRAVCACLKGHKGDPYSFCKPYE---CLSDPECPNHLKCENEKCVDPC----ECARNADCDARN----HRGICTCILDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPH---STCYRYECKTNEDCPFDKACASEKCIDPCQTTL-CGSKAICNVE----YHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDM--YIGSSGQCERVEGTSECIVNEDCTSTDVCY--EGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCN 4252
            P   P LTPG  N    P+YS        + +    E  P  P    Q + H+     P    G       P P  P R   +  K     +PC    C   + C  R     C C+P++ G P    C P         EC  + DCPS  ACINE+C +PC     C  NA C+V++ +P     C C  G+TG     C       ++ EP+                                 VGCR     N++C R+ AC   KC NPC     C   A+C   NH  TC C  G  GD +  C P  + +        +       +   NPC+  + CG N+ C   +   +C CL NF G P     + EC  N DCP DK C +  C DPC    CG  A C V+ H  +C CP  L G+P +AC+ +         +DE    Q           + C  N+ C+A+    RC C   Y G           P  + EC    DCP+  +C +  C +PC  +  C  S  C+V    P     C CP     N +  C R E +                    I  C   PCGVNA C      SVC C  G+ GNP  IC            P C  N DCPSH AC   KC +PC     C  +A C+VINH P C C  G +G         +PY  CR  +   +P  P++        V+PC+   C  N+ C     + IC+C+P+F G P   +C P         EC    +CP+  ACIN++C +PC     C  NA+C V +  PL    C+C  GFTG    RC+ + P                         VV+ G                   C  N+EC   LAC N +C +PC     C   A+C V+NH   C C  GYTGDP++ C  +                                             EC  ++DC  N AC+N +CVD C  +  CG +A C+ + H ++C CP+ + G+  VSC           P   +    +  +PC  + CG  A C       IC C +GY G P  +CR ++C  +SDC     C     KC   C     C  +AVC+A  HR  C C     G+ +  CN P+     PE + D                PC   SPC P+  C    + +     C CL+  Q GT   C     + EC   ++C     C    C + C    CG +A+C  + H   C C  G  GDP   C   P              RD P         C       SPC   A+C+V     VC C    +IG+P   C    RPEC  ++ECP ++ACI  KCQ+PC  +                                               CG N+ C++ N +A+C CL G+ G+P +      C    +C   +ACIN +C + C+ E CG    C+  NH  +C C +   G  +V C+                                  EC+ + DC     CV+ KC DPC   C  NA C+A NH+  C+C P F G PY      +PEP   + EC  D DC +  ACIN+ C NPC     C   A C V    PL    C C EG+TG   + C  +      GCRSD EC     C +  C++PC     C T A C    +H+A C C  GY G+P   C++    EC  D++C    AC   +C +PC+    CG GA C   NHR+ C+CP GFSG+P   C         C  D +CP   AC   +C +PC  T  CG  A C            C C  G  G   + C     R+  C + + C   E C  R   C   C D + CA +A+C A  H+  C CP +  GD +  C E    P E +  C  D +C    ACI+ RCQ+PC    PC  N  C+VQN+ P+    C CP+G       +C       EC++N DC   + C++  C   C+     CG  A C    H   C C  G  G+P  +C          +   C  ++DC  +  C   NR C   C   + CA +AIC    H+  C C  G+ G P   C  P+    P+C+ DA+CP  LACIN +C +PC+T   C     C V     +    C C    +   S + V    P V  GC+ NSEC+ T  C NG C++ C     CG +AQC  + H A C CP G+ G+P   C         I +  C  + DC  ++ C N  CI PC  +  CG  A C     ++ C+CPP + G+P   C          C+ S DCP ++ C+N +C  PC+   CG  A C  + H   C C  G  GN    C  + CR D +C+ +++C   N  C+  C  ++ CA  A C   NHR  C CP   EGD +  C        +LEC  D DC    AC+ + C  PC   NPC++N  C+A      R V C CP    +G+    C+    +  C  + DC +   C D  C D C V + C    +C            C C +    +A  AC   + P     +PGC SDQDCP   AC + QC NPC     C   A C+V QH+A+C+C DGF G+P   C+      C  D EC    ACI   C NPC  +  CG NA+C VQ++RA C C  GY G+PY  C   GC S+ +CP  + C N +C NPC++ N C   AEC  +NH AVC C     G+PY  C+P     C  D +CP    C NE+CVDPC     C R A C+          +C C   +     G  C+P P  + E   C  D DCP+  +C+N  C +PC     C  NAEC++ D  P+    CTC +GF G  +  C KIE      C  N++C  +  C N  CI  C +   CG+ AQC    HRA C C  G  G+        G C  D +CP +KAC+N +C +PC     C  + +C    HRP C CPPG     +   S  +   C ++ DCP  KAC   +C++PC  T  CG  A C+V          C+C  G  GNP + C +                        LC        K      + Q  C CP     D Y +C+   E   E   R+D+    V A  R    D                      +   C CP D+   +   G+C+  E   EC  N+ C     C     +C + CL K CG NA C+ + H AQC+C  GYTGNP+  CN
Sbjct: 19463 PQPVPSLTPGVINLPSEPSYSAPIPKPGIINVPSIPEPIPSIPQNPVQEVYHD--TQKPQAIPGVVNVPSAPQPT-PGRPYYDVAKPDFEFNPCYPSPCGPYSHCHNRFGVAACVCLPNYRGTPPN--CRP---------ECVINSDCPSSLACINEKCRDPCPGS--CAYNAVCRVHEHVP----NCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSICGPNAVCNNGKCSCIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPCPGT--CGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQP-TPCGPNSQCRAYHEQAICYCLPNFIGTPPGC--RPECTSNSDCPLDKYCLNLRCRDPCPG-ACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVE---RDEVNPCQ----------PSPCGPNSECQATSGGARCSCLPQYHG---------TPPFCRPECVNSADCPADKACRNYKCIDPCPGS--CGFSALCRVVAHSP----VCYCPEGYVGNAYTLCSRPEPSPP---------------AVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEIC-----------RPECTVNSDCPSHRACMSEKCRDPCPGV--CGLNALCQVINHSPVCECHTGHVG---------NPYHSCRIPQ--REPPAPEY--------VNPCQPSPCGANSQCRESQGQAICSCLPEFVGTP--PSCRP---------ECVISAECPADRACINQKCQDPCPGA--CGLNAQCHVRNHSPL----CSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPC--PGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGH--CGLNALCDAVNHIAMCHCPERMTGNAFVSCQ----------PIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQP-PNCR-LECYSSSDCSQVHSC--INNKCVDPCP--GKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCN-PIPVPRVPEPVRD----------------PC-QPSPCGPNSQC----TNVNGQAECRCLQEFQ-GTPPNC-----RPECVSHDECANTLACMNQKCRDPC-PGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKP--------------RDEPKPPPTPKNPCY-----PSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGC----RPECVGNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGE-CGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPE-PKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPL----CVCNEGYTGNALQNCYLL------GCRSDGECAANEACVNQQCVDPCGFTQ-CGTGAICRADFNHRARCHCLDGYRGNPLVRCER---PECRSDDECAFHLACRNERCEDPCN----CGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEAC--RGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYE----PPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPI----CFCPAGWGGDPQVQC----YKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISC----------ITGHCQYNEDCADHEACDRLNRVCRPVCDQET-CALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLER-CGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADD-CGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCN---CGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQC--VNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRC-------LRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQH---RAV-CRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPR----LPGCESDQDCPDQEACIHAQCRNPCN----CGTNAVCQVTQHRAVCSCQDGFEGNPYASCRS---IGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKG-GCKPTPG-IKEVGGCISDSDCPTDKSCLNSVCRDPCN----CGLNAECRIKDHKPV----CTCRQGFEGNPEFECSKIE------CSINSDCPGTHVCRNQLCIPAC-QGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLG-CRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRS----------------------LCV-----IEKGFVRDVDGQ--CVCPPGTALDIYEYCTPCRE---EQGFRIDESGHCVCALERGMVID----------------------ERGRCTCPIDLGYRLTPRGECQPEE-PPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCN 22559          

HSP 18 Score: 1056.2 bits (2730), Expect = 0.000e+0
Identity = 999/3301 (30.26%), Postives = 1387/3301 (42.02%), Query Frame = 0
Query: 2888 EPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTCRKTCSINSCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLACI-NRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVEC-EYNDDCSTNDICQDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSP--------------TNDCKKPIVP---------------------------------ECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACE---------------------------------------------EPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKP------------------------------------------------YECLSDPECPNHLKCENEKCVDPC--ECARNADCDARNHRGICTCILDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDP-----------------------------NSLHAHQGE----------------------CNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCYRYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFC-----SLPIEPAIE--------------------PECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERV----EGTSECIVNEDCTSTDVCYEGSCINACLIKK-CGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKV-VHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFC-----EEPGCKSDFECRDNQACINRECQNPC-LFEKCGLNAECNANG----HRAICSCLQGHKGDPYSFC-----KPYECLSDPECPNHLKCKNEKCVDPC----ECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCIN-ENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCIN-NQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYC------YKYECKTNQDCPLDKVCTSEKCVDPCDTT-----QCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQ-------CRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKR---PLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVES--RPECEKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVT-CGLNAVCRVQNHRAVCSCLGGY-VGDPYKFCD----EPGCKSDFECPNSQACYNKNCQDPC-LFDECGQNAKCFANNH---RSM-CVCNEGHKGDPYTFCKPY------DCLVDNDCLDHLRCTNTKCVDPCACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPV----CKCPNGLAGDPHSYCYKYE-------CVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAEL--------SQITIQTQAE-------CTTNNDCRXTDVCLSGTCIDACKVF-PCGAYADC-VPNFHEAR---CACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSD----CPRYTACTNKKCINPCAVDKPC----ASTAICK-----VINHKPFCSCRD--GYIGSSETSCQLPQKPECTKDSECANHLAC--IQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSD-KACINRECQDPCLLEQCGENAECLVNNH--EARCKCLSSFKGD 5850
             PEC ++ DCPS +ACI+ +C++PC  +  C  N +C+V  + P    +C C +G   +    C+   ++         Q+  I      +  C  + CG NAVC    +  KC+C   Y GDP   C            P C  + DC     C  ++C NPC     C   A+C   NH A C+C +G  G     C P   P+    A      A +  R   NPC    CG N+QCR    +AIC CL  +IG+P       P     C SNS+C     C N  C +PC     CG  A C V+ H   C+CP    G+P   C PI     + D              ++PC  + PCG N+EC  T+  + C C P + G P     + EC  S DCP DK C N KC+DPC  + CG  A+C+   H   C CP G  GN Y  C   E                    + L  + + C   A C+  N    C C P + G+    C        + EC ++ DC   +AC+   C+DPC  +  C  N  C+     P+    C C  G        C+  + +    EY               ++ C+ + CGAN++C  S  ++ C CL  + G              PS  P C    +CP+  AC N++C +PC     C   A C V  H  LC+C  GF G                +ND + P VP                                 EC  + ECP +LACI +KC++PC    CG  AQC V NH   CSC  GY GDP+T+C                                               P C  + +CP  +AC+N++C +PC   +CG+NA C   NH A+C C +   G+ +  C+P                                                 EC S  +C     C N KCVDPC  +C  NA C A  HR  C CI  +TG+ + + C PIP P + E         P ++ C             PC  N++C   +        C C++ F G          P     C S+ ECA +LAC N  C  PC  +  CG  AQC+V  H   C CPVG TGDP                             N++   QGE                      C  +++CP N+ACI ++C++PC     CG  AIC    H P+C CPPG  G+  + C R                     DPC  + CG  +IC ++  ++ C+C  G  GNP       EC    DC  +  C     KC   C G  +C   A C+  NH   C CP+N +G+ +  C     + PI+P                       PEC +++DC    AC+  KC DPC   N C     C+ +N   +    C CP + Y     QC R     E   ECI + DCT+   C    C N C     C   A+C   LH   C C EGYTGN    C +           GC  + +C +   C N++C+DPC   + C   AIC+   +H + C C DG+ G+P   C   ++PEC  D +C    AC  ++C++PC+   CG  A C+  NHRA C C   FSG+P   C     +  GC  D EC    AC   EC+NPC +   CG NA C           +CSCL G+ G+    C     +   C S  +C +   C+   CV+PC     CAR+A C A+ HR IC+C     GDP+    EP   P I+   C  D +C    ACIN+ C +PC    PC  NAEC+V ++ P+    C C  G+ G    +C K E       +  ++C  +     +NCV+PC + +  CG  A+C   NH++ C C  G  G+P+ SC+      C Y+ DC+D++ C   N+   P  ++ TC  +AIC    H+P C+C  G  GNPH  C       K +C  + DCP    C +E+C DPC T      Q     L         C+CP     +    C  +        C+ + +C + E C+  N  C   C  +  C   A C AR+H   C+C     G+    C+      P +P   C  + DC     C ++IC +PC  +D C     C        R   C CP G T      C          C+   DC S+  C    C   C   NCG NAEC    H  IC C  G +GN +  C  P+         GC +  +C     C NR CI+PC+   PCA  A C   NH++ C CP G  G P   C   ++ EC  D +C  +LAC+  +C +PC     C  NA+C+   HRAVC C     +G+PY +C+    EP C+ D +CP+  AC +  CQDPC +   C   A+C   N    R+M C C E    D    C+         C  D DC D   C + +C +PC C   A C    H+A CSC   F G+PY  +C  I         C  D +C S + C + +C NPC  N PC  NAEC V          C C+ GY G   E+C        IGC SN++C  +  C+  +C+NPC    PC   A+C  QNH   C C   + G+PY  C+      C  D DC   + CI  QC DPC   +PC + A+C      PV    C CP+G        C           C++  DCP DK+CL   C DPC    CG+ A C  + H+ +CTC  G +GNP   C ++EC  N+DC     C   +  CI  C Q   C  NA C ++ H+  C C     G+    C           C+ D +CP  +AC+N +C +PC     C+  + C++             +  +   E       C ++ DC     CL G C++ C    PCG  A C V +    R   C C  GYTGNP  QC +  + V   +E G   D D    CP  TA    +   PC  ++      +   +C      VI+ +  C+C    GY  +    CQ  + PECT + +CA++  C    + C+DPC + +CG+NA C    HRA C C+  Y G+P   C     R+D+  P    +C+    Q    + + G N    V  H  +  C+ + +  G+
Sbjct: 19587 RPECVINSDCPSSLACINEKCRDPCPGS--CAYNAVCRVHEHVP----NCYCQTGYTGNPFISCQRTPIA-------PVQREPI----EAKDPCYPSICGPNAVC----NNGKCSCIPEYRGDPYVGC-----------RPECVLNTDCARDKACIQQKCKNPCP--GTCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTP-------PGCRPECTSNSDCPLDKYCLNLRCRDPCP--GACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDE-------------VNPCQPS-PCGPNSECQATSGGARCSCLPQYHGTPPFC--RPECVNSADCPADKACRNYKCIDPCPGS-CGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPA--------------VVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEIC--------RPECTVNSDCPSHRACMSEKCRDPCPGV--CGLNALCQVINHSPV----CECHTGHVGNPYHSCRIPQREPPAPEY---------------VNPCQPSPCGANSQCRESQGQAICSCLPEFVGTP------------PSCRPECVISAECPADRACINQKCQDPCPGA--CGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPG-ACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPG-HCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAF-VQCNPIPVPRVPE---------PVRDPC----------QPSPCGPNSQCTNVNG----QAECRCLQEFQG--------TPPNCRPECVSHDECANTLACMNQKCRDPCPGS--CGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCP--GVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQ-------------VTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRAC--INSKCVDACVG--ECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCL--NACGINAICRAINHKAV----CSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLL----------GCRSDGECAANEACVNQQCVDPCGFTQ-CGTGAICRADFNHRARCHCLDGYRGNPLVRC---ERPECRSDDECAFHLACRNERCEDPCN---CGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEP---PEIK-TGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPI----CFCPAGWGGDPQVQCYKPE------CKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCI---TGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCS--NGNCLDACRLER-CGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADD-CGIGAYCHVQQ----RKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPC---NCGPNAECTVKNHHPICYCKPGFSGNAQFGC-API---------GCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRC---LRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYA-SCRSI--------GCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNR----AQCRCLSGYRGNPYERC------RVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCN---CGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVC--RNQLCIPAC-QGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTP-------LGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCV---IEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNHTNFRTDFPRPDMVVSCLADGVQVEIHITEPGFNGVLYVKGHSKDEECRRVVNLAGE 22616          

HSP 19 Score: 1039.25 bits (2686), Expect = 0.000e+0
Identity = 960/3207 (29.93%), Postives = 1347/3207 (42.00%), Query Frame = 0
Query: 6329 DMCKDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQ----LPIQ-----------------------------------------PECTRDYECPDNKACIQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACL----NRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPC--KCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPV-------------------------------LVEY---------ECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNFECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKE----VECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTDRDCPDSDVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYF---------------PVP--------------------QPEPSITPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQL--------------SPKP-------------------------------ECIVDQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGDPYTFCRPYECLVDRDCPDQLKCDHEKCVDPC--QCAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVVE-------------------------------------------EGCE----SDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCE-------------------------------------LITEPVVVG----CTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLC------VPVED-----------------------KECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHSY--------ECLSNKDCPLDKSCQNKICVNPCSKT-ICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLDCHNDNDCKDDEKCDRKT----------------------------YTCYK----------VCNSNDECA-----------------IGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPE-CQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQ-CYDSSDCRSSEVCHTGTCITACL-VFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVN-DPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCELPSEPECLVDDDCPSDLACIHQSCKTPCSTST--CGINAKCNVKSHRAICVCIAGYDGDPYQICEEPGCKSDIECPFDKAC--ISRECQNPCLYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHC-------KPYECLYDPDCPDHLTCKNEKCVDPCQ----CAKYAEC---DARNHRGI------------------FPEPVEVEGCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVV------GCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIED---HECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEYECLRDNDCPLNKACVSQKCTDPCLTTD-CGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPL-LGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLVVDSSPSKSVSCSCREGFYVGKNGDCIEV--DGQPECRSHSDCRYNEQCQSGSCLDACRIRLCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECKPPTPLSIGCSADSDCPVVEACLNTKCVDPC----NCGENALCRKINHKAVCFCPSGFSGNPEVLCE---KLECTSDEDCSNDKMCHENTCANPCILLNPCAING--ECIPSNHVSK--CRCPSDMNGDPYSLCVDVE-------CAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCN----CGGGAKCFLSGHRPICQCPEGFIGNP---QIECNPAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPN----LHNAQCECDEGFEGDPYTGCS-----II--GCKSDSE----CPNKKACRNRDCIDPCLKDNPCAV---------FANCVSRDHFAQCRCKV--GYQGDPYESCTVIPPPECVEDGDCTTGMAC--INEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYV 9071
            D+ K     N C    CG  S C   F  A C C   Y G P             +  P C  + DCP   AC N KC +PC     CA  A C+V  H   C C  GY G+P   CQ     P+Q                                         PEC  + +C  +KACIQQ+C NPC    CG  A C V  H A CSC  G  GD +  C+                      R   NPC    CG N+ C   + + IC C+    G P   C+P EC  +SDCP +  C N +C DPC   C   A C ++NH   C C    TG+P  ++C PI  P                                L +Y         EC+   DCP+++AC + +CI+PC     C   A C+V    P+    C C EGY G     C + +P                A V    + PC N SPCG  + CQ  N  SVC+C  GY G+P   C P    EC  + +C S++AC++ +C DPC    +CG NA+C+  NH  +C C  G  G+P+ SC   +          ++  + + ++PC  + CG  ++C      ++C C     G P     E     EC  D  C+N         KC   C    +C  +A C    H+ +C+C   F GD  + C+ +                      S   ++PC + +PC    +C V +       SC C  N Y+ A  +C       EC  + +CP +  C +  C D C   +CG  + C    H   CSC AGYTGDP+T+C                 P P                     P     P C  + DCP   +C N+ C++PC     C +NA C  +NH  +C CP    G+    CQ                P P                               EC    DC    +CI  KC  PC    CG+NA+C+A  HRA C C+  Y G+ +  C                 + +   DPC    CG N+QC   N +A C+C +  +G P   CRP EC+   +C + L C ++KC DPC   C + A C    H   C C    TGDP+ I    +P+P  E                                           EGC      +++C + QACI  +CQ+PC     C   A C + + +P+    C+C  GY+G    +C                                          P+  G    CT   +C+   AC N  CV+ C+ E  C   A C   NH   C+CP    G+P+  C       P++                         EC  +++CSR ++C+  +C   C   N C  NA+C   NH+ +C CPP   G P+  C           EC+S+ DC  DK+C N++C NPC ++ IC   A C V+ H+ +C C  GY G+   +C LL C +D +C  +E C  +                                Y+           C S+DECA                 IGA+C   +H  +C C     G+    C   P   +PE C +D++C + LAC    C+NPC +  PC  N  C V +T+P++++ C C  G+    D  C K  P+ Q C     C+ +E C  G C+  CL    C  +A C +  H   C C     GDP   C        P +  GCT D++C    AC N+ C DPC   +PC  NA+CRV    P+C C  G+ G PQ  C    +PEC ++ DCP D  C++++C  PC+     CG  A+C  ++H+A+C+C  G  G+P+  C    C+ + +C   +AC  ++R C+  C  + C +NA C+ + H+  C+C+ G++GNP+V C       KP +C+ D DCP  L C NE+C DPC     C     C   D    R +                     P  + GCQ + +C + E C +  C + C   R C  NA+C   +        C+C +G+  +G+ + E  T  + V      GCS + DC     CRN  C++PCA D  C   A C V + K+ C CPPG TG+P   C+   D     C+  +DC  N+AC+  +C  PC     CG NA C   +H P+C C+ G +G+    C    C  D++C  +K CV+++C +PCL +D C + A+C    HR  C C  GL+G PF+ C  +EC  + DC +N  C  N  +C   C   NPCA+ A C A  H+  C C   L LGN +  C    +  EP CR D DCPSK ACI+ KCQ+PCS  +PC P+  C V++S P +++ C C E      +G C ++     P C S  DC   E C    C + C    CG NA+C    H + C+C+  F GNP  +C  I          GCR D EC +   C N  C++PC++NDPCG +A C V  +   CRC  G+ G+P   C+      IGCS+++DCP  + C N +CV+PC     C   A CR  NH AVC CP  F GNP V C    +  C  D DC   + C    C +PC++L PC      E  P++ V    C CP          C           C  + DC ++++C    C DPC     C  NA C+   H   C C     GNP   C          + EC ++SDCP    C N  C   C     C ++A C  ++       VC C  G       +C P+      GC  DDECP+++ACVN  C +PC     C     C +  HRP C CP G +      + E +   C SD +C S +AC+   CVNPC    PCGV+A C+      +    CEC EG+ G+P   C      +I  G   D +    CP   A    +   PC ++    +             +  D   +C C +  GY+  P   C    PPEC  +  C     C    + C++PC + K C   A C+ +         C+C  GY 
Sbjct: 19542 DVAKPDFEFNPCYPSPCGPYSHCHNRFGVAACVCLPNYRGTP------------PNCRPECVINSDCPSSLACINEKCRDPCPGS--CAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSICGPNAVCNNGKCSCIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPCPG-TCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTPPG-CRP-ECTSNSDCPLDKYCLNLRCRDPCPGACGIRAICHVQNHGPLCVCPPHLTGNPL-LACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPFCRPECVNSADCPADKACRNYKCIDPCPGS--CGFSALCRVVAHSPV----CYCPEGYVGNAYTLCSRPEP-------------SPPAVV----ILPC-NPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRP----ECTVNSDCPSHRACMSEKCRDPC--PGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIPQ----------REPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQ--------KCQDPC--PGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVP---------------PPQPPKSNDIRDPC-VPSPCGPYSQCRVVNG----GASCSCLPN-YVGAAPNCRP-----ECTINAECPSNLACINEKCRDPC-PGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGH--CGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGK-CGLNAVCQAIQHRAHCECIPRYTGNAFVQCNP----------IPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPN-CRP-ECVSHDECANTLACMNQKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRIC---LPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCPGV--CGLEAICTMNNHIPI----CSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGE--CGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPC--LNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVP--TQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEP-----PEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCY---KPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKP-QCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLER-CGVNAQCTARD----HYAQCNCPKGF--QGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADD-CGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCN----CGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSN--ECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEP--RPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCN---CGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSI----------GCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCR-----VIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCN----CGLNAECRIKDHKPVCTCRQGFEGNPEFEC---------SKIECSINSDCPGTHVCRNQLCIPACQGEQ-CGSNAQCLAIE----HRAVCECIPGHGGNARIACTPL------GCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPC-LTKVCGVNAFCNAVNHR----AQCQCITGYT 22551          

HSP 20 Score: 1020.38 bits (2637), Expect = 0.000e+0
Identity = 958/3198 (29.96%), Postives = 1328/3198 (41.53%), Query Frame = 0
Query:  108 PCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVGGTCLNSCRVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRP--------------QP-------------------------------EPECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPYSYCNAYECLSDPECPDHLHCISEKCVDPCK--CAANAECDARNHRGYCACIIDFTGDPYGIECTPIPEPVIEEV---------------------------------------ECVEDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCV--------KIEPIID----------------------------VG--------CRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQIS------------------------------------------QGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSC-----------------------------------------FKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICP-----------------------------------TDTVVGIDG-----RCNRVQT--------SPECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHEC--------------------------------------YFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTV------------CRPHP-------------------------ECPDRLKCENEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQ-NHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYE-----CQKNEDCPFDKSCSSNNCIDPCQNT-VCGRNAECSV----EYHKSICKCPSGLQGSPYVAC-----KEVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVE-TATECQSNNDCPDTDVCDRGTCINACKSRP--CGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAAC-KDRKCINPCAESSPCASSARCKVINHEPECTCPDGFIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCENEKCVDPCE----CARNADC---DARNHRGI-CTCIPDFTGDPYGIACEPIPEPVIEEVECKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERC----VKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKISN---SECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSFECKKNEDCPFDKECKSESCVDPCIDTQ-CGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPL-IGDGYSFCN-RPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGT----------------------------------------QVGTNGQCITVQSQNECS-------------------IDNDCNQDDMCYEGTCVNACYV-ERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNCQPPERPECRVDAECPLDRACIHQKCQNPCSRL-TCGKNADCKVNN----HRAICTCLKGYNGDPYSLCK-------LSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPC---ECARNADCKARNHRGYCTCIPNFTGDPYGIVCEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRS----HKALCSCPVGYAGDPYSFCKK----ILTHECNYDNDCQ-----RTQACIENQCSEPCSLNE----------ICG--KGAICENRNHRSVCKCPRGFSGDPHSYCYKY---ECKTDNDCPFDKACA--KEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRND 2824
            PCG  + C  +     C+C     G P       EC IN+DCP   AC+ EKC DPC  + C  NA C V  H   C C  G  G+P++SC+             A       + ++ C  S +C P+A+C   K    C C P   GD Y  CR        PEC +++DC +  ACI +KC+NPC  T  C L   C V +       +C CP+  +      C                   +      +N C+  PCGPN+QC A   ++ C C   + G P               +P C SN DCP    C N  C +PC     C + A C V NH P+C CP    G+P   C+P              QP                                PEC   +DC    AC   +C+ PC   +CG +A CRV  H  +C C  GYVG+ Y++C  P        P     +      PC    CG NA C P N  + C+C  G+ GNP   C   EC  + +CP H  C+SEKC DPC   C  NA C   NH   C C     G+PY     P  EP   E                                        ECV   +C +  ACI+++C +PC     C  NA C V +  PL    C C  G+TG    RC+        K   I D                            VG        C  + EC  NLAC N+KC +PC     CGF+A+CSV NH   C+C  G+TGD ++ C  +                                           + EC  + DCP N+AC++ +C DPC     CG NA+C A NH A+C CP     ++  +C           P           NPC+ + CG  A+C       IC C  G  G P   C+ +EC    DC     C  I+ KC   C G  KC  +AVC+A  HR  C C P   G+ +  C                                         F+   P+ +PEC   D+C   LACM++KC+DPC  +  C  S +C V    P     C CP                                   T+ V  + G      C++++          PEC   ++C  +  C+   C D C    CG+ AIC   +H   CSCP GYTGN   +C                                      +F +P ++    P C    DC     C N+ C++ C  +  C   A CQ INH+PVC+CP   +G+P               C+P P                         +C     C ++KC DPC   C  NA C A NH+ +C+C P+F G PY      +PEP   + EC  D DC +  ACIN+ C NPC     C   A C V    PL    C C EG+TG   + C  +      GCRS+ EC  N AC N +C++PC     C + AICR   NH+  C C  G+ G+P   C      EC+ D++C  ++ C + +C +PC     CG  A C V NH   C+C   F+G+P   C         C  + +CP   +C    C +PC  T  CG NA C V         +C C  G  G   + C     ++  C   + C   E C  +   C   C +++ CA +A+C A +HR  C C     GD ++ C +   P  K+ C  D +C    +CI++ CQ+PC+  NPC+ + EC+V ++ P     C CP      G+G   +V+    EC+ N DCP    C    C++ C      CG  A+C A+ H +VC C  G +GNP   C              C  N+DC  H AC +  +   P  +   CA +A C    H+P+C C  G+ G+P   C    P    +P +C+ D +CP  L C NE+C DPC     C     C   D    R + C C  D   D     C PI  P +    C+ + +C +   C N  C + C + + C  NA+C   D        C C +GF G     C    V +  + + GC  N +C     CRN  C++PC  +D C   A C V    A C C  GYTG+P  +C+  S+     CK  TDC SNEACIN QC   C     CG +AEC    H  +C C  G +G+    C    C+ +++C  DK+C +  C++PC+ +  C   A C    H+  C+C  G +G+P++ C  ++C  + DC S   C   + +C   C + N CA++A+C+A  HR  C CP  L +G+ Y++C  RPV+P     C  D D     ACI D C++PC V SPCHP+  C VL S  ++T+ CEC E                                            GTN  C   Q +  CS                   +D +C+    C  G C+N C + + CG NAEC    +R++C C  GY G+P   C             GC  + DCP+   C+N  C+NPC   +PCA  A C+   H  VC CP  F+G+P  +C+PP +P C++D +CP  +ACI+++C +PC  L  C + A C+V         +C C  GY       CK       + GC SD +CP  ++C+N  C++PC    CG   EC+ ++H+ +C C  G +G     C + EC  +SDCP    C N  C+  C   +C  NA C A  HR  C CIP   G+   I C P+         C  D +CP+  AC+N +C++PC     C  +  CKVY   P        + G  G   ER + I       C SD++C  +  C  G+C+NPC    PC  +A CSVR        +C C  GY G+P   C K    ++      D D Q      T   I   C+ PC   +          +C   +G + + R  R  C    G+   P   C      EC +++ C  ++ C    + C DPC    CG  A C    H++ C+C  G  GNP + C     R D
Sbjct: 19557 PCGPYSHCHNRFGVAACVCLPNYRGTPPNC--RPECVINSDCPSSLACINEKCRDPCPGS-CAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPI---------APVQREPIEAKDPCYPS-ICGPNAVCNNGK----CSCIPEYRGDPYVGCR--------PECVLNTDCARDKACIQQKCKNPCPGT--CGLQALCHVYN----HVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTPPG------------CRPECTSNSDCPLDKYCLNLRCRDPCPGA--CGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPFCRPECVNSADCPADKACRNYKCIDPCP-GSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPE-------PSPPAVVIL----PCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRP-ECTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPCP--GACGLNAQCHVRNHSPL----CSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCP--GACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPG--HCGLNALCDAVNHIAMCHCPERMTGNAFVSCQ----------PIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQP-PNCR-LECYSSSDCSQVHSC--INNKCVDPCPG--KCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCPGS--CGQSAQCTVSLHIPN----CQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCP-GVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQ-GCRPECTLSSDCAKDRACINSKCVDACVGE--CGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPE-PKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPL----CVCNEGYTGNALQNCYLL------GCRSDGECAANEACVNQQCVDPCGFTQ-CGTGAICRADFNHRARCHCLDGYRGNPLVRC---ERPECRSDDECAFHLACRNERCEDPCN----CGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEAC--RGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYE--PPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRP----ICFCP-----AGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITG----------HCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQC--DIPVKTPKP-QCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTD-ISRNCVPITVPKVIS-GCQHNSECANTEVCSNGNCLDACRLER-CGVNAQCTARD----HYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADD-CGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCN----CGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLAC--VSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPV----CRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVI----------GCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPC---NCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGN-ARIACTPL--------GCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPI-------CISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCT-PCREEQGFRIDESGHCVCALERGMVIDERG-RCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNHTNFRTD 22566          

HSP 21 Score: 969.918 bits (2506), Expect = 0.000e+0
Identity = 897/2936 (30.55%), Postives = 1234/2936 (42.03%), Query Frame = 0
Query:   18 CQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGDAYSNCSPIN---------------------------------------------EDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCR-------------------------------EKVVSIL----------KPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVGGTCLNSCRVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCR----------------PQP--------------------------EPECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPYSYCNAYECLSDPECPDHLHCISEKCVDPC--KCAANAECDARNHRGYCACIIDFTGDPYGIECTPIPEPVIEEVECVEDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQIS---------------------------QG----------------------ECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEY-----------------------------------------------ECLRNSDCPFDKACVSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKN--------------------------------VECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKR-EVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECEIANDCKISDICVSGSCIDACKVNPCGVNAICKS-ASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRPHP----------ECPDRLKCENEKCVDPCE----CARNADCDARN----HRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADNKCSNPCRSNSL-CGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNN--CIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYVAC------KEVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEA----SRHRERCICSSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATE-----------CQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINPCAESSPCASSARCKVINHEPECTCPDGFIGSPTTDCRP----------------------------------------------------RDPYSFCRPYECLSDPECPDHLKCENEKCVDPC----ECARNADCDARNHRGICTCIPDF-TGDPYGIACEPIP-EPVIEEVECKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKISNSECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSFECKKNEDCPFDKECKSESCVDPCI-DTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCR---EVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCK----AENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNCQPPER--PECRVDAECPLDRACIHQKCQNPCSRLT-CGKNADCKVNN----HRAICTCLKGYNGDP------YSLCKL-SGCESDFE----CPNHQACINRECQNPCLFEKCGXXXECKX------------ENHRAICHCLSGHKGQAYVNCKRY---ECLRDSDCPNHLHCVND--KCVDPC---ECARNADCKARNHRGYCTCIPNFTGDP 2547
            C S+ +C  ++ C N  C +PC  +  CG+ A C V+NH   CVC    TG+    C PI                                                EC   +DCP + AC  ++CIDPC  +  CG  A+CR  +H PVC CPEG  G+ +  C   E       P   A V    + PC  + CG NA C      ++C+C  G  G+P   C+  EC  N DCP +  C   + KC + C   GVC  +A+C+   H   C C     G+ Y  CR                               + + S L          +PEC + ++CP   ACI++KCQ+PC     C L  +C V +  P     C C           C  +      ++N+    +D CV           PCGP +QC   +  ++CSC   Y G             A   +P C  N +CP+  +C N  C +PC     C   A C VINH P C+CP GY G P T CR                P P                           PEC L+SDC  + AC+ Q+C+ PC  + CG+NA C   NH A+C C     G+ +  C+          P           NPC    CG NA+C  RN  A C C  G+ G P +     EC S  +C     CI+ KCVDPC  KC  NA C A  HR +C CI  +TG+ + ++C PIP P +                   E   +PC   SPC  N+ C   +        C C++ + G          P     C S  EC + LAC NQKC +PC    +CG SA+C+V  H   C C VG TGD +  C+                              QG                      EC  + +CP N+ACI ++C DPC    +CG  AICT  NH  +C CPPG+  ++ + C                                                  EC  +SDC  D+AC++ KC++ C    CG  A C    H P+C CP  + G+P+++C+                                  EC  +EDC     C  +S KC   C   N C  +A+C A NH+  C CPP   G  Y+ C ++   P  KPEC  D DC    AC+++ C++PC  +  C+    C V    P     C+C           C  +     C    +C  ++ CV+  C+D C    CG  AIC++  +H +RC C +GY GNP   C            P CR+DD+C  +  C+N  C +PC     C   A C+V NH   C CP G+ G+P   C   P          ECP +L C   +C +PC+    C  NA C+  +       +C+C+P + G+   I C   P     +  C     C    AC    C NPCL   PC ++A+C            C+C E   G     C +  P +  GC  +SEC    AC N +C +PC   NPC+ +A CR QN +P C C  G+ GDP   C    + ECK + DCP +  C +  C +PC    + CGN A C   NH  VC C     G+P  SC    CQ NEDC   ++C   N  C   C    C  NA C    H+  C+C  G QG+P+V C       + QC +D DC     C  +R  C   C+  +VC     C       +    C C      D    C  I VP   S C  + +C +   C +  C + C L   C  + +C   D        C CP      GF    R+E  T            C  N+DCP   +C    CI+ C +  CG+ A C  +   ++C C  G+ GNPQ  C L P  V  +   GC S+ DCPS+ AC + +C +PC     C  +A C V NH P C C  GF G+    C P                                                     DP+  C   EC SD +C  +L C + +CV PC     CA+NA C A  HR +C C      G+PY   CEP P EPV     C++D DCPS+ ACI+++C +PC +  PC   A+C V +++P+RTM C C E         C K+ P    GC S+ +C    AC + +C NPC     C   A CQV  H A C CQ G+ G+PY+ C  I    C+ D +C S +ACIN  C++ C++N PCG +AEC    +R+ C+C  G  G+P+  C    C  N DCP DK C++E CV+PC+    C   A C  + H  +C+C   + GNPY+ CR   +  C+ ++DC  ++ C     +C   C     C   A+C+    +      C CP   +  G   C       +   C+ DSD    ++C++  C++PC     C  +  CR+ +   +    C C +G +     +C    S+ ECSI++DC    +C    C+ AC  E+CG NA+C+A  HR+ C C PG+ G+ + AC        PL   GC  D +CP+   C N  C +PC   + CA   +CKV  H+P C CP G +  P  N    ER  P C  DA+CP  +AC+  +C NPC+    CG NA C V +       IC CL+GY G+P       SLC +  G   D +    CP   A    E   PC  E+     E               E  R  C    G++      C+     EC  +  C ++  C  D   C DPC    C  NA C A NHR  C CI  +TG+P
Sbjct: 19818 CTSNSDCPLDKYCLNLRCRDPCPGA--CGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPFCRPECVNSADCPADKACRNYKCIDPCPGS--CGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPE-------PSPPAVV----ILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRP-ECTVNSDCPSHRACM--SEKCRDPC--PGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPCPGA--CGLNAQCHVRNHSPL----CSCQPGFTGDALTRCLPVPPPQPPKSNDI---RDPCVPS---------PCGPYSQCRVVNGGASCSCLPNYVG------------AAPNCRPECTINAECPSNLACINEKCRDPCPGA--CGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGH-CGLNALCDAVNHIAMCHCPERMTGNAFVSCQ----------PIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNC--RLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAF-VQCNPIPVPRVP------------------EPVRDPCQP-SPCGPNSQCTNVNG----QAECRCLQEFQG--------TPPNCRPECVSHDECANTLACMNQKCRDPCP--GSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCPG--VCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGE-CGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRAC--VSQKCRDPC--LNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRP----LCVCNEGYTGNALQNCYLLG----CRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCE----------RPECRSDDECAFHLACRNERCEDPCN----CGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGE-ADIGCHKEPP---RDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQ----HRAICSCPERTQGDPFTNCYE-PPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQC---YKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINER--CADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLER-CGVNAQCTARD----HYAQCNCP-----KGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERC-LPPSDVILV---GCKSSTDCPSNEACINTQCASPCN----CGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAY-CEPRPVEPV-----CRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCN----CGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIG---CRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQAC--INEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCN----CGLNAECRIKDHKPV----CTCRQGFEGNPEFEC----SKIECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIAC-------TPL---GCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTV--PGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITGYTGNP 22554          

HSP 22 Score: 890.182 bits (2299), Expect = 0.000e+0
Identity = 856/2805 (30.52%), Postives = 1174/2805 (41.85%), Query Frame = 0
Query: 7026 EAIKGLVEC----QTDRDCPDSDVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLSP---------------------------------------------KPECIVDQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACI----NKDCLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGDPYTFCRPYECLVDRDCPDQLKCDHEKCVDPC--QCAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPV-VVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHSYECLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLDCHNDNDCKDDEKCDRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCEL---------------PS---------------------------EPECLVDDDCPSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEEPGCKSDIECPFDKACISRECQNPCLYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPC--QCAKYAECDARNHRGIFPEPVEVEGCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSIC------------------------------VIIEDH-------------------ECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGD------------------------PHSFCY-----------------------EYECLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVECRKERD------CKTNEKCDMNTYKC---FPLCDFENPCAEGASCLAQ-------------------NHKEKCVCQPPLLGNGFVLC--SLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLVVDSSPSKSVSCSCREGFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDACRIRLCGINAICVAE-NHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECKPPTPLSIGCSADSDCPVVEACLNTKCVDPCN----CGENALCRKIN----HKAVCFCPSGFSGNPEVLCEK-----LECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLC-----VDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPC-YSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEAC--VNRMCRNPCN---CGGGAKCFLSGHRPICQCPEGFIGNPQIECN------PAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCA-----PNLHNAQCECDEGFEGD------PYTGCSII-GCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTV-------IPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPP---IISGCERNDDCSNSTSCINAICRSPCACGLNADCKIIDHQPVCTCKPGFYGDPEIECTDTVCQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNIVSCSDNSDCPTDKECINKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGF-IGNKGTSC--VKVSVTCEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECFPV-----------KTCPANSG------------------LILDNREECVCPTGF----------------GFTENKDECIPCLKENGFILNNEGKCVCNDARGYE----YNPDSGKCECPPGERLNNFGICERVPDCEEDPDCPTQKYCEKTNGTCSNPCT-RNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIP--PVKTDFPRPEMVVN 9496
            +AI G+V      Q     P  DV       + C  + CG YS C   F  + C C+  Y G P            P+  P C  + DCPS  +C N  C +PC     C  NA C+V  H P C C  GY G+P   CQ +P                                             +PEC+++ DC   KACI  KC++PC    CG+ ALC   NH ATC C  G  GD +  C+                      +  ++PC    CG N+QC   + +A+C C     G P   CRP EC  + DCP    C + +C DPC   C   A C  +NH   C C    TG+P  +AC+PI  P VE                 R+  NPC    PC  N++C+           C+C   Y G         T P     C +  +C    AC N  C++PC     C  +A C V  H   C CP G+ G+ Y+L              CSR +       I  CN  +PC  NA C   N   +C+C PG  G+P   C   EC  N DCP  ++C ++ C +PC   +CG NA C V  H  VC+C  G+ G+PY SC++         + +         C         C   ++C        C+C    +G         P S +PEC I ++C  + AC+N  CQ+PC     C  N QC V N  P+    C C  G +     +C  V   PQ   S+D R             C+   CG  + C+  +   +C CLPN+VG              P+    CTI+ +CPS  AC N  C DPC    C   A+C VI H P C+C  GY G P TSC +               PS                            PEC+++ DCP + AC++Q C  PC    CG+NA C+  +H A+C C     G+ +  C+          P           NPC    CG NA+C+ ++  A+C C  G+ G P  +C+  EC    DC    +C N KCVDPC  +C   A C A  HR          G    +  P     +    ++PC    PC  N++C   N        C C + + G     C          C +  +C+ +LAC N +C +PC     C Q+A+C V+ H  +C CP GMTGDP+ IC                              V  E++                   EC  +S+C  N+AC+  +C DPC     CG  AIC   +H P+C C  G  G+                        P+S C                          EC   +DC  ++AC++ KC D C+  +CG  A C+T  H  +C C   + G+PF++C+E    +  D      C++N  C +        +P C     C+   +C++Q                   NHK  C C P   G+ +  C   LP    +PEC  D DC +  ACIN+ C+NPC + N C P   C V    P     C C EG+      +C  +     CRS  +C  NE C +  C+D C    CG  AIC A+ NH + C C   + GNP V C            P CRSD EC  +  C+N +C DPC     CG  A C+V  H   CRCP GF G+P++ C        GC+ D++CP   AC   +C +PC+    CG NA+C  ++       +C C  G+ G  ++ C K       CTS + C + + C    C NPC+  +PCA + +C+   H + C CP    GDP++ C     +   C  + +C    AC   +C DPC   NPCA NA C+       C C     G+P V C          + EC +++DCP    CLN+ C +PC +    C   A C   +       VC C  G       SCI         C  +++C  +EAC  +NR+CR  C+   C   A C    H+P C+C  G+ GNP ++C+         C  D +C S  AC+   C +PC     C     C      P    A C+C      D      P T   +I GC+ +SEC N + C N +C+D C  +  C V A C +RDH+AQC C  G+QG+P   C         IP P C  + DC     C NE C +PC     C   A CHV +    +   C CP GY     + C  LPP   I+ GC+ + DC ++ +CIN  C SPC CG NA+C + +H P+C CKPGF G+ +  C    C+SD+EC     C N EC   C A + PC   AEC G  H+A C CP GL G+PFV C  + C  + DC ++  C++  C   C   NPC   + C+   H+  C C     +GN    C    V   C  D DCPSK +CI+ +C +PC    PC   A CSV ++VPVRTM C C E    DAS  C  +           + CP                       +  +R  C C  GF                G  ++   CI     NG  +N    C+ ND  G         +  +C C  G R N +  C RV  C  + DCPT K C+  N  C NPC   NPC P A     +H+  C+C   + G+P + C P   P   + TD P  +  +N
Sbjct: 19520 QAIPGVVNVPSAPQPTPGRPYYDVAKPDFEFNPCYPSPCGPYSHCHNRFGVAACVCLPNYRGTP------------PNCRPECVINSDCPSSLACINEKCRDPCPGS--CAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSICGPNAVCNNGKCSCIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPCPG-TCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTP-PGCRP-ECTSNSDCPLDKYCLNLRCRDPCPGACGIRAICHVQNHGPLCVCPPHLTGNPL-LACQPIVIPPVE-----------------RDEVNPCQP-SPCGPNSECQATSG----GARCSCLPQYHG---------TPPFCRPECVNSADCPADKACRNYKCIDPC--PGSCGFSALCRVVAHSPVCYCPEGYVGNAYTL--------------CSRPEPSPPAVVILPCNP-SPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRP-ECTVNSDCPSHRACMSEKCRDPCPG-VCGLNALCQVINHSPVCECHTGHVGNPYHSCRIP--------QREPPAPEYVNPCQP-----SPCGANSQCRESQGQAICSCLPEFVGT--------PPSCRPECVISAECPADRACINQKCQDPCP--GACGLNAQCHVRNHSPL----CSCQPGFTGDALTRCLPVP-PPQPPKSNDIRD-----------PCVPSPCGPYSQCRVVNGGASCSCLPNYVG------------AAPNCRPECTINAECPSNLACINEKCRDPCPGA-CGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCP-GHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQ----------PIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQP-PNCR-LECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQP-SPCGPNSQCTNVNG----QAECRCLQEFQGT-PPNCRP-------ECVSHDECANTLACMNQKCRDPCPGS--CGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCPGV--CGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACV-GECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRP----LCVCNEGYTGNALQNCYLLG----CRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRC----------ERPECRSDDECAFHLACRNERCEDPCN----CGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQC---------YKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQN----HQAVCICPTGTQGNPFISCITGH------CQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMA-CKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLER-CGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADD-CGIGAYCHVQQ----RKAICRCPPGYTGNPQERC--LPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASD-PCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACI-----NGDCIN---PCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERC-RVIGCSSNNDCPTDKTCQ--NEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACIN 22111          

HSP 23 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 603/1757 (34.32%), Postives = 871/1757 (49.57%), Query Frame = 0
Query:   18 CQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGDAYSNC-----SPINEDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEY-HNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTE-CENNNDCGDQDVCVGGTCLNSCR-VHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPCSRNT--CGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTC--INRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPYSYCN------AYECLSDPECPDHLHCISEKCVDPCK----CAANAEC---DARNHRGY-CACIIDFTGDPYGIECTPIPEPVIEEVECVEDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERC----VKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQ---GECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPC-KNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPL-IGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTS--PECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCR-----PHPECPDRLKCENEKCVDPC----ECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDV-GCRSNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNNCIDPCQNT-VCGRNAECSVEYHKSICKCPSGLQGSPYVACKEVQ---CRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASR----HRERCICSSPYTGDGYSFCQKIVVPASKSECNVDE----DCPSKLSCISQTCQNPCSLNNPCSTSQECKVADT-----------LPSRTVACICPPNT--YVNGFGNCKRVETATECQSNNDCPDTDVC--DRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICN 1700
            C  +++C  ++AC ++ C +PC N+  CG+ A C   NH+  C C   F G  Y+ C      P  + EC  D DC  + AC+   C +PCE++  C  +A C  Q H+P+C+C EG  G+    CY   C+ + +C   +ACV ++CVDPC  T+CGT A C  ++ H A C C  G +G+P + C+  ECR +D+C  +  C   N +CE+ C     C   A C    HR  C CP   +G+    C   +V      C +D++CP K AC   +C+NPC VT PC     C+V+D+ P RT+ C C        +  C +   + + C +++ C D + C GG C+N C    PC  +AQC+A  HR+ CSC     G+P  +C          ++ GC  + +C   ++C N+ C +PCAE  PC+  A CRV N +P+C CP G+ G P   C    +PEC++++DC     C+ + C+ PC+     CG  AQC  +NH+A+C C +G  G+P+  C    C+ + +C D + C  +NR C+  C  E C  NA C  R H+  C+C  G++GNP+  C+        +C+ D +CP  L CI+E+C DPC     C     C   D    R   C C  D   D     C PI  P +    C  + +C + E C +  C + C +   C  NA C   D        C C +G+ G     C    V +  I + GC  + +C  +  C N+ CI+PC     CG  A C V+  K  C C  G+TG+   +C+  S      CK   DCP N+ACI+ QC  PC+    CG NA CT +NH  +C C PGF+ ++Q  C    C  + +C  DK CV+ +CINPC  +  C   AEC    H+  C+CP GL+G P++ C  +EC    DC     C  +S +C   C  RN CA +A+C+A  HR  C CP  L +G+ Y+ C  R V   +P C  D DCP  LAC+ +KCQDPC+   PC  + +C V ++ P +T+ C C    V    G C ++     P CE   DC   + C+   C + C    CG NA+C+   H + CSC +G+ GNP   C  +          GCR D +C +   C N  CINPC  + PC P A C V ++   C C +GY G+P   CR      + +CP    C+NE+CV+PC     CA  A+C A+NH  +C C  DF G+PY + C P P+P+     C  D DCP + ACINE+C +PC++ +PC + A C+V  T P+RTM C C +G+  +G   C     + +V GC S+S+C  + +C N  C +PC     C  +A CR ++H+P C C  GF G+P   CS   + EC  + DCP   VC +  C   C+    CG+NA C  + H  VC+C+    G+   +C    C+ +++CP DK+C +  C DPC  T +C ++  C V +H+  C CP G          E     C  D DC   + C   R  C   C+ +  C  NA C            C C   YTG+    C K      +S C +++    D   +  C   T  +      PC   Q  ++ ++           +      C CP +    +   G C+  E   EC SN+ C D   C  D  TC + C ++ CGVNA C A  H + C C  G+ GNP   CN
Sbjct: 20874 CVINEDCSRDRACVSQKCRDPCLNA--CGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLAC--RNERCEDPC----NCGIGAQCRVENHRAQCRCPAGFSGNPAVRC--DLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYE-----PPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCY---KPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTD-ISRNCVPITVPKVIS-GCQHNSECANTEVCSNGNCLDACRLER-CGVNAQCTARD----HYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAA-DDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCN----CGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLAC--VSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPV---EPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCN---CGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSI----------GCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPY-VDCRPPPQPI-----CQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCN----CGLNAECRIKDHKPVCTCRQGFEGNPEFECS---KIECSINSDCPGTHVCRNQLCIPACQGEQ-CGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKAC--LRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDK------RSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQP-EEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCN 22559          

HSP 24 Score: 785.408 bits (2027), Expect = 0.000e+0
Identity = 1135/4209 (26.97%), Postives = 1586/4209 (37.68%), Query Frame = 0
Query:  361 NSCRVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDC---PTYSSCR---------NRLC--INPCAEDKPCSLYATCRVINHQPVCTCPNGYI-------------------------------GSPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKG-------HKGNPYSYCNAYECLSDPECPD----------HLHCIS-EKCVDP---CKCAANAECDARNHRGYCACIIDFTGDPYGIECTPIPE----PVIEEVECVEDKDCF-----------SQEACIS-EECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKC---------------INPCTTRT-TCGFSARCSVKNHKMYCNCEVGFTGD------------------AYSKCIQISQGECKYDDDCPFNKACISNQCTD----PCSNGQL--CGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPCKNTLCGTRAEC-SVEYHKPICKCPKGLQGSPYIECK---NVECKRHEDCGDQEKCNL----------ISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQ-----ECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECEIANDCKISDICV---------------------SGSC--IDACKVN----PCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANC-QVINHNPVCTCPNGYIGSPTTVCRPHPECPDRLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACI-----------------NEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCECSPGFTGDPYS----LCSPTREDECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYV--ACKEVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYTGDGYSFCQKIVVPAS-KSECNVDEDCPSKLSCISQTCQNPCSLNNP----------------CSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICN-LAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINPCAESSPCASSARCKVINHEPECTCPDGFIGSPTTDCRPRDPYSFCRPY-ECLSDPECPDHLKCEN-----EKCVDPC---ECARNADCDARNHRGICTCIPDFTGDP--YGIACEP---IPEPVIEEVECKEDRDCPSQNAC---IN--EECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNG-----ECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQ--CVKISNSECKYDTDCASNEACINDQCVDHCVV-----NLPCGKDAECETIRHRSVCKCPKG-LAGDPH---VSCYSFECKKNEDCPFDKECK--SESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQCRRNSDCDS-----KEKCNLKTY----KCTPL---------CRK--------------------------NNNCAESAVCKAENHREKCSCPT---PLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACY-VERCGINAECIANFHRSKCSCYPGYLGD--PKNACYQSPTEIEPLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVC----TCPDGFIGSPSTNCQPPERPECRVDAECPLDRACIHQKCQ---------------NPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSL---CKLSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXENHRAICHCLSGHKG---QAYVNCKRYECLRDSDCPNHLHC--VNDKCVDPCECAR--NADCKARNHRGYCTCIP---------------------------NFTGD-----PYGIVCEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCK----CPRGFSGDPHSYCYK-YECKTDNDCPFDKAC-----AKEKCIDPC-KDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVD----GTCRKTCSINSCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLL--------------------EPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLACINRKCQNPC-STLTCGDNAQCRVQRHRAICT----CLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGY--NGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYE----CRISDDCPFDKTCLNEKCVDPC-DTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCK--EVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIP---QAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETK---------------VECEYNDDCSTNDICQDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCSSI-TCGKNAQCRVQNHRAICSCFGGYVGDPYTACE--EPGCKSD--------------FECPNKQACINRECQ---------NPCLFENCGINAECSP-ENHRAVCACLKGH-KGDPYSFC---------------------KPYE---------CLSDPECPNHLKCENEKCVDPCE----CARNADCDARNHRGICTCILDFTGDPYGIACEPIPEPVI--------EEVECNEDRDCPSQNACI-----NEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGK--GDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCL----KNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCK-CPPGLAGDPHSTCYRYE----CKTNEDCPFDKACASE-KCIDPCQTTLCGSKAICNVEYHQSS-CKCPAGLQGNPYINCKELE 4056
            N C+  PC   A C  +    TC+C  GY GN    C+ I       +   C  N +C   P +  C+           LC  ++ C   + C   A C        C+CP+GY+                               GS   DC P  + + R +S C D            C+R  CG NA C   +    C C  GY GDP + CE           D   C      NP     CG  AEC        C+C  G       H        N  +    P   D           L C+  ++C  P    KC  NA+C        C C   F G  Y + C  I E    P  E   C +    F               C+  +EC     +  PC ++A C+  +T+P     C C +GY GK D +    +  +++ C S+ +C +N  C   +C               I+ C T    CG  A+C        C CE G+ G                   AY K  Q ++  C  +D   +N + ++  C D       +G    CG NA CT       C CPPGF+ D  S C + +  R                     + CG  AEC +V      C+CP      P    +    V C  +EDC     C+           I   C   C   N C A A C  +N + +C+C P   G+   +            CN  D+C            +PC     CS++      +C    +       CI  T   VG             C  AN C   + CV                     +G C  +D C V      CG+NA+CK+      C CP G+ GNP   C   +       TP C+       Y L  N+  ++ C+    C   A C  +      C CP GY   P   C    EC +R             CA  A C  +     C C   + GD Y   C       + + +C  DR+C +   CI                 N +C +PC  + PC  NA+C   D        C C  GF  KGD           +GC    EC                ++ PC+  A C  +     C C   +TGDPY       S T + +C  ++DC SN+ C +  C +PC S+ LCG+NA CE   H+  C+C   +              KN D          +C+  CQ+ +CG  A C        CKCP G  G+P+   +C   QC     CG+ + C   R  C + C    VC   A C+  R+  +CIC   + G+    C   +  A     C  +  C   L      C NP +  NP                C  + EC+         ++C+CP     N +  C+ V+                         C ++PCG+NA C  RA    C C  G  GNP S C  +     +   +  C+   +CP   +C+  +C N C+++S C   A C   N    C CP G+IG       P D    C    +C +D +C     C        KCVD C   +C  NA C + +HR  C C   F G+P    + C+P   +PE   EE +CK D+DC     C   +N  +EC N C     C  N  CK+    P     C C E +         +   + D  C S++ C    ACR       +C+  C +   C   + C    H  +C C  G+ G+P  +  C       C+   +C  +EACI D+             + CG  A C T  H++ C+CP G  AGDP+     C S  C  N DCP  + C   + +C D C +  CG  A C  E H+ +C+C  G++G+P     EV C +   C +        C +       KC PL         CR                           +N C  +A CK  N +  CSCP    P+       C R +      +CL D D   +  C +  C+        C  SQ+C   ES L       CL+ +Q  +   C+       C  + +C QD  C E  C+N C     CG NA C  + H S+CSC  G+ G+  P+  C + P          C     CPS  MC    C  PC + + CAV   C     + VC     C  G I +    CQ    P C  DA+CP    C+  KC+               + C+   C  +A C+       C C +G  GD YS     +   C    +C N+ ACI+ +C +PCL   CG    C+ E H A+C C +G  G      V C + EC+   DC     C    ++C+ PC+       +C+ R+H+  C C                             N  G      P G++ +P+     +  EC  D DCP+  +C N  C +PC     C LNA C+           CTC     G     CV IE      C  + +C  +  C D  CI+PC   N C   A+CSV++H  +CSC  G  GD    C ++    C  D  C +   C    CS  CS N  C    +C     +  CK    CP+ F    ++ C K  EC++D++C  D+ C      + KC   C     CG  AECV   H   C C +G  G+    CR++EC +D+DC++++ CD     C   C     C  NA C   +HQ+ C C   F+GD    C  I        CR D  C     C +AR                          +  C CP G    D +  +    S EC+ N DC     C        CR  C+   CG NA C P  H  +C C  GY G P       V   +PL                     +P C  D +C ++  C+  QC NPC     C ++A C   NH   C C +GF G  + +C  + VP    D EC     C +  C   C + L C  N +C        C     C  G+      VC     V  GC  + +CS + +C+N +C+NPC+E NPCG +A C V  H A+C C      N  P   C     LEC+ + DC +  AC  + C   C  +  C TN  C     +  C+   N  G     C        CR    CP + +C+ ++CVDPC D T CG+ A C+   H+  C CP GL GN  + CK   + C ++ DC SN+ C   +  C   C ++ NC     C     R  C        +    CA+      +  +  C+ D  C   +AC+   C++PC     C +  +C          V C CP          CQ    +                +C   +DC+    C  G C      NKCG   +C          C+ G   N                   C +DQ      +C N +C +PCA +K C   A C V +H+ LC CPDG+ G P+ +C   +  EC  D +C  +  C Q KC+NPC     CG NAQCRV   +A CSC   + G+P + C   E GC S               +EC     CI    Q         N C  + CG+NA C   EN++A C C +    GD Y  C                     + YE         C SD +CP+   C    C DPC     C  NA C    HR  C+C     G P  I C+  P+ V         E++ C+ D +CP    C       + C+NP  +   C  N +C+     P+    C C  GF     G+  C   +      C  + +CA ++AC +  C +PC+    +   C     C V+NH+  C C                 C  D  CP ++AC   +C +PC     C  N+ CI E H+P+CK CP G   D  + C + +    C +N DC     C S  KCIDPC T+ C     C V  H+ + C CPA L  N   NC   +
Sbjct:  131 NECKQRPCDVFAHCTNTLGSFTCTCFPGYRGN-GFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDE---------CARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCE-----------DVDECAT---NNP-----CGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGY-LHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECT---ALDKPCGQHAVCE--NTVP--GYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQ-NEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGA------------------SKCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALN-CGAHAQCMLANGQAQCLCAPGYTGNSALAGG----------CNDIDECRA----------NPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCI--TSKTVG-------------CSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICN-------TPECQCQSP---YKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGA---------QLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLC------ALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERF-PCGINAKCTPSD-----PPQCMCEAGF--KGDPL---------LGCTDEDEC----------------SHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPC-SSLLCGSNAYCETEQHAGWCRCRVGYV-------------KNGD---------GDCVSQCQDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGR--CKERCEGV-VCGIGATCD--RNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCAC-NPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAV----GNHISCLCPQGFSGNPYIGCQDVD------------------------ECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQAS-CGPRAICDAGN----CICPMGYIGD------PHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPE---EEDKCKSDQDCSRGYGCQASVNGIKECINLCSNVV-CGPNELCKIN---PAGHAICNCAESYVWNPVVSSCEKPSLPD--CTSDANCPDASACRPDVLGVLKCVAIC-DAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDPL---PEVACTKQGGCAAGTCHPSAICEVTPEGPVCKCPPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVCSCPLRFQPISDTAKDGCARTIS-----KCLTDVDCGGA-LCYNGQCR------IACRNSQDCSDGESCLKNVCVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAP--------CLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQ----PGCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQ----AHQAICTCPLNSRGDPTIECVHIE------CADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQL--QYCQQDGQCAQGSICSHGICSPLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQ-FQFCSNNICTKELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHM--CKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDF------CR-DAPCGPGARCRNAR-------------------------GSYKCTCPPGLV-GDPYN-EGCRSSVECETNEDCPPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADR----VAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKEC--VRVP-VACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGH------VCLHNKCV-YGCHVDDDCSASESCRNDKCVNPCLE-NPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCR-HDNECGHGEL-CLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGS--CQGKCRNDQNCLADERCMRGTCRTVC--------NTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVN----HGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKC-----RNKCGPKRQCTVGQLCERGACIAGCKSNGD-----------------CAADQ------SCVNGKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKEC---VQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRTLGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPE-IECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCTDPCNNPLFI---CESNKKCETRRHQPV----CICKSGFIVNEYGELTCAPDK----RECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCIC-------MRDCQPSISICLRDAGCPASQACRKLKCVDPCEFAT-CAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQAHQCGSSGKCIDPCLTS-CAGGVKCVVSAHRVTICTCPATLTNNTDSNCTSTD 3952          

HSP 25 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 543/1517 (35.79%), Postives = 758/1517 (49.97%), Query Frame = 0
Query:    1 MACTCIEGY---------EEPIIASGCQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGDAYSNC--SPINEDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCK--STKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRI---ESKTECENNNDCGDQDVCVGGTCLNSCRVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPE---PECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLF-EKCGENAECSPRNHRATCKCNKGHKGNPYSYCNAYECLSDPECPDHLHCISEKCVDPC----KCAANAECDARNHRGYCACIIDF-TGDPYGIECTPIP-EPVIEEVECVEDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPC-KNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECK---NVECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASN----HREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSP--------TTVCRPHPECPDRLKCENEKCVDPCE----CARNADCDARN----HRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDT-----LPLRTM--------TCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLAC--DNGKCINPCRNNNPCSSSAICRTQNHQPTCECSPGFTGDPYSLCSPT--REDECKHDE--DCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSP--VCKCLENFAGD--PHSSCFKYE 1444
            M C+C+ GY         +EP    GC S D+C   +ACR   CVNPC +++PC   A+C  + HR  C C     GD ++NC   P  +  C +DS+C    AC+  +C DPC    PC   A CR Q+ +P+C CP G  GDP   CY+ ECKIN DCP++K C+ E CVDPC     +CG  A+C  + H A+C CP G QG+P++SC    C++N+DC D+  C+  N  C  +C     CA +AIC   +H+  C C P   G+ +  C +  V   KP+C  D+DCP K ACI+E+C +PC     C+  Q C V+D+ P R ++C CP DT T ++  C  I   +  + C++N++C + +VC  G CL++CR+  CG NAQC A  H + C+C +G+ GNP+  C   +V       PGC  N DCP    CRN +CI+PCA D  C + A C V   + +C CP GY G+P   C P  +     C+  +DC  + ACI  QC +PC+   CG NA+C VKNH  IC C  G+ G+    C   GCR+D EC   + C+NREC NPCL  + C  NAEC  RNHRA C+C  G +G+P+  C   EC SD +C  +L C+S +CV PC     CA NA C A  HR  C C      G+PY   C P P EPV     C +D DC S+ ACI ++C +PC+V SPC   A C V +++P+RTM C C E         C K+ P    GC SD++C    AC + +C NPC     CG +A C V  H+  C+C+ GF G+ Y+ C  I    C+ D +C   KACI+  C +PC     CG NA C  Q++RA C+C  G+  +    C    C  N+DCP DK C +E+C+NPC  +  C  RAEC  + H  +C+CP    G+PY++C+      C+   DC  ++ C  I+ +C   C     C   A+CE +         C+CP   +  G   C       +   C  D DCP   +C++  C+DPC     C  + EC++ D  P     C C        +  C+++    EC I +DC  + +C +  CI AC+   CG NA C +  H + C C  G+ GN    C        PL   GCR+DD+CPT   C N  C +PC   + CA    C+V +H P C CP G +             +C    +CP +  C   +CV+PC     C  NA C  R+       IC C+  +TG+P  + C+     VIE+      RD   Q  C      +      PC +    ++ ++        R M        TC    G+       C   EP     C SN +C  N  C  D   C +PC     C  +A C   NH+  C+C  G+TG+P   C+ T  R D  + D    C ++ V  +   + P       G N V  V  HS    C+ + N AG+  P +  F+  
Sbjct: 21169 MMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVC-DQETCALNAICVGRRHQPQCECRPGYQGNPHVQC-DIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADD-CGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCN---CGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAY-CEPRPVEPV-----CRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPC----NCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIG---CRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQAC--INEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCN----CGLNAECRIKDHKP----VCTCRQGFEGNPEFECSKI----ECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIAC-------TPL---GCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNP-AVQCDKRSLCVIEK---GFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPE---CTSNDQCADNRFCNLDTKTCEDPCLTKV-CGVNAFCNAVNHRAQCQCITGYTGNPDLHCNHTNFRTDFPRPDMVVSCLADGVQVEIHITEP-------GFNGVLYVKGHSKDEECRRVVNLAGETVPRTEIFRVH 22627          

HSP 26 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 1117/4254 (26.26%), Postives = 1560/4254 (36.67%), Query Frame = 0
Query: 3248 RPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEV-ECRKDTDCASNEKCN--LQNFRC------------------LRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSY--CAEKIPQAAKLECQIDQDCQGTKACIE------------HGCKD--PCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECE-------------YNDDCSTNDICQDGSCIDACR----VNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDC------------PSYTACRNRQCINP---CAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDC---KKPIVPECLSDPECPDHLACIQQKC---------QNPCSSI--------TCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPCECARNADCDARNHRGICTCILDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENA------------NCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPH-STCYRYE---------CKTNEDCPFDKACASEKCI-----------------DPCQTT----LCGSKAICNVEYHQSSCKCPAGLQGNPYINCK---------------------ELECRKHQDCRDNEKCDMTT-----------YKCTPLCT----------GSNKCASKATCEATNHQEKCFCPSNYIGDGYS-FCSLPIEPAIEPECRVDQDCQSVFACIR-----------------DKCTDPC------------------------FTNNP---CLPLQECKVLN-------SSPLKTVSCICPSDMYIGS--SGQCERVEGT--SECIVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSP--TTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPYECLSDPECPNHLKCKNEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVV--DVGX---RXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPAS-NEECNYDGDCSDNQVCIN-----NQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCY-----------KYECKTNQDCPLDKVCTS-----EKCVDPCDTTQCGLKALCRTE-YHQSICECPQGLQGNPYV---ECKSV-QCRKDQDCRDNEKCN---LQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGD--GYSYCFEKRPLVPKAECQTDGDCRGSLACI------SKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYN----CQRVESRPECEKDRDCDSSSICNE--GTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETS-CRPPIKPEC-RYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCK-------SDFECPNSQACYNKNCQDPCL-FDECGQNAKCFAN-------NHR---SMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPC----ACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEP--LKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSY---CYKYECVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPY---IMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQ-------------------------------------SNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQI-----------TIQ-TQAECTTNNDCRXTDVCLSGTCIDACKV-FPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDG---YIGSSETSCQLPQKPECTKDSECANHLACI-----QQKCQDPC-ASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQ-CGENAECLVNNHEARCKCLSSFKGDPYVKC------------------------------------------RSYECLVDSDCPRHLACEN----EKCVDPC---KCAKYADCKVTNHQGYCTCNSYYTGDPYG--LACEPIPEPIEV-----------------ECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPIS-TGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCY-----SYECKTNEDCPFDKHCVGQKCVNPC-DTTLCGTNAVCKSEYHQSICHCPR---------GLQGSPYVTCKEIECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDVV-KCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQE-----------ASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPCTS-IACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPC-HFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYE-------CLIDSDC---PTNLQCNNEKCVDPC---------------------KCARNADCEI-KNHRGYCTCQSDF-TGDPYGISCDPIPEP------------VLVEYE---------CIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPI-----------IHTGCKSDNKCAQNLACVR-GNCVNPCIND-SPCGDFSSCQTQNHKSVCKCSLGYIGDPYS--TCVPVNEKECQFDDECSSNQACVNNQCEDPC----NNANICGYNAICETKNHRA--ICM-----------------------------------------------------CPKGFAGDPHTSCYNFE----CLSNDDCPFDKKCISE-KCISPCLETICGNKAECTVEYHN-SVCKCPSGLQGNPYVVCKEVECT 6896
            RPC   A C  T     C C P + G+       + C   D+C            DP    RC   A C        C+C +G +G+  + C +V ECR   +C  N  C     N+ C                  +  CS  N C   A C       RC CPP ++GDG S   C ++  + A+  C  + DC  T                 +GC+D   C   NPC    EC         +  C CP G  +  +    ++   +  +             Y         C D   ID C     V KCG N +CI+      C+C  G+ G   + C      NE    P C  +  C            P YT    R C++     A DKPC   A C+       C CP G+ G P       +  +   C S+ +C ++  CI+ +C          + C  I         CG +AQC        C C  GYVG P                         C+ PC    CG +A C P+ + A C C  G   +P        C+   EC                C +NA C        C C   F+GDP+              V+ +E R   S+                 C   AEC     +P    TC C  G T    +  V+  PI+   C +N +C  +  C+              +C  PC   N CG  AQC + N +A C C  G+TG+     A  G CN   +C  N                PC   AIC       +C+CP G +GDP+   C   +         C T E C  D    +  CI                 D C        CG  A+C        C+CP G  GNP+I C+                        C   Q C    +C               Y+  P  +          G+  CA  A C        C CP  Y GD Y+  C+L      + +C  D++C +   CI+                 +KC  PC                        F  +P   C    EC  L         +      C+CP D Y G      C    GT  S+C+ N+DC S   C EGSC++ C    CG NA C T  H   C+C  GY  N +  C                        +QC++  C D           A+C        C CP G +G+P    +C      +C+    C +   CI  +C+  C  + CG  A C   N + IC    +F G+P   C  P              I +   +P     CG NA C     ++ C+C  G  G+PY  C                 +++    P  C  NA+C A  +   C C   F+G+PY I C+ +                        +EC N     KPC  NA C            C C+ G  G     C  IE     D          EC    + +   C N C ++  CG  A C   N    C C +G+IGDP+      S   +C  D DC  +++C        +C+D C  K  CG +A+C +E+HR  C C  G  GNP                + +CK++QDC     C +     ++C++ C    CG   LC+      +IC C +    NP V   E  S+  C  D +C D   C    L   KC  +C     C + ++C AR H+  C C +   G+    + C   +    K  C+   +C+ S ACI      +  C+  C     C P   C T +        C CP G   G  Y+    CQ V     C  + DC  S +CN    TC D C   +CG NA C    H ++C C  G  G+P       LP V       C+    C + T                C   A C V     VC CP  ++G  ++  CRP    +C   D +CP +  C    CQNPC +  CG NA C+V N + VCSC   +   P     + GC        +D +C     CYN  C+  C    +C     C  N       +H    S   C EGH       C    C  + +C     C   KC++PC    +C   A C    H + CSC   F G+P        PE   ++V   CLA   CPS  +C   +C      N PCT+ A C V +    +    VC         E C   +     GC S+++C     C  GKC                          C+ G+ G P+          C+  D+C                  +PC  +A C +      C CP G  GD +S        +C   DDC  +  C+   C DPC +T+CG+ A+C +E H+ +C+C +G  G+P    + C +VEC  + DC  D  CD  + +CI+ C                                       S  C   AFC ++     C+CP  +IGD       +    D  EC  D+DCP   +C N RC +PC   N C  +  C+      I           TI+    EC  N+DC     CL   CID C +   CGA A C    H   C+C  G TG+ +  C ++           C  D  C + + C++  C   C+ ++ C S  +C     +  C        +   S   C   ++ EC  DSEC     C+     + KC+  C     CG NA C  + H   C+C E + GD  S C++  C SD +C +DK+C N  C+  CL+ Q CGENA C   +H+  C C   F GDP V+C                                           S EC  + DCP H AC       KC D C   +C   A+C    H   C C S Y G P      C+P+P P +V                  C LD +C   + C   +C NPCL    C  NAEC + + L      C C +G++G   ++C RV    +  C       P   C    C   C     C+S  +C  L    + +C V       + CL       C  D DC  SESC +++C +PC +  PCG NA C  +NHR+ C C + ++ NP  Q         EC+ N DC     C    C   C D   C TN  C+    + +C             GL   P        C+SD  C  +  C  +   CV  C DP  C  NA+C+  +H++ C C     G+    C     +     C  + DC     C    CQ  C+ ++ CL  ++C        R++   C ++E  ++  ICE    +T C+ D  CA  + C +  C N C    +CG  ++C    H   CQC   + GD L  C L  P +            A   P CS  +DC     C   KC N C     C +   C+    +  C                     C  + +C  +++C+  +C +PC +  ACGRNA C V++HR LC C  GY G+P   C +  C+ D +C   + C   +C+NPC  +  CG NA C     +  CSC     G+P S C+P E       C  +S C   P   +C    C+D C                      C  NA C + +N++  C C  DF  GD Y       P+             V   YE         C  D DCPS ++C+   C +PC     C   A CK      L    CSC   + G+ +++C K DP                C +D++C + L C + G C +PC N    C     C+T+ H+ VC C  G+I + Y   TC P +++EC  DD+C+SN AC + +C +PC      A IC  N  CE +NH+   ICM                                                     CP GF  D    C   +    C SN DC    +C S  KCI PCL T C    +C V  H  ++C CP+ L  N    C   + T
Sbjct:  136 RPCDVFAHCTNTLGSFTCTCFPGYRGN------GFHCEDIDEC-----------QDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQD-ECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGG----SFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLD---IDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCE---NINECQDNP-CGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSP---------------------PRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAA--GCVDIDECDVMHGPFGS-------CGQNATCTNSAGGFTCACPPGFSGDPHSKC-----------VDVDECRTGASK-----------------CGAGAECV---NVPGGGYTCRC-PGNTIADPDPSVRCVPIV--SCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALN-CGAHAQCMLANGQAQCLCAPGYTGN----SALAGGCNDIDECRAN----------------PCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCAL-----AQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKD-YTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDC-----------------------VSQCQDVICGD----------GALCIPTSEGPTCKCPQGQLGNPFPGGSC---STDQCSAARPCGERQICINGRCKERCEGVVCGIGATCDRNNGKCICE--PNFVGNPDLICMPP--------------IEQAKCSP----GCGENAHCEYGLGQSRCACNPGTFGNPYEGCG---------------AQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPY-IGCQDV------------------------DECAN-----KPCGLNAACLNR----AGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLC-SQASCGPRAICDAGN----CICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACS-KIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAIC-DAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQ----KHHCRNHAECQESEACIKDESTQTLGCRPACDTVK-CGPRAVCVTNN----HQAQCQCPPGPFAGDPYDPFNGCQSVP----CVYNHDCPPSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDP-------LPEV------ACTKQGGCAAGT----------------CHPSAICEVTPEGPVCKCPPLFVGDAKSGGCRP--DGQCPNGDADCPANTICAGGVCQNPCDNA-CGSNAECKVINRKPVCSCPLRF--QPISDTAKDGCARTISKCLTDVDC-GGALCYNGQCRIACRNSQDCSDGESCLKNVCVVACLDHSQCASGLACVEGH-------CT-IGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNP-------TPEQGCVRVPAPCLASNQCPSGHMCIGNQC------NLPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEIC-NSDRTCQPGCDSDADCPPTELCLTGKC-------------------------KCATGFIGTPFG---------CSDIDECT----------------EQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQPCHSTAFCNNLPGSYSCQCPEGLIGDPL-----QAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQY---------CQQDGQCAQGSICSHGICSPLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICT--KELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHL----KQCHCPEGFTGDSAKECVRVPVACDGEC------GPGYTCRDSMCLPVCHNDLECASNEKC--LKGSCMLTCRVDNDCFLGHVCLHNKCVYGCHVDDDCSASESCRNDKCVNPC-LENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDNECGHGELCLGLNCVP-------GCRSDQGCPPELSCVGQQ--CVDPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVPRIA-----CGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGT---CRTV---CNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHGVQCQCPAAFMGDGLTGCQL--PPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKCRNKCGPKRQCTVGQLCE----RGACIA------------------GCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYEC---ACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRTLGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTV----LHRPRCSCPSCHIGRPEIEC-KSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCTDPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAP-DKRECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQACRKLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQAHQCGSSGKCIDPCL-TSCAGGVKCVVSAHRVTICTCPATLTNNTDSNCTSTDIT 3954          

HSP 27 Score: 744.577 bits (1921), Expect = 0.000e+0
Identity = 1068/4096 (26.07%), Postives = 1565/4096 (38.21%), Query Frame = 0
Query:   36 VNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGDAYSNCSPINEDECRY-----DSDCPLNNACMKHQC--------------IDPCERNRPCGTKAICRTQSHKPVCMCPEG--LAGDPHA---------FCYEFECKINNDCPFEK------ACVE-EKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCN--LNNFKC-----------------EELCISSGVCAPSAICETYKHRETCVCPPPLTG--DGYSYCREKVVSILKPECYVDSDCPQKYACISEKC---------QNPCV------------------VTKPCSLTQECKVMDSYPTRTVSCICP-KDTRTSLNGECS--RIESKTECENNNDCGDQDVCVGGTCLNSCRVH-----PCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQ--VTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLAC------------IGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPYSY----------CNAYECLSDPECPDHLHCISEKC-----------------VDPCK-------CAANAECDARNHRGYCACIIDFTGDPYGIECTPIPEPVIEEVECVEDKDCFSQEACISEECD-NPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCT-----FNKPCSDSQ-----ECKVFDTSPTKTVACICPTDTVVGIDG------------RCNRVQ----------TSPECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSP----------------CAPTANCQVINHNPVCTCPNGYIGSPTTVCRPHPECPDRLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEV---ECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERC----IKIEPVVDVGCRSNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCECSPGFTGDPYSL---CSPTR-----EDECKHDEDCPSNMVCADN-----KCSNPCRSNSLCGNNAVCEV--MNHSPVCKCLENFAGDP-HSSCFK---YECQKNEDCPFDKSCSSN-----NCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSP--YVACKEVQ---CRKDNDCGQDEKC----DLQRFTCTKLCSNSNVCAANARCEASRHRERCIC-SSPYTGDGY---SFCQKIVVPASKSECNVDEDCPSKLSC--ISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGC-------DSNQDCPSHAACKDRKCINPCAESSPCASSARCKVINHEPECTCPDGFIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCENEKCVDPCECARNADCDARNHRGICT--CIPDFTGDPYGIACEPIPEPVIE---EVECKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGK--GDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCIC-QIGYTGDPYSQCV--KISNSE------CKYDTDCASNEACINDQC---------------VDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVS---CYSFECKKNEDCPFDKECKSESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPY---LSCREVQCRRNSDCDSKEKCNLKTYKCTPLCR-------------------------------------KNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYV-ERCGINAECIANFHRSKCSCYPGYLGDPKNACYQ----------SPTEI--EPLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNCQPPERPECRVDAECPLDRACI-----HQKCQNPC-SRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLF-EKCGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPCECARNADCKARNHRGY--CTCIPNFTGDPYGIVCEPIPEPVIEEVECNEDRDCPSQNACIN----EECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPII--------------------ETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTH------------------ECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYCYKYECKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPY-----VSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPD-EPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTCRKTCSIN-SCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAIC----TCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYK----------------------YECRISDDCPFD--KTCL-NEKCVDPCDTTRCGSKAICKA-EYHKGSCECPNGL------------------------------QGNPYIFCKEVE-CRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICP------PPFE--GDGYSYCAEKIPQAA-KLECQIDQDCQGTKACIEHG-CKDPC---FYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGSCIDAC-----RVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCT-CPDGFIGSPTNDCKKPIV-PECLSDPECPDHLACIQQ-KCQNPCSSITCGKNAQCRVQNHRA-ICSC 3660
            V+ C+  N CG  A C+       C C  G+ GD  S    +++DEC       ++DC   +   +  C              +D C  N PCG  A C        C CP G  L  DPHA             +     +  P+++      AC++ ++C  P    KCGTNAKC     +  C CP G QG  YL C+ +    ++ C +NA C   + +F C                 +E       C   A+CE       C CP    G  D    C +  V+IL   C  + DC     CI  +C          + CV                  +  P S   EC+         ++C  P +D R   +  C   + E+   CE+       DV  G   ++ C V       CG NA C  S+   TC+C  G++G+P   C  +    TGA+    G +               C+N               V      C CP   I  P    R  P   C  + DC  +  C            IG  C  PC    CG +AQC + N +A C C  GY G+        GC +  EC                   C E A CS       C+C  G  G+PY             +A  C +   C    +  +  C                 VD C        C  NA C        C C     G+P+          ++ E+    +  C S    +   C  + C+    C   A C    ++      C C +GY  + D  CV ++           EC+   A               C F A+C  K     C+C  G+ GDAY+    ++Q +C  D +C  N+ CI                            C CPP +  D Q N                     KC +PC+   CG  A+C+     P C C  G +G P + C            D+++C+ +             CA  A C       +CVCP    GD Y S    E  + K +C  +DDC   LAC+   C  PC+      N  C   Q      C+V          C+     V+  DG            +C + Q          ++ +C  A  C    IC++G C + C+   CG+ A C    ++ +C C   + GNP   C  + P  +   +PGC  +  C  Y L ++    NP    +P                C P A C+ + ++  C CP G+ G+P   C+   EC ++             C  NA C  R     C C+    G+PY  +C+PI     ++    +CNE  +CP   +C   +C N C     C   A C   +        C C  G+ G   ++     I+ +   D  C  +  C + L     KC++ C     C  +A+C +++H+ +C CS GF G+P +L   C P R     ED+CK D+DC     C  +     +C N C SN +CG N +C++    H+ +C C E++  +P  SSC K    +C  + +CP   +C  +      C+  C    C  N+ C    H+  C C +G  G+P     C+  Q   CR   +C + E C      Q   C   C ++  C   A C  + H+ +C C   P+ GD Y   + CQ +        C  + DCP    C  ++ TC + C   + C  +  C   D        C CPP     GF      E A        C     C  GT         C  +A C       VC C               PL V   K  GC       + + DCP++  C    C NPC  +  C S+A CKVIN +P C+CP  F   P +D   +D  +     +CL+D +C   L C N +C   C  +++        + +C   C+ D +    G+AC       +E    + C+ +++C    +CI  +C NPC     C  NA C +          C+C EGF G    ++ CV+    V   C ++++C     C   +C      N PC+ TA C V     + +C ++ YT +    C+  +I NS+      C  D DC   E C+  +C               +D C    PC   A CE +     C CP+G  GD +         +C K +DC  +  C    C DPC+ T CG  A C  E H+ +C C +G+ G+P    + C +V+C  + DC     C+ +T +C   C                                       +  C  +A C        C CP  LIGD      R     D  ECL D+D   S +C +  C++PC  ++ C  + NC+      +    C C   ++     +C+ +    EC+ ++DC+ +  C +  C++ C +   CG  A C    H   CSC  G  GD K  C Q          +   I    + SP C  +RDC S  +C   +C   C  +S C     C       +CT                +  ECR D+EC  D  C+       KC++ C  R  CG+NA+C   +H   C C +G+ GD  S C+   C SD +C N ++C N  C+  CL  + CG    C  E+H+ +CHC  G  G   V C   +  RD+ C     C                   RN RG   CTC P   GDPY   C          VEC  + DCP   AC       +C + C   + C  NAEC     +      C C  G+ G+  +R    +P+                     +  C  D+EC     C+ G C NPC++   C  +A+C +++H   C CP G+ GD    C ++                      C+ D +C   + C++  C   C ++  C  G +C                   H+ C  Y C  D+DC   ++C  +KC++PC +  CG  A C    H+++C C + +  NP      V    +ECR + DC +   C      C  LC+D+  C  N +C      ++ VC      D      E+    +  P CR D+ CP +++C+  +C +PC     C  N  C+  ++       C CP G   +    CK   ++  C  N DCQ  ++C  G+C+  C  + +C A+  C        CN         + AC Q  +    + + GC  D  C +   C N++C NPC     C + A C  +NH   C C   F+G   T C+ +    C  D EC ++ A    KC     T  C    QC   + R  C     C  G +      CE    +  GC+SN +C+   +C NG+C +PC     CG +A C V  H   C CP GY G+P   C      EC+ DTDC SN+ C   +C +PC     CGTNA+C     ++ C CPP+  G+P + C                        YEC   D C  D  + CL     V+ C    CG  A C   E ++  C CP                                 QG  Y+  ++ E C  DTDC S + C LQ   C   C+    C   A C+   HR RC CP      P  E   D      +  P+   ++ C  D +C  T  C ++G C DPC    +I  C  N++C+     P+    CIC  G  +   G       K EC  +DDC++N  C DG C + C     R   C  N  C    H+  C+C++    +  +                C  D  CP+  ACR  +C++PC E   CAP + C V  HK +C  CP GFI    N C+K      C S+ +C     C    KC +PC + +C    +C V  HR  IC+C
Sbjct:  256 VDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNIL---CSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAE---------------CVN---------------VPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAG---GCNDIDEC---------------RANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPF----------IMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECI---SIAGGVSYCACPKGYQTQPDGSCVDVD-----------ECEERGA-------------QLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCI------------------------QPGECVCPPPYFLDPQDN--------------------NKCKSPCERFPCGINAKCT-PSDPPQCMCEAGFKGDPLLGCT-----------DEDECSHL------------PCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVK-NGDGDCVSQCQDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVCGIGATCD--RNNGKCICEPNFVGNPDLIC--MPPIEQAKCSPGCGENAHC-EYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK------------PCGLNAACLNRAGGFECLCLSGHAGNPYS-SCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQAS-CGPRAICDAGN--------CICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQ-LGKGLRKCVDACSKIQ-CGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLC-SNVVCGPNELCKINPAGHA-ICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPAC-DTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSV-------PCVYNHDCPPSQMCNRMTHTCFDVCDEES-CGDNAICLAED----HRAVCQCPP-----GFKGDPLPEVA--------CTKQGGCAAGT---------CHPSAICEVTPEGPVCKC--------------PPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNA--CGSNAECKVINRKPVCSCPLRF--QPISDTA-KDGCARTI-SKCLTDVDCGGAL-CYNGQCRIACRNSQDCSDGESCLKNVCVVACL-DHSQCASGLAC-------VEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCSIDQ----HHSQCSCPEGFEGNPTPEQGCVR----VPAPCLASNQCPSGHMCIGNQC------NLPCTKTASCAVGERCYQQVCRKVCYTSN---NCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDEC-TEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCR-----DPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAI----CTCPLNSRGDPTIECVHI----ECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSPLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCS----NNICT----------------KELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPGARC-------------------RNARGSYKCTCPPGLVGDPYNEGCR-------SSVECETNEDCPPHAACTKTNGVAKCRDVCAQLQ-CGPNAECVPKGHV----AQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVCL------------------HNKCV-YGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESV--CRPLCADDAGCLTNERC------QQGVCKPLCRHDNECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHR----KQCLCPEGLDGNANVACKVPRIA--CGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRTVCNT--------DEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHGVQCQCPAAFMGDGLTGCQ-LPPERCHPDCECDENGAYCAPKCSR---TEDCACGQQCARGKCRNKCGPKRQCTVGQL------CERGACI-AGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKECV---QFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRTLGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSC-LQG-HCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCTDPCNNPLFI--CESNKKCETRRHQPV----CICKSGFIVNEYGELTCAPDKRECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISI----------------CLRDAGCPASQACRKLKCVDPC-EFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQAHQCGSSGKCIDPCLT-SCAGGVKCVVSAHRVTICTC 3936          

HSP 28 Score: 729.554 bits (1882), Expect = 0.000e+0
Identity = 1141/4272 (26.71%), Postives = 1571/4272 (36.77%), Query Frame = 0
Query: 1875 KPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECS-PTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKISNSECKYDTDCASNEACIND------QCVDHCVVNLPCGKD-AECETIRHRSVCKCPKGLAGDPHVSCYSFECKKNEDCP--FDKECKSES-CVDP--CIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREV-QCRRNSDCDSKEKC-NLK-TYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACIS-DTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPGCDVDRDCPSYTMCKNRL----CINPCAEDSPCAVTAICKVIQHKPVCT-----------------CPDGF--IGSPSTNCQPPERPECRVDAE-CPLDRACIH-------------------QKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPCECARNADCKARNHRGY-CTCIPNFTGDP-YGIVCEPIPEPVIEEVECNEDRDCPSQNAC------------INEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPY-SFCKKILTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYCYKYECKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCS-ALCSDNNLCANNAKCEAI-NHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFEC------KEVELSTECQVNNDCQQFEICV-----------DGTCRKTCSINSCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTD--CRPINVPE--CLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYK--YECRISDDC------------------------PFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYC----AEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDIC-QDGS----CIDACRVNKCGANTRCISSFHRSECVCLQGYTGN---AQVACYLPITPNEPSLVPGCTSDQDCPSYTACRN-----RQCINPCAEDKPCAPTANCKV-VQHKALCTCPDGFIGSPT-NDCKKPIVPECLSDPECPDHLACIQQ-----KCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPY-----TACEEPGCKSDFECPNKQACINRE------CQNPCLFENCGINAECSPENHRAVCAC----LKGHKGDPYSFCKPYECLSDPECPNHLKCE--NEKCVDPCE---CARNADCDARNHRGICTCILDFTGDPY------------------GIACEPIPEPVI-----------------EEVEC-NEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNF----DTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDP--HSTCYRYE--CKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQ-------SSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGS------------NKCASKATCEATNHQEKCFCPSNYIGDGYS--FCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPC-------------------------FTNNP-----------CLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTST-DVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNP-ESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTI-TCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPG-CKSDFECRDNQACINRECQ------NPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFC------KPYECLSDPECPNHLKCKNEK---------CVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDV------------------------------GXRXXSECS------PNLAXRXQNCVNPCIN---ENPCGAYAKCQVTNHRSQCDCGIGFIGDP---YSSCVPASNEECNYDGDCSDN---------------------QVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYECKTNQDCPLDKVCTSEKCVDPC-DTTQCGLKALCRTEYHQSICECPQG-LQGNPYVECKSVQ-CRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSY--CFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACS-LSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVC----TCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPC-TSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPG--CKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMC----VCNEGHKGDPYTFCKPYDCLV----DNDCLDHLRCTNTKCVDPCA----CAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLAC-EI-----------------------GKCLNPCTTQRPCGSYAKCNV-QNHQPECSCSPGY-TGDPYALCQETS---------------------------TKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCY----------------KYECVTKDDCPFDKTC-LAKNCVDPCKNT--ICGVRASCNAEHHQGICTCISGLQGNPY--IMCK--EVECRRNNDCNFDEKCDLNSFK--CIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFL-----NNPCSSSQECRIAELSQITIQTQAE-----------CTTNNDCRXTDVC-LSGTCIDACKVFPCGAYADCVPNFHEAR-CACFTGYTGNPRSQCTRVVILV 5668
            +PC   A C    T  L + TCTC  G+ G G              C    EC  P +A R       C+EN  C N      L  +  C C+ GY GD    C  +   EC+   +C  N  C N        C D  V N P  +   + +   + +VC         P   C + E     DCP  +D + +SES CVD   C  T CG  A C        C C  GY G+P   C +V +C  N+ C    +C NL  +++C         C    V + + H ++   P      GY      + P  +             AC+  D C  P  V                             + GTN +CI       C   +   Q         +N C    CG NA C        C+C P Y GDP   C     +I+   +    +D+ C  + +C+N +    C  P   D        C+ +    +C+                 C DGF  IGS   +       ECR  AE C     C++                     C+ PC  + CG +A CK + + A C C  G+  +P  +   +GC    EC                F  CG    C        C C  G  G  +  C   +  R                   +C   A+C      GY C C  N   DP   + C PI       V C+ + DCP  + C            I  +C +PC     C  +A+C + +        C C  G+TG            +  GC    EC                + NPC   A CS  +   LC CP G +GDPY   C    T  C+  N C   + C++                   ++    SVC C +G+  +  +     +C+  ++C   +               CG  A C        C+C QG  GNP++ C   E  N  +C       L    C  + CS    C + A+C +I      C CP  +       C ++    DE E R  + C     C          VNKP                + SC CP G Y+ D +        ++     EC  N  C Q   CV           +  C+  C    CG NA CTP     +C C  G+ GDP             LL  GC+++D+C                   PCA  A C        C C   + G P           P+  CL + +C  +LAC+   C +PCS+L CG NA C  ++H   C C  GY+ +                            +G+C++ C ++  CG  A C        C CP G  G+P+   +   D +C     C   + CIN +C + C     CG  A C   N +  C C PN  G+P   C     + + S  C                        P++      K V  C    CG  A C+A  +  SC CP G  GNPYI C++V+     +CA N+ C L N  CL      N   GF           C+C     G+ YS C    ++    A K +C    +C    +C +  CK+ C   + C     C A         +CICP G     +        + +C  + DC  ++IC Q G     C+DAC   +CG N  C+S  HRS C+C  G+ GN    QV C    T   P     C SDQDC     C+      ++CIN C+ +  C P   CK+     A+C C + ++ +P  + C+KP +P+C SD  CPD  AC        KC   C + TC  N+ C  + H+  C C  G+VG+P         ++  C++  EC   +ACI  E      C+  C    CG  A C   NH+A C C      G   DP++ C+   C+ + +CP    C      C D C+   C  NA C A +HR +C C   F GDP                      CE  PE  +                  + +C N D DCP+   C    C NPC     C  NAECKV +  P+    C+C   F    D         I + C ++ +C  +L C N  C   C  +  C +   C        C   +  +   + L   +G C      + +C  +++CI N+C NPC     CG NA+C  + H   C CP G  G+P     C R    C  +  CP    C   +C  PC  T   S A+    Y Q       +S  C AG   N    C+   C    DC   E C     KC     G+              C + A CE      +C CP   +GDGYS   CS P +      C    DC +  ACI  KCTDPC                         F  +P           C+   +C    +   +T  CI P D+     G C+  +  + C   E      DVC +   IN CL + C   A C+ +     C+C EG  G+P ++GC       +P+    C  + DCP+   C+N +C  PC     C + A C+   H+++CTCP    G PT  C      EC  + DC+   AC+  KC +PCS    CG  A C  +NH  +CSC    +GD    C +   C+ D +C     C +  C         C+ E+  L   C     ++  SC Q      + FC      K  EC SD EC     C ++          C+    C RNA+C AR+H   C C   F GD               ++EC  D DC +  +C N  C   CL+ +PC +NA C    T       C C  GF+G    RC  I+   D                               G R   EC       P+ A    N V  C +   +  CG  A+C    H +QC C  G+ G P    + C P  +  C   GDC  N                     +VC   QC +PC +   CG++A C  +NH   C CP+G  G+    C +     + +C     C    C+  C +  +C     C        C        G+  +  K V  C  D DC  +E C  +N KC   CL +N C   A C   NH+ +C C   +  +      C    PL    EC+ + DC   LAC   +C+  C  +  C  ++ C+     P       C      G    C  +   P C  D+ C     C    CVD C+  + CG NA C T  H   C C  G  GN  +AC +P           C  ++DC S   C    C   C  D  C A   C     ++VC     C  G I           +  CR D  C    AC+ +KCQNPC T   CG  A C V NH   C C   ++GD    C  P   C  D EC  + A     C      ++C    +C     R+ C     C  G        C+   C+     + DC     C N KC DPCA    C + A C    H+  C C   + G+P             V++EC  D DC S + C   +C+NPC     C  NA+CRV      R   C C   + G    +C  +E     G  S+  CG+N  C E+                       G  +N C  Q PCG  A C+V +N+Q EC C   +  GD Y  C  T+                           T++C SD DC + ++C+Q  C+DPC     CG NALC +  HRP C CP+   G P   C                 +  C T  +CP    C     C DPC N   IC     C    HQ +C C SG   N Y  + C   + EC R++DC  +  C     +  CI    ++ ICA N  CE  NHK  C C  D        C   I+      C  D+ CP  QAC   +C +PC       N+PC       I +         A+           CT+N DC     C  SG CID C +  C     CV + H    C C    T N  S CT   I V
Sbjct:  136 RPCDVFAHC----TNTLGSFTCTCFPGYRGNG------------FHCEDIDECQDPAIAAR-------CVENAECCN------LPAHFLCKCKDGYEGDGEVLCTDVD--ECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVC--------GPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQC--------RCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQR-------TSGAGLACLDIDECNQPDGV----------------------------AKCGTNAKCINFPGSYRCLCPSG-FQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGC----VDIDECTA----LDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDID-----ECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDV--AAGCVDIDECDVMHG----------PFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGAS---------------KCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPI-------VSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALN-CGAHAQCMLANG----QAQCLCAPGYTGNS---------ALAGGCNDIDEC----------------RANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQ-------------------DSYTGNSVCICRQGYERNSENG----QCQDVDECSVQRG-----------KPACGLNALCKNLPGSYECRCPQGHNGNPFIMC---EICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDV----DECEERGAQLCAFGAQC----------VNKP---------------GSYSCHCPEG-YQGDAYNGLCALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPS-DPPQCMCEAGFKGDP-------------LL--GCTDEDECSHL----------------PCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKN---------------------------GDGDCVSQC-QDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTD-QCSAARPCGERQICINGRCKERCE-GVVCGIGATCDRNNGK--CICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNV--CQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVD-----ECA-NKPCGL-NAACL------NRAGGF----------ECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQAS-CGPRAICDAG--------NCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERT--VPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCS-NVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKCPPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPC--DNACGSNAECKVINRKPV----CSCPLRFQPISDTAKDGCARTI-SKCLTDVDCGGAL-CYNGQCRIACRNSQDCSDGESCLKNVCVVAC---LDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKT--ASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQP-GCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQ------CHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCED---INECLSQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCR------DPNE---CLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIEC---VHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSPLCSTNRDCISEQLCLQGVCQGTC-KSNSSCPQ------FQFCSNNICTKELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKS---------GCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALC----TTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSP-CQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVCLHNKCVYGCHVDDDCSASESC--RNDKCVNPCL-ENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPL----ECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPL------CRHDNECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVPRI--------ACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRTVCNTDEACAQGQICENRM-----CQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCS---RTEDCACGQQCARGKCRNKCGPKRQCTVGQ------LCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKEC---------VQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVG----RKAQCSCPPDFFGNPTSECRPLE-----GGCSSKPCGENSKCTEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQ-PCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRTLGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCTDPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRD--------CQPSISI-----CLRDAGCPASQACRKLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQAHQCGSSGKCIDPC-LTSCAGGVKCVVSAHRVTICTCPATLTNNTDSNCTSTDITV 3955          

HSP 29 Score: 727.243 bits (1876), Expect = 0.000e+0
Identity = 1086/4251 (25.55%), Postives = 1571/4251 (36.96%), Query Frame = 0
Query: 4923 CNEG----TCVDA----CSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDC---PSYTSCR---------NRLC--IDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPCACAKYAECDARNHKAYCSCLVDFT--GDPYGIACDPIPEPLKVE---YECLADKDCPSKE------VCYD-QECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKC--------------LNPCTT-QRPCGSYAKCNVQNHQPECSCSPGYTG--DPYALCQETSTK-ECTSDDDCQTSETCIQYQC---------------TDPCQ-YNKPCGKNALCSSEKHRPVCKCPNGLAGDP----------------HSYCYKYE----CVTKDDCPFDKTCLAKNCVDPCKNTI-------CGVRASCNAEHHQGICTCISGLQGNPYIMCKEV-ECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESV-NHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQAC------------INERCENPCFLNNPCSSSQECRIAELSQITIQTQAECTTNNDCRXTDVCLSGTC--IDACKVFPCGAYADCVPNFHEARCACFTGYTGNP-RSQCTRVVILVPQEVEIGCSGDSDCPRYTACT---------------------NKKC--INPCAVDK---PCASTAICKVINHKPFCSCRDGYIGSSETSCQLPQKPEC------------------TKDSECANHLACIQ-------------------------QKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYS---VCKEAGCRSDYECPSDKACI-----------------NRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCRSYECLVDSDCPRHLACENEKCVDPCKCAKYADCKVTNHQGY-CTCNSYYTGDPYGLACEPIPEPIEVECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYS--YECKTNEDCPFDKHCV----------------------GQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEI-ECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKE----ESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKD-----GNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINP----GCSHDDDCPGHTACRN-----LKCINPCAMDEPCAITADCKV-VHHQSLCTCPDGYIGSPQ-TDCQLPIQPECTRDYECPDNKACIQQ-----QCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPY-----TICNEPGCKSDFECPQQQACLNRE------CQNPCHFEKCGVNAMCSPKNHRGICSC----IEGHKGDPYSFCKPYECLIDSDCPTNLQCN--NEKCVDPC---KCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGY--IGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICM----CPKGFA-GDPHTSCYNFECLSNDDCPFDKKCISEKCISPCLET-ICGNKAECTVEYHNSVCKCPSGLQGNPYV---------------------VCK----EVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRL--------------DNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKG---LVECQTDRDCPDSDVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACY--FPVPQPEPSITPGCQSDQDCPSYNSC--RNRLCINPCAEDDICVINANCKVINHEPVCSC---------------------------------------PNGYIGSPTTECQLSPKPECIVDQDCPLTKACIIGKCESPCS-ANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDCLDPC-LFEQCGQNAQCNPRNHRAMCKCKEGHKGDPYTFCRPYE-CLVDRDCPDQLKCDHEKCVDPCQCAKYANCDAKNHRGYCN--CIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACID-----RECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVE---------------------------------------DKECSYDDECSRTQSCIENQCIQICN---VNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHS-----YECLSNKDCPLDKSCQNKIC---------------------VNPCSK-TICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLDCHNDNDCKDDEKCDRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHP-LIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSS--DCRSSEVCHTG-TCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVNDP--CVKNAKCRVIYHEPVCTCSDGYIGSPQTSCELPSEPECLVDDDCPSDLACIHQSCKTPCST-STCGINAKCNVKSHRAIC----VCIAGYDGDPYQICE----EPGCKSDIECPFDKACISRECQNPCLY-DECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPCQCAKYAECDARNHRGIFPEPVEVEGCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEYE-------CLRDNDCPLNKACVSQKCTDPCLT------------------TDCGIKAKCKT-EYHRGICVCEEGL-QGSPFIECKEVECRKERDCKT-------------NEKCDMNTYKCFP-----------------LCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLC----------SLPVKTEEPECRIDDDCPSKHACINR-KCQNPCSRRNPCLPSETCLVVDSSPSKSVSCSCREGFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDAC-----RIRLCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCR-CPEGFEGDPSIECKPPTPLSIGCSADSDCPVVEACLNT-KCVDPC--NCGENALCRKINHKA-VCFCPSGFSGNPEVLCEKLECT 8635
            CN+G     CVD     C    C V A C  TL    C+C  G+ GN    C       +P++   C  + +C   P++  C+           LC  +D C     C   A C        C+CPDGY+G+       P +  C+   EC                   CG  A+C        C C  GY GD      E GC                 QD C    CG+NA C   +    C+C +G+ GDP   C+  D    N+                 C   AEC        C C   F    DP+    D +P+PL  +   Y   A    P +        C D  EC  P    K C  NA+C  +      +  C+C  G+ G+G   C  I       C  N+ C D +   +  C              ++ CT   +PCG +A C        C C  GY G  DP   C++      C+S+ DC  +  CI+ QC                D C+ + + CG +A C +      C+C  G  G P                H+YC   +    CV +D   ++ + +A  CVD  +  +       CG  A+C        C C  G  G+P+  C +V ECR                      + ++ C   A C +V      CRCP + I D     D  +  V    C  + DCP    C            I   C +PC   N C +  +C +A       Q Q  C         +  L+G C  ID C+  PC   A C        C C  G +G+P R  C            +GCS  + C     C                      N +C  ++ C+V +    C   A+CK +     C C  G+ G+    C++   PEC                  +    C +   CI                           +C++  A  +C   A+C  K     C C E Y GD Y+      +  C +D EC +++ CI                 N +C+ PC    CG NA+C  ++   +C C + FKGDP + C       D D   HL C             Y    V    GY C C   YTGDPY   C       + +C  + DC    AC+E  C +PC     C +NA C+           C C  GY   GD  C                          QC     +   C   A C   +    C CP G  G+P +     ST +C     C   + CI+ +C++ C+    CG  A C   N +  C C    +GNP   C     + K +  C  + HC                       G +  N C    CG NA C++  +   C CP+G  G+PY+ C+++ EC +                        K C +NA C        C CL  + G+ YS C   E    +   K QC    +CP+  SC   +C++ C     C     C   N        C CP   I   +       I+ +C  D DC  S++C         CV+AC  ++CG N+ C    H+++C C+ G+ G+P    NL +  Q     P     C  D DC     C+       +CIN C+ +  C     CK+     ++C C + Y+ +P  + C+ P  P+CT D  CPD  AC        +C+  C +  C  N+ C   +H+  C C +G++G+P          +  C++  EC + +AC+  E      C+  C   KCG  A+C   NH+  C C      G   DP++ C+   C+ + DCP +  CN     C D C    C  NA C  ++HR  C C   F GDP            L E  C +   C +                  C   A C+V    P+    C C   + G       + D     G   D  C  N  C  G C NPC  D+ CG  + C+  N K VC C L +  I D           +C  D +C     C N QC   C N+  C     C        C+    C  G A  + H +     C SN +C  D+ CI  KC++PC     CG  A C+++ H+S C CP G +GNP                       +C      + CTK + C   E C  ++  C ++C   N+C    IC + R     TC                     PGC  D DCP +  C++ +C+                   + PC ++ +C   + LP  T  C C +       GD  +  G     +C    DC ++  C  G C D C    CG  + C +  H + CSC AG+ GDP       F V          C    DC    +C      CI PC  D       NC+V +H+  C+C                                       P G IG P       P  EC+ D DCP + +C   +C SPC   N CG+NA C+A  H+A C C     GDP   C    C  N +C   +AC++  C+DPC L   CG  A+C+ +NH  +C C+ G  GD    C   + C  D  C     C H  C   C   +    +    +G C   C ++ +   +      I    +E  C SD++C   + C+       +C++ CL    C  NA+C      P     C C EG+ G     C  I       CTSD +CS   +CDN  C   C+   PC   A C+  +H+  C C  GF+GDP   C  ++                                         EC  +++C    +C +   +  C        C  NA C+ + H   C C  G  G P +           C    DCP +  C + +C                      NPC +   CGQNAEC ++ H   C CP G+ G     C  +    D +C     C  +   C  VC+++ ECA   KC     +  C   +   +G    VC+         C +D DCS + +C N  C NPC+ N PC  N  C V N       +C C        +      TPQ  C  S   +CR +  C  G  C  +     C D+A C + +      C P    D  + C H  + +  +   GC  D  CP   +C  + C+DPC  DP  C  NA C+ I H   C C +G  G+   +C++P    C  ++DC S+  C   SC+  C     C  + +C   + R +C     C  G      QICE    + GC++D+ C  D+AC++++CQNPC    +CG  A+C+  +H   C+C     G+    C+                     + P +C    ECD     G +  P     C   +DC   + C   +C+N C   R C               T+   C  G                + GC ++ DC+   +C N +C +PCA ++ C + A C V+ H+  C CP G  G+P   CV     EC  D+DC+ NK C + +C +PC++   CG NA C+ +  +  C C     G+P S C   E       C  ++ C          C D C+                     CG+ A C   E ++  C C E    G  +++C       ++DC+T                C  +T +C+                   C     C   A C    H+ +C C    +G   + C          + P   E+  C  D +CP    C    +C +PC+  NP    E+    ++   + V C C+ GF V + G+      + EC    DC  N  C  G C + C     R  +C  N  C  +NH+  C C           C P   +        C  D+ CP    C+  KCVDPC     C  ++ C V  H P+C+ CP GF  D    C+   P    C++++DC     C ++ KC+DPC  +C     C    H+  +C CP+  + N +  C   + T
Sbjct:  116 CNDGYGGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGN-GFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNN------PYREGCQDVDEC--------------SYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRS---ESGCVD---------------QDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNN----------------PCGLGAECVNLGGSFQCRCPSGFVLEHDPHA---DQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAK-CGTNAKCINFPG----SYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECR----------------------TGASKCGAGAECVNVPGGGYTCRCPGNTIADP----DPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALN-CGAHAQCMLANG-----QAQCLCAPG---YTGNSALAGGCNDIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCI-------TSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQ-LCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSD-PPQCMCEAGFKGDPLLGC------TDEDECSHLPC------------AYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLL-CGSNAYCETEQ----HAGWCRCRVGYVKNGDGDCVS------------------------QC-----QDVICGDGALCIPTSEGPTCKCPQGQLGNP-FPGGSCSTDQCSAARPCGERQICINGRCKERCEGVV-CGIGATCDRNNGK--CICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECAN------------------------KPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQAS-CGPRAICDAGN--------CICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPS---NLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCS-NVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDP------------LPEVACTKQGGCAAGT----------------CHPSAICEVTPEGPV----CKCPPLFVGDAKSGGCRPDGQCPNG---DADCPANTICAGGVCQNPC--DNACGSNAECKVINRKPVCSCPLRFQPISDTAKDGCARTISKCLTDVDCG-GALCYNGQCRIACRNSQDCSDGESCLKNVCVVACLDHSQCASGLACVEGHCT---IGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQV--CRKVCYTSNNCLAGEICNSDR-----TC--------------------QPGCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECTEQPCHASARC---ENLPG-TYRCVCPEGTV----GDGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKV---------ECIDHVDCAGDRACDAETNRCIKPC--DLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPN-ECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSPLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELE--CRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAP----DCLCKEGFFGDAKSGCRKIE------CTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTC--RDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGH---VCLH--NKCVYGCHVDDDCSASESCRNDKCVNPCLEN-PCGPNAACSVSN----HRASCSC-------LESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHD--NECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCA-DPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVPRI-ACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRTVCNTDEACAQG------QICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHGVQCQCPAAFMGDGLTGCQ---------------------LPPERCHPDCECD---ENGAYCAP----KCSRTEDCACGQQCARGKCRNKCGPKRQC---------------TVGQLCERGA--------------CIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKECV---QFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTT--PKQDCRTLGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCTDPCN--NPLFICESNKKCETRRHQPV-CICKSGFIVNEYGELTCAPDKRECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRD--------CQPSISI--------CLRDAGCPASQACRKLKCVDPCEFAT-CAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGG-NCTSNTDCSQAHQCGSSGKCIDPCLTSCAGGVKCVVSAHRVTICTCPATLTNNTDSNCTSTDIT 3954          

HSP 30 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 1099/4222 (26.03%), Postives = 1564/4222 (37.04%), Query Frame = 0
Query: 5625 DACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDC---PRYTACTNKKC-----------INPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQLPQKPECTKDSECANHLACIQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCRSY-ECLVDSDCPRHLACENEKCVDPCKCAKYADCKVTNHQGYCTCNSYYTGDPYGLACEPIPEPIEVECELDQD------CPRQK------ACIE-QECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEEIKEYGCKAN---SDXSPNLACIGR---------------QCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTG--DPNYSCLPISTG-ECKHDSDCLNSESCIDNQCE---------------DPCKVYTP-CGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIECKSDI--DCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCK------------DGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSP-QTDCQLPIQPECTRDYECPDNKACIQQ-----------------------QCLNPCT----SIACGRNAECRVTKHRALCSCRSGYIGDPYT---ICNEPGCKSDFECPQQQACLNRECQNPCHF--EKCGVNAMCSPKNHRGICSCIEGHKGDPYSFC-KPYECLIDSDCPTNLQCNNEKCVDPCKCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACI-----------------DTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPY-STCV---PVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNFECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYV--VCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPS-SPGCKVDEDCPSSNACISKQCQNPCRLDNP---CSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTDRDCPDSDV--CDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQ--------DCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQL-SPKPECIVDQDCPLTKACI-----IGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVC-----------EXPGCKSNLECLTT---QACIN--KDCLDPCLFEQCGQNAQC--NPRNHRAMCKCKEGHKGDPYTFC--RPY--ECLVDRDCPDQLKCDHE-----KCV---DPCQCAKYANCDAKNHRGYCNCIADYTGDPYGI-ACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTC------FEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACD--NGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGD-------PHNFCHSYECLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQG---------SPYISCKLLD----------------CHNDNDCKDDEKCDRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPI-TIEPSLTAGCTIDTDCPSYNACHNRLC---------------IDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGS--PQTSCELPSEPECLVDDDCPSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQI---CEEPGCKSDIECPFDKACISR--ECQNPCLYDECGVNAECIPKSHRAMCKCKKGHK---------------------------------------GNPY-VHCK-PYECLYDPDCPDHLTCKNEKCVDPCQ----CAKYAECDARNHRGIFPEPVEVEG----------CQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVN----RHKSHCTCPPGMTGDPYSIC---VIIEDHECEQDSDCNGNKACV-----EYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEYECLRDNDCPLNKACVSQKCTDPCLTTD-CGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVE-CRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGF-VLCSLPVKTEEPECRIDDDCPSKHACINR----KCQNPCSRRNPCLPSETCLVVDSSPSKSVS-CSCREGFYVGKNGDCI----------EVDG-------------QPECRSHSDCRYNEQCQSGSCLDAC-RIRLCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPG-----------CRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECKPPTPLSIGCSADSDCPVVEACLNTKCVDPC---NCGENALCRKINHKAVCFCPSGFSGNPE-----VLCEKLECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDVECA----INEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPC----NCGGGAKCFLSGHRPICQCPEGFIGN-------------PQIECNPAG------CSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCINA--------------------ICRSPCA-------CGLNADCKIIDH-QPVCTCKPGF-YGDPEIECTDTV------------------------------CQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNI----------------VSCSDNSDCPTDKECIN-KLCTDSCSISNP---CGSKSECKVKNHKVDCSCALGFIGNK--GTSCVKVSVTCEVDEDCPSKQSCIEKECLNPCVY----NEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECFPVKTCPANSGLILDNREECVCPTGFGFTENKDECI 9366
            + CK  PC  +A C        C CF GY GN    C  +       +   C  +++C   P +  C  K             ++ C   + C   A+C        CSC DGY+G++      P +  C    EC+                 +CG  A C        C C   Y GD  S   E+GC                 QD C    CG NA+CL  +   RC C   + GDP   C    EC  ++ C     C N      C+C       V  H            DP+    + +P+P+  + +L          P Q+      AC++  EC  P  +   C TNA+C  +      +  C C  G+ G+G   C  + E ++  C  N   +D   +  C  +               +CT+      PC   A C+       C CP G  G  DP  +C  +     C  + DC N+  CI+NQC                D C+ +   CG +A+C+ T     C+C  G +G+P                         C  PC+   CG +A CK + +++ C C  G   +P          SD+   C   ++C++ +    P  +    C  NA C  +    TC C P + GD +S C   +E +                               C  G +C    ++P    TC CP N I   +     + I   C  + DC  + +C               +C + C+ + CG +++C  +  QA C C  GYTG+             +++  GC+  D+C                   PCA  A C       LC CP G  G P +  C       C+    C   + C+Q                        Q ++ C+      ACG NA C+       C C  G+ G+P+    ICN P C               +CQ+P       C ++   S +       CI    G  Y  C K Y+   D  C    +C          CA  A C  K     C C   + GD Y   C       L + +C  D++C +N+ CI                 + +C +PC  + PC   A C   D        C C  G+ G         DP++  GC  +++C+                  PC   + C  +     C C   Y GDPY S C+      + +C  +D+C+SN AC+   C  PC++  +CG NA CET+ H   C C  G+             + N D           C+S C + ICG+ A C        CKCP G  GNP+    C   +C+    C   + C     +C   C+    C   A C+  R+   C C   F+G+    CM  ++    SPGC  +  C          C NP    NP   C +  K V             C  N       +C A+   + C   +    +    C D   VD C    CG  + CL      +C C++G+ G+PY++C       +P  +  CQ           +CP   SC+   C N C++   C   A C   N    C CP GYIG P  +    S + +C  D DC  ++ C      + KC   CS   CG NALC + +HR++C+C  G+ G+P  +            E   CKS+ +C      QA +N  K+C++ C    CG N  C  NP  H A+C C E +  +P      +P   +C  D +CPD   C  +     KCV   D   C   + C A+ H+G C+C+  + G+P     C+P      +  C + A+C   +ACI  E     L  RP  +  KC              C      F G        C+       V C  + +C  S  C+     C + C EES C   A C   +H+A C CP GF GDP              +  C++   C    C            +A+C +    P+CKCPP  +GD       P   C +     + DCP +  C   +C NPC    CG NAEC V   + VC CP  +Q          +  IS  L D                C N  DC D E C +    C   C  + +CA G  C            H  IG                C+ + +C  + +C+ + C NPC     C  N  C ++         C CP+G       +   V     C  S+ C S  +C    C        C   A C   +  +   C    V    + CL   I   + +   GC  D DCP    C    C               ID C   PC  +A+C  +     C C +G +G    Q  C  P +  C   DDC ++LACIH  C  PC  + CGINA C  + H A+C C AG+ GDP      C +  C   ++C  D+AC +    C  PC    CG    C  + H+A C C +G++                                       G+P    C+ P ECL D DCP   +C+N +C  PC+    C   A C A+ H+ I   P+   G          C  + DC  ++AC+D +C +PC     C   A C V N + +    CSC  G +G     C  +       C  D  C+    C +  C   C+ +R C     C         KS+ +CP       +  C   +  ++ EC  DS+C  ++ C+       +C   C+    CGRNA C    H P C C+ G  GD  S C + EC  D+DC  +K+C +  C   CL    CG  A C TE+H+ +C C+ G  G P + C  ++ CR                        + PC  GA C       KC C P L+G+ +   C   V     EC  ++DCP   AC       KC++ C++   C P+  C+     P   V+ C+CR G Y G+  D +          +V G             +P C   ++C   E CQ G C + C + + CG NA CV +NH   C C   F+G+    C+ +         PG           C +D EC +  +C    C+  C V++ C     C  N  V                         GC  D DC   E+C N KCV+PC    CG NA C   NH+A C C      NP      V    LEC  + DC N   C E+ C   C     C  N  C     V K  C  D       LC+ + C      ++ C  E +C   +C+DPC     C  NA C+T+ H   C+C   L GN  V+C  K P        C  + DC S   C    C+  C +   C     C              C +G I  E+R C         GC  D  C ++EACVN+ C+NPC     CG  A C +  H   CQCP  F+G+             P  EC+  G      CS  ++C   + C    C N C     C V   C                     G  I GCKS+ +C   ++C N  C DPC  +  C   A C   +H   C C  GY+G+P + C      EC  D DC +   C   KC NPC     C   A C V+     +   C CP  +       C+   P+  GC  +  C  ++ C                       +C  P         CGLNA C ++++ Q  C C   F  GD  ++C  T                               C SD +C    +C  G C+  C    + CG  A C+ V H+  C CP+   G P + C                  + CS +S+CP   +C     CTD C+  NP   C S  +C+ + H+  C C  GFI N+    +C      C  D+DC S  +C + +C NPC+        C  N  C V +  PV    C C+   +   SI C     CPA+       + +CV P  F        CI
Sbjct:  131 NECKQRPCDVFAHCTNTLGSFTCTCFPGYRGN-GFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNN------PYREGCQDVDECSYPN--------------VCGPGAICTNLEGSYRCDCPPGYDGDGRS---ESGCVD---------------QDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGF---VLEH------------DPHA---DQLPQPLNTQ-QLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAK-CGTNAKCINFPG----SYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTA---LDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRM---------------------ACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNP----------SDVAAGCVDIDECDVMHG---PFGS----CGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTG--------------------------ASKCGAGAECV---NVPGGGYTCRCPGNTIADPDPSVRCVPI-VSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGN-------------SALAGGCNDIDEC----------------RANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPEC---------------QCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQ---LCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLC------ALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERF-PCGINAKCTPSDP-----PQCMCEAGFKG---------DPLL--GCTDEDECSH----------------LPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSL-LCGSNAYCETEQHAGWCRCRVGY-------------VKNGD---------GDCVSQCQDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQIC--INGRCKERCEGV-VCGIGATCD--RNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCAC-NPGTFGNPYEGCGAQSKNV-------------CQPNS-CGPNAECRAVGNHISCLCPQGFSGNPYIGCQD---VDECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSC-------QPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQAS-CGPRAICDAGN----CICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGH-AICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQP----AQKHHCRNHAECQESEACIKDESTQ-TLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQ------SVPCVYNHDCPPSQMCNRMTHTCFDVCDEES-CGDNAICLAEDHRAVCQCPPGFKGDPLP------------EVACTKQGGCAAGTC----------HPSAICEVTPEGPVCKCPPLFVGDAKSGGCRPDGQCPN----GDADCPANTICAGGVCQNPCDNA-CGSNAECKVINRKPVCSCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNV--CVVACLDHSQCASGLACVE---------GHCTIG----------------CRSNKECKQDQSCIENKCLNPCQSANSCGPNALCSIDQ----HHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQC-----NLPCTKTASCAVGERCYQQVC--RKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQ--CHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCG-KGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGV----CSCEAGSTGDAKLGCVQLQY-----CQQDGQCAQGSICSHGICSPLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQ------FQFCSNNICTKELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCR------------------------DAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSV-----ECETNEDCPPHAACTKTNGVAKCRDVCAQLQ-CGPNAECV-----PKGHVAQCACRSG-YDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVCLHNKCV------------------------YGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERC--QQGVCKPLCRHDNECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVAC--KVP-----RIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRTVCNTDEACAQGQI-CENRMCQT-------GCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKCRNKCGPKRQCTVGQLCE-------------------RGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKECVQF---ECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVG----RKAQCSCPPDFFGNPTSECR---PLEGGCS-SKPCGENSKCTEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRTLGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGV-CGLNALCKTVLHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCTDPCN--NPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPV----CICMRDCQPSISI-CLRDAGCPASQAC---RKLKCVDPCEFATCAPNSPCI 3860          

HSP 31 Score: 660.218 bits (1702), Expect = 0.000e+0
Identity = 1077/4162 (25.88%), Postives = 1526/4162 (36.67%), Query Frame = 0
Query: 4215 NACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDC---PSYNQCRNRKC-----------IDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQN--PCSTI-TCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPY-ECLSDPECPNHLKCKNEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACIN-EECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNC--------VNPCIN-------ENPCGAYAKCQVTNHRSQCDCGIGFIG--DPYSSCVPAS-NEECNYDGDCSDNQVCINNQCI-----DPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYECKTNQDCPLDKVCTSEK--CVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGD-CRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNE------------GTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACY-------LPLPTVEPSLTPGCSNHQ-----DCPSYTSC--RNRLCIDP----CIEDTPCAAGATCRVINH--KSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCD-----EPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFA-NNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPCACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCY-----------------DQECKNPCFFNKPCTQNAECRVYDTL-----------PLRTMT------------------------CVCVQGYTGKGDEQ-CVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPH--SYCYKYECVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIMCK--------EVECRRNNDCNFDE-----KCDLNSF---------KCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCD--------------------------------------------KKIASVDTAECKVDSDCPKKQACINERCENPC---------------------FLNNPCSSSQECRIAELSQITIQTQAECTTNNDCRXTDVCLS-----GTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCT--RVVILVPQEVEIGCSGDSDCPRYTACTN-----KKCINPCAVDKPCASTAICKV--INHKPFCSCRDGYIGSSE-TSCQLPQKPECTKDSECANHLACIQQ-----KCQDPCASPICGINARCRVKRHRAICVCLENYIGDP--YSVCKEAG---CRSDYECPSDKACINRE------CQDPCLLEQCGENAECLVNNHEARCKCLSS-FKGDPY---VKCRSYECLVDSDCPRHLACE--NEKCVDPC---KCAKYADCKVTNHQGYCTCNSYYTGDPY------------------GLACEPIPEPIEVEC--------------------ELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTC---LKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPIS-TGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQC----YSYECKTNEDCPFDKHCVGQKCVNPCDTTL-CGTNAVCKSEYHQSICH----CPRGLQGSPYVTCKEIECKSDIDCNTKEKCNL------ENYICVPL-------CTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMC--KDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTG-----DPLKEC------------------------NLII-PLQEASINPG-CSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPCT-SIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPG-CKSDFECPQQQACLNRECQNPCHFEK-CGVNAMCSPKNHRGIC--SCIEGHKGDPYSFC------KPYECLIDSDCPTNLQCNNEK---------CVDPCKCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKID-------------------------PII-----HTGCKSDNKCAQN------LACVRGNCVNPCIN---DSPCGDFSSCQTQNHKSVCKCSLGYIGDP---YSTCVPVN--------------------EKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNFECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKE----------------VECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTC-------PTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTDRDCPDSDVCDDGTCVDACR-KNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVC----SCPNGYIGSPTTECQLSPKPECIVDQDCPLTKACIIGKCESPC-SANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPG--CKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGD--PYTFCRPYECLV----DRDCPDQLKCDHEKCVDPCQ----CAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACD------------------------NGNCVNPCIEESPCTSTAKCSV-RNHKAACTCPIGF-NGDPYSLC---VPVED------------------------KECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHS----------------YECLSNKDCPLDKSC-QNKICVNPCSKT--ICGQNAECSVEYHQAVCKCPRGYQGSPY--ISCK--LLDCHNDNDCKDDEKCDRKT--YTCYKVCNSNDECAIGAKCTARDHLKKCTCS---HPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVC-HTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITI 7809
            N C  + C   A C+  L    C CF GY GN     +I     +P++   C  N +C   P++  C+ +             +D C   + C   A+C        C+CPDG+VG                    N+ Y   R+ CQ+   CS    CG  AIC        C C   + GD                R    C++   Q+ C    CG NA+C        C C  G+ GDP + C+   EC ++  C    +C N      C C      +   H        +     YG     I             R   +  AC++ +EC+ P  + K C  NA+C  +      +  C C  GF G+G   C  I    D      + C+  +      C           C++       + PCG +A C+ T     C C  G+ G  DP  +C     N  C+ + DC++N  CI NQC      +P    S+C     CRT  H  VC         PHA C         +C    V +  +  C  PC+  +CG  A C+ + +++ C C  G   NP              C D ++C++ +    P      +C   A C       TC C    SGD +S C +        EC+T    C     C++                        +P    TC CP G TI       R      C  + DC  +SIC+               C   C   NCG +A+C      + C C  G+TGN  +A            P  E ++   CSN        CP  +S       CI      C +  PCA G TC   ++   SVC C  GY  + E             + +C D   C  Q+ +       CGLNA+C+       C C  G+ G+P+  C+     E  C+S ++     +C    C        C   A+C +     S C C +G++  P           D  C+D   C          CA  A+C  +     C C   + GD Y   C         + +C AD++C + E C                  + +CK+PC    PC  NA+C   D             PL   T                        CVC + YTG   +  C+         C SN +C  NLAC  G C++PC++   CGS A C  + H   C C  GY  +               D DC +       QC D       CG  ALC      P CKCP G  G+P     C   +C     C   + C+   C + C+  +CG+ A+C  + + G C C     GNP ++C            C  N  C +        C+  +F         +   +C Q N C  NA C +V +   C CP    G+ Y  C                                             K     +  +C    +CP+  +C   +C+N C                     ++ +P      C I          + +C  + DC  +++C         C+DAC    CG  A CV   H + C C  G+ GNP +     +    VP+E E  C  D DC R   C       K+CIN C+ +  C    +CK+    H   C+C + Y+ +   +SC+ P  P+CT D+ C +  AC        KC   C +  C  N+ C  ++H+  C CL  ++G+P   + C+ A    CR+  EC   +ACI  E      C+  C   +CG  A C+ NNH+A+C+C    F GDPY     C+S  C+ + DCP    C      C D C    C   A C   +H+  C C   + GDP                      CE  PE    +C                      D DCP    C    CQNPC   + C +NAECKV +  P+    C+C    +  S    + C R        C  + D    L C   QC   CR    CS    C  L ++ + +C   +      +C+    T  C+ + +C   +SCI+N+C +PC+    CG NA C    H S C C +G  GNP  +         C  +  CP    C+G +C  PC  T  C     C  +  + +C+    C  G   +   TC+   C SD DC   E C          +I  P        CT+ + C  +A CE       C C     GDGYS    +    +  QC    DC   ++CI  +C DPC L+  C +   C       L    C CP+  +   N        K EC    DCA    C  +   C+  CD+  CG    C+   H+ATC C  GY       + + EC                         LI  PLQ    +P  C  D DCP   +C+N +C +PC     C + A+C+   HQ++CTCP    G P  +C   +  EC  + +C   KAC+  +C++PC+   ACG  A C V  H  +CSC +G  GD    C +   C+ D +C Q   C +  C   C   + C    +C     +G+C  +C        + FC      K  EC  DS+C  +  C ++          C+    C RNA+C  ++H   C C+  F GD     C  I        EC  D DC ++++C +  C   CL  +PC + A C    T       C C  G++G   V+C  ID                         P +     + GC+S  +C  N       AC + N V  C +      CG  + C  + H + C C  GY G P    + C P+                     +  C  D EC + + C   QC +PC     CG NA C  +NH   C CP+GF GD    C       + +C     C    C+      +C N  EC     N  C     L+G+  + C+                   C  D DC  +E C  R  KC   C  EN C  +A C  + H   C+C       PTP +G  +S  +E         C+ + DC +  AC    C+  C  D  C + ++C      P      +C           C  +  +  C++D+ CP    C    CVD C    +CG+ + C T  H  +C C  G  G+   AC  P           C  ++DC S   C    C   C  D  C+ +  C       VC    +C  G I      CQ      C  D  C   +AC+  KC++PC +   CG  A C   NH   C C + ++GD  T C+ P   C  + EC    A     C      E C    QC     R  C+ K G K        C    C+     + DC     C + KC DPC     C + A C    HR  C C   Y G+P         +  V+  C  D DC S + C   +C+NPCL Y  C  NA+C+V      R   C+C   + G    +C     P+  GC+S K C  +  C                          G  VN C ++ PC   A C V  N++A C CP  F NGD Y  C    P +D                        ++C  D +C   +SC++  C   C +   C  NALC    HRP C CP   IG P   C S                  C ++ +CP    C Q   C +PC+    IC  N +C    HQ VC C  G+  + Y  ++C     +C+ D+DC  +  C        C         CA    C  ++H   C C     P I    S+C+            D+ C  + AC    C +PC     C  N  CIVE+  PI      CP G        C+K  P   C  ++DC  +  C  +G CI  CL    G      S      C C      +    C    IT+
Sbjct:  131 NECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQ-DPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVG--------------------NNPY---REGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGD---------------GRSESGCVD---QDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDI---------APYQRTSGAGLACLDIDECNQPDGVAK-CGTNAKCINFPG----SYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIG--SSCVDIDECRT--HAEVC--------GPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPS--------DVAAGCVDIDECDVMH---GPF----GSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVD------ECRTGASKCGAGAECVN------------------------VPGGGYTCRCP-GNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEKAI---CSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSE-------------NGQCQDVDECSVQRGK-----PACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKL-VGNSCVLSGCSS---GQACPSGAECISIAGGVSYCACPKGYQTQP-----------DGSCVDVDECEERGAQ---LCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLC------ALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCE-RFPCGINAKCTPSDPPQCMCEAGFKGDPLLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLL-CGSNAYCETEQHAGWCRCRVGYVKN--------------GDGDCVS-------QCQDVI-----CGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVCGIGATC--DRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVC-QPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSI----------RGQCGNDADCLHSEICFQLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEE-EDKCKSDQDCSRGYGCQASVNGIKECINLCS-NVVCGPNELCKINPAGHA-ICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKCPPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPC--DNACGSNAECKVINRKPV----CSCPLRFQPISDTAKDGCARTIS----KCLTDVDCGGAL-CYNGQCRIACRNSQDCSDGESC--LKNVCVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQP-GCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECTE-QPCHASARCENLPGTYRCVCPEGTVGDGYS----QPGCSQPRQCHKPDDCANNLACIHGKCTDPC-LHTVCGINANCQSEGHEAL----CSCPAGFLGDPNDTGVGC-FKVECIDHVDCAGDRACDAETNRCIKPCDLTSCG-KGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIEC---VHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSPLCSTNRDCISEQLC----LQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKS-GCRKI--------ECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALC----TTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLP-----VCHNDLECA---SNEKC-----LKGSCMLTCRVDNDCFLGHVCLHNKCVYGCHVDDDCSASESC--RNDKCVNPC-LENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLE---------CRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDNECGHGEL------CLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVP--------RIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRTVCNTDEACAQGQICE-NRMCQTG----CRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCS---RTEDCACGQQC----ARGKCRNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPS--------KECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVG----RKAQCSCPPDFFGNPTSECR----PLEGGCSS-KPCGENSKCTEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQ-PCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRTLGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCTDPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSI----SICLR-----------DAGCPASQACRKLKCVDPCEFAT-CAPNSPCIVEDHKPICKF---CPAGFIADAKNGCQKAKPGGNCTSNTDCSQAHQCGSSGKCIDPCLTSCAGGVKCVVSAHRVTICTCPATLTNNTDSNCTSTDITV 3955          

HSP 32 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 1086/4220 (25.73%), Postives = 1535/4220 (36.37%), Query Frame = 0
Query: 5443 NCVDP----CKNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINE------RCENPCFLNNP----CSSSQECRIAEL-SQITIQTQAECTTNNDC---RXTDVCLSGTCIDA--CKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSC-QLPQK---------PECTK----DSECANHLACIQ-QKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCRSYE--CLVDSDCPRHLACENEKCVDPCKCAKYADCKVTNHQGYCTCNSYYTGDPYGLACEPIPEPIEVECELDQDCPRQKACIEQECQNPCL-----IYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEEIKEYGCKANSD---XSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCID-NQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSY-ECKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIECKSDIDCNTKEKCNLENYICVP----LCTDPKL------------CAVNANCEITNHKETCQCLPFYYGDGY--SFCTKKEESKKKP--------------QCQIDGDC---PQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPL--------KECNLIIPLQEAS---INPGCSHDDDCPGHTACRNLKC-INPCA---------------MDE-------PCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQ-----------------QQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPY-------SFCKPYECLIDSDCPTNLQCNNEKCVDPCK---CARNADCEIKNHRGYCTCQSDFT----------------GD---------------PYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHT----GCKSDNKCAQNL-----ACVRGNCVNP-----------CINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNFE-----------CLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCK----EVECTKDSDCLNNEECNLRLAKCNRLCQ---RENSCTKSAICEATRHTEICTCPTPFIGDGKSFCM----EIVKPPSSPGCKVDEDCPSSNACIS-----KQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTDRDCPDS-----DVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDP--YTACYFPVPQPEPSITPGCQSDQDCPSYNSC-----RNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGS----PTTECQLSPKPECIVDQDCPLTKAC--IIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYT----------------------------VCEXP----------GCKSNLECLTTQA-------CINKDCLDPCLFEQCGQNAQCNPRNHRAMCKCK--------EGHKGDPYTFCRPYECLVDRDCPDQLKCDHEKCVDPCQCAKYANCDAKNHRGYCNCI-ADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKG--DEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAAC----TCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQC---------------IQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNF---CHSYECLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPY---ISCKLLDCHNDNDCKDDEKCDRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTC------------------SHP---------------------LIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITAC-LVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPC-VNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCEL-PSEPECLVDDDCPSDLACIHQS-----CKTPC-STSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEEPGCKSDIECPFDKACISRECQNPCLYDE-CGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPCQCAKYAECDARNHRGIFPEPVEVEGCQMDKDCPSQEACIDR----ECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEK---CELITEPIVV-----------------GCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIE---DHEC---------------EQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEYECLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSPF-----IECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLL-----GNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLVVDSSPSKSVSCSCREGFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDACRIRLCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECKPPTPL--------------SIGCSADSDCPVVEACLNTKCVDPCNCGENALCRKINHKAVCFCPSGFSGNPEVLCEKLECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIE---VEKECVVDSDCPS-----QLACLND---------YCENPCYSL---TPCHTSAMCSVVDTSPFRTMVCTCREGW------------IPQEDRSCIPIETPNPPGCVK----------------DDECPSNEACVNRMCRNPCN----CGGGAKCFLSGHRPICQCPEGFIGNPQIECNP----------------AGCSSDKECRSTEACVE-ASCVNPCLINDP---CGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIG----CKSDSECPNKKACRNRDCIDPCL----KDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSC-INAICRSPC--ACGLNADCKIIDHQ-PVCTCKPGFYGDPEIECTDT 9143
            NCVD     CK   C V A C        CTC  G +GN +  C++++           +C   +         +  C  NA C ++     C+C     GDG   C       D  EC+   +C     C N        C +    NNP    C    EC    +     I T  E +   DC      D      C+D   C   PCG  ADC+      RC C  GY+G+P + C  V                              + CA + PC   A C  +     C C  G++   +    QLPQ          P  T            LAC+   +C  P     CG NA+C        C+C   + G  Y  C+                IN ECQD      CGENA C        C C   + GDP+  C   +    +D  C +H  CEN      CKC +  D K                DP  +ACE +   + + C  + DC     CIE +C   CL     I S CV   EC+ +  +      C    G                 YGC+  +      P +AC       PC +   C + A C+   + A C C  G T +P+     ++ G             C+D ++C+     +  CGQNA C  +     C C  G  G+PHS+C    EC+T       K   G +CVN           V    Y    C CP      P      + C   + C+  E C   N IC      LC +P +            C  +A C + N +  C C P Y G+      C   +E +  P               CQ  G     P +  CI  +    C    PC  G+ C V +S    S+       E  SENG C+ +    EC V                       CG N+ CK       C+C +G+ G+P          EC    P +      +  GCS    CP    C ++   ++ CA               +DE        CA  A C        C CP+GY G          Q +C  D EC  N+ CIQ                  +C +PC    CG NA+C        C C +G+ GDP   C +                    ++ C    C   A C  K     C C + + GDPY       S     +CL + DC +NL C    CV PC    C  NA CE + H G+C C+  +                 GD               P G   +P P       +C   + C   Q CI+  C   C       +   C +  T       C C   + G  D+ C  + PI       GC  +  C   L     AC  G   NP           C  +S CG  + C+   +   C C  G+ G+PY          CQ  DEC++                  CG NA C  +     C+C  G AG+P++SC   E           C    +CP    C   +C + C +  CG +A C        C CP G  G+P+          +C  D+DCL++E C  +L K  R C     +  C  +A+C +  H   C C   F G+  +  +    E   P     CK D+DC     C +     K+C N C  +  C   + C +    P     C C+++   N          L +C +D +CPD+     DV     CV  C   +C + S C+   H  +C C+ G+ G+P     C       +P+    C++  +C    +C        L   P  +   C   A C   NH+  C CP G        P   CQ  P   C+ + DCP ++ C  +   C   C    CG NA+C A +HRA C C  G+ GDP                              VC+ P          GC+ + +C    A       C    C +PC    CG NA+C   N + +C C             G   T  +   CL D DC   L C + +C   C+ ++  +      +  C     D++    G+AC    E     GC S+ +C   Q+CI+ +C NPC +   C  NA C +          C+C EG+ G    ++ C  +  P    C +  +C +   C    C  PC + + C    +C  +  +  C     C  G   +    C P     C  D +C  T+ C+  +C               I  C    PC  +A C        C CP GT+GD ++        +C    DC  + +C +  C +PC  T+CG NA C  E H+A+C CP G+ G P    + C  ++C +  DC  D  CD +T  C K C+    C  G  C  RDH   C C                  S P                     LIGD        P     EC  D+DC  + +C NS C++PC     C  N  C  +         C CP         +C  +    +C D+ DC   + C    CI  C L   CG  A C   +H   C C     GD    C+             C  D  C   + C + +C   C  N  C+    C     +  C  +         S  +   E EC  D +C  D  C+  +     C++ C   + CG NA+C  +SH   C+C  G+ GD    C +  C SD +C  DK+C +  C+  CL  + CG NA C  + H+ +C C+ G  G+P V C   +   D  C     C+N +    C C      D  N          VE C+ ++DCP   AC       +C++ C   + C  NAEC     +      C+CR GY G+  ++   C+ +  P  V                  C  D +C     C+  +C NPC + + C Q A C +  H   C CP G TGD    CV +    D EC                 D +C  N+ C++  C+  C  D  C    +C                   H+ C  Y C  D+DC  +++C + KC +PCL   CG  A C    HR  C C E +  +P      +    +ECR+ RDC     C  +   C PLC      A+ A CL     ++ VC+P        G+G +   L      P CR D  CP + +C+ ++C +PC+    C  +  C  +D        C C EG     N  C     +  C  + DC+ N+ C +GSC   CR      +  C+A+       CR     N + AC             GCR+D  C T   C N KC +PC     CG+ A C V  H   C+CP  F GD    C+ P                 +  CS   DC   + C   KC + C         ++  +  C                  C S+ DC+ D+ C    C++PC     C  N  C  S H   C CP    G+P   CV  EC ++ DC+S + C Q KC +PC+    C  NA C+ V   + C C P   GNP   C      P+E     K C  +S C       + AC++           C  P  +     PC  +A C V++ +      C C E +             P++D   +  E     GCV+                D +CPS ++C+   C +PC     CG  A C    HRP C CP   IG P+IEC                    CS+D EC  T  C +   C +PC  N+P   C  + KC    H   C C  GF  + Y   +       C  D +C +  AC +  C +PC+    +   CA   +C  ++H   C C    Q     S ++     C+ D  C    AC   KC +PCE    CA  + C V +    KP+   CP G++     GC+   P    C  N DCS +  C  +  C  PC  +C     C +  H+  +CTC      + +  CT T
Sbjct:  124 NCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGF-HCEDID-----------ECQDPAI--------AARCVENAECCNLPAHFLCKCKDGYEGDGEVLC------TDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDV------------------------------DECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCEN---------------IN-ECQD----NPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKP---------------DPK-VACEQVD--VNILCSSNFDCTNNAECIENQCF--CLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPG----------------SYGCECEAGYVGSPPRMAC-----KQPCEDVR-CGAHAYCKPDQNEAYCVCEDGWTYNPSD----VAAG-------------CVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGAS----KCGAGAECVN-----------VPGGGY---TCRCPGNTIADPD---PSVRCVPIVSCSANEDC-PGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVG-CSDANPCATGETC-VQDSYTGNSVCICRQGYERNSENGQCQDVD---ECSVQRG-----------------KPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKC-TPSDPPQCMCEAGFKGDPLLGCTD--------------------EDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERC-------EGVVCGIGATCDRNNGKCICEPNFVGNPDLIC--MPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNS-CGPNAECRAVGNHISCLCPQGFSGNPY--------IGCQDVDECANKP----------------CGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQASCGPRAICDA----GNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEIC-FQLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCS-NVVCGPNELCKIN---PAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGC-------QPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVP---CVYNHDCPPSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKCPPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPC-DNACGSNAECKVINRKPVCSCPLRFQPISDTAKDGCARTISK---CLTDVDCGGAL-CYNGQCRIACRNSQDCSDGESCLKNVCVVACLDHSQCASGLACV---EGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCSIDQ----HHSQCSCPEGFEGNPTPEQGCVRVPAP----CLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQP----GCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDEC-TEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTS-CGKG-NCQVRDHKATCACYEGYQLVNDVCEDINECLSQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPN----ECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQ----AHQAICTCPLNSRGDPTIECVHI----ECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQY---------CQQDGQCAQGSICSHGICSPLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCR----SSVE-CETNEDCPPHAACTKTNGVAKCRDVCAQLQ-CGPNAECVPKGHV----AQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVCL------------------HNKCV-YGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESV--CRPLC------ADDAGCLTNERCQQGVCKPLCRHDNECGHGELCLGLNCV---PGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTID----HRKQCLCPEGLDGNANVACKVP--RIACGRNEDCQSNQLCYAGSCQGKCRN-----DQNCLADERCMRGTCRTVC--NTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKCRNKCGPKRQCTVGQLCERGACI---------------AGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGNPTSEC-----RPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHVLENN---QAECYCPEDFPNGDAYVQCYLTTPKQDCRTLGCEV---GGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCTDPC--NNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQ----PSISI-----CLRDAGCPASQACRKLKCVDPCEFAT-CAPNSPCIVEDH---KPICKFCPAGFIADAKNGCQKAKP-GGNCTSNTDCSQAHQCGSSGKCIDPCLTSCAGGVKCVVSAHRVTICTCPATLTNNTDSNCTST 3951          

HSP 33 Score: 653.67 bits (1685), Expect = 0.000e+0
Identity = 830/3017 (27.51%), Postives = 1209/3017 (40.07%), Query Frame = 0
Query:    9 YEEPIIASGCQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRNHRTTCVCTIGFT----GDAYSNCSPI---------------------------------NEDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCY--------EFECKINNDC------------------PFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVG-----GTCLNSCRVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQP-GCDSNQDCPTYSSCRNRL-----CINPCAEDKPCSLYATCRV-INHQPVCTCPNGYIGSP-TTDCRPQPEPECRLDSDCSDHLAC----IG-QQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPY-----SVCEEPGCRNDFECPDTQTCINRE------CQNPCLFEKCGENAECSPRNHRATCKCNKG-HKGNPY---SYCNAYECLSDPECPDHLHC--ISEKCVDPC---KCAANAECDARNHRGYCACIIDFTGDPYGIECTPIPEPVIEEVECVEDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDH-------NLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGF--TGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALC----KCPPGFATDSQSNCYEYECL----RNSDCPFDKACVSEKCINPCKNT-LCGTRAECSVEYHKPICKCPKGLQGSPYIE--CKNV--ECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREV-PSDK---PECNVDDDCPGLLACMSEKCQ---------------DPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSP-ECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHE---CYFVSPTSEPLLTPGCRNDDDCPTYSLC--KNTMCINPCAEDS-------------------------------------PCAPTANCQVINHNPVCTCPNGYIGSPTTV-------CRPHPECPDRLKCENEKCVDPCE----CARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCECS---PGFTGDPYSLCSPTREDECKHDEDCPSNMVCADN-----KCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNNCIDPCQ-NTVCGRNAECSVEYHKSICKCPSGLQGSPYVACKEVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYTGDGYS-FCQKIVVPASKSECNVDEDCPSKLSCISQT----CQNPCSLNNPCSTSQEC---------------------KVA--DTLPSR-TVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINAC-KSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINPCAESSPCASSARCKVINHEPECTCP-DGFIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCENEKCVDPC---ECARNADCDARNHRGICTCIPDFTGDPY-GIACEPIPEPVIEEVECKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKISNSECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIRHRSVC----KCPKGLAGDPHVSCYSFECKKNEDCPFDKECKSESCVDPC-IDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACY-VERCGINAECIANFHRSKCSCYPGYLGDP------------------KNACYQSPTEIEPLLSPGC--DVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPV-CTCPDGF----------IGSPSTNCQP------------------PERPECRVDAECPLDRACIHQKCQNPCS-RLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLS----------------GCESDFECPNHQACINR-ECQNPC---LFEKCGXXXECKXENHRAICHCLSGHKGQAY--VNCK--RYECLRDSDCPNHLHCVNDKCVDPC--------ECARNADCKARNHRGYCTCIPNFTGDPYGIVCEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGC-RDGDCINPCIKDNPCHTSAQCSVRSHKA-LCSCPVGYAGDPYSFCKKI 2695
            +E     S C S+D+C SN AC    CV+PC+ S  CG  A C    H   C C +G+     GD  S C  +                                 + D+C     C     C+  +C + CE    CG  A C   + K  C+C     G+P   C            C  N  C                  P+E    + K V  C+   CG NA+C    ++  C CPQG  G+PY+ C++V+   N  C  NA C       E LC+S     P + C+  + +               +C++      K +C    +CP+ Y+C   +C+N C     C     C   +        CICP       + +      + +C N+ DC   ++C         C+++C    CGPNA C++  HRS+C CS G+ GNP +     Q     P +   C S+QDC     C+  +     CIN C+ +  C     C++      +C C   Y+ +P  + C     P+C  D++C D  AC    +G  +C+  C   TC  N+ C  + H+  C CL+G+VG+P         ++  CRN  EC +++ CI  E      C+  C   KCG  A C   NH+A C+C  G   G+PY   + C +  C+ + +CP    C  ++  C D C    C  NA C A +HR  C C   F GDP            + EV C +   C +                  C  +A C+V    P+    C C   + G               GCR D +C +       N  C    C NPC     CG +A C V N K  C+C + F    D        +  +C  D DC     C + QC   C N Q C +   C        C    +C  G A      C E  C      N +C  D++C+  KC+NPC++   CG  A CS++ H   C CP+G +G+P  E  C  V   C     C     C  I  +C   C+    CA    C     R+ C           ++C   E+  SD+   P C+ D DCP    C++ KC+               D CT  +PC  S  C+        T  C+CP  TV   DG      + P +C   +DC  +  C+ G C D C    CG+NA C+S  H++ CSCP G+ G+P+     C+ V           C +  DC     C  +   CI PC   S                                     PC  TA C  +  +  C CP G IG P          C    +CP    C+N +C  PCE    C  NA+C A+ H+ ICTC  +  GDP  I C          +EC ++ DC  + AC++ +C +PC +   C   A C V + + +    C+C  G TG     C++++      C+ + +C +   C +G C   C  N  C S  +C     Q TC+ +   P F     ++C  T+E EC+ D +C  +  C  +     KC + C   + CG NA C   +H+P C C E F GD  S C K EC  ++DC  DKSC ++ C   C     CG NA C+ E+H+ +C C  G  G P V C  +   +D  CG                         ARC  +R   +C C     GD Y+  C+  V      EC  +EDCP   +C        C++ C+    C  + EC                     +VA    LPS   V   CP NTY      C        C  + +C   +VC  G C N C + + CG NA+C  + H   C C +GF G+    C   P+         CD   +C     C+D  C+  C     CAS+ +C   +    C    D F+G           ++ C  Y C  D +C     C N+KCV+PC    C  NA C   NHR  C+C+     +P   + C   P      +EC+E+RDC +  AC    C   C     C+ N  C+     PL      C  G      E C+ +  V   GCRS+  C P L+C   +C++PC +   C   A CQ ++H  +C+C  G  G+    C K+    C  + DC SN+ C    C   C  +  C  D  C     R+VC     C +G   +  +      C+ +  C  D+ C ++ C +PC    QCG  A C V  H   C+C + + G+    C+    R + DC+    C+     C P C +  +CA    C     R KC  P      G   C R    A    C  + D +  ++C++  C +PC  E  C  +  C V E  +L    C C +G +   + +C+    Q EC +D DC+ +  C +G C N C     CG NA+C     +++CSC P + G+P                   + C + P   E     GC  D  + C    +C   L +N C  D PC + A C V+++    C CP+ F          + +P  +C+                    +  +C  D +CP +++C+   C +PC+ R  CG NA CK   HR  C+C   + G P   CK                   C +D ECP    C    +C +PC   LF  C    +C+   H+ +C C SG     Y  + C   + EC RD DC +++ C + KC +PC         CA N  C+ +NH+  C C+ +         C+P          C  D  CP+  AC   +C +PC  +  C  N+ C V D  P+      C  GF       C K +P     C S+++C +   C   G CI+PC+    C    +C V +H+  +C+CP     +  S C   
Sbjct: 1185 FESGTPKSKCLSNDDCASNLACLEGSCVSPCS-SLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCE-GVVCGIGATCDRNNGK--CICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNV--CQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESK---------------FCQDA----NKCQCNERVECPEGYSCQKGQCKNLCSQAS-CGPRAICDAGN--------CICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCS-NVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDP------------LPEVACTKQGGCAAGT----------------CHPSAICEVTPEGPV----CKCPPLFVGDAKSG----------GCRPDGQCPNGDADCPANTICAGGVCQNPCD--NACGSNAECKVINRKPVCSCPLRFQPISDTAKDGCARTISKCLTDVDC-GGALCYNGQCRIACRNSQDCSDGESCLKNVCVVACLDHSQCASGLA------CVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMC--IGNQCNLPCTKTASCAVGERCYQQVCRKVCY--------TSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECT-EQPCHASARCENLP----GTYRCVCPEGTVG--DGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVE----------CIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPT-IEC--------VHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGV----CSCEAGSTGDAKLGCVQLQ-----YCQQDGQCAQGSICSHGICSPLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNIC--TKELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCG-----------------------PGARCRNARGSYKCTCPPGLVGDPYNEGCRSSV------ECETNEDCPPHAACTKTNGVAKCRDVCAQLQ-CGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTY------CSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPV--------ACDG--ECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVCL-------HNKCV-YGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSP-----PLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDNECGHG------ELCLGLNCV--PGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVAC-KVPRIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRTVCNTDEACAQGQICENRMC--QTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHGVQCQCPAAFMGDGLTGCQLPPERCHPDCE----CDENGAYCAPKCSRTEDCACGQQCARGKCRNKCG-PKRQCTVG-QLCERGACIAG---CKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTVSEHRML----CYCPDGYEGEPSKECV----QFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAHQGC----LCGGPL-VNAC-RDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRTLGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCTDPCNNPLF-ICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRD---------CQP------SISICLRDAGCPASQACRKLKCVDPC-EFATCAPNSPCIVEDHKPICKF---CPAGFIADAKNGCQKAKP--GGNCTSNTDCSQAHQCGSSGKCIDPCLTS--CAGGVKCVVSAHRVTICTCPATLTNNTDSNCTST 3951          

HSP 34 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 532/1571 (33.86%), Postives = 735/1571 (46.79%), Query Frame = 0
Query:    5 CIEGYEEPIIASGCQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGDAYSNCSPINEDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQ-SHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVE-----CRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYK----HRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSR-IESKTECENNNDCGDQDVCVGGTCLNSC-RVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDK-PCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLAC--IGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCE------EPGCRNDFECPDTQTCINRECQNPCLFEK-CGENAECS-----PRNHRATCKCNKGHKGNPYSYCNAYE-------CLSDPECPDHLHCISEKCVDPC---KCAANAECDARNHRGYCACIIDFTGDPYGIEC--TPIPEPVIEEVECVEDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPC-KNTLCGTRAECSVEYHKPICKCPKGLQ-GSPYIEC--KNVE--CKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASN----HREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECEIANDCKISDICVSGSCIDACKVN-PCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRPHPE--------CPDRLKCENEKCVDPC----ECARNADCDARNHRGICTCI---PDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPH---SSCFKYECQKNEDCPFDKSCSSNNCIDPCQNTV-CGRNAECSVE----YHKSICKCPSGLQGSPYVACKE 1502
            C+    EP     C SD +C +++AC N+VC NPC  SN C   A C V+ HR  CVC  G+TG+A  NC  +    CR D +C  N AC+  QC+DPC   + CGT AICR   +H+  C C +G  G+P   C   EC+ +++C F  AC  E+C DPC    CG  A+C VE H A C+CP G  G+P + C  V      C  + +CP    C     +C+  C  +  C  +AICE           C C P   G+    C ++        C     C    AC    C NPC+   PC+ + +C            C CP+ T+      C    E KT C ++++C     C+   C + C   +PC  NA+C   + R  C C  G+ G+PQ  C           +P C  N DCP   +C N  C++PC   +  C   A C   NHQ VC CP G  G+P   C       C+ + DC+DH AC  + + C   C + TC +NA C  + H+  C C  GY G+P+  C+      +P C  D +CP    CIN  C +PC     C     C+     P+   A CKC      +    C           C  + EC +   C +  C+D C   +C  NA+C AR+H   C C   F G+P  IEC  T +  P I    C  + DC   + C +E C +PC     C   A C V      R   C C  GYTG   ERC+    +I VGC+S  +C  N AC N +C +PC     CG +A C+VKNH   C C+ GF+G+A   C  I    C+ DD+C  +K C++ +C +PC     C  NA C  +NHRA C+CP G   D    C   EC  + DC  + ACVS +C++PC +   C   A C    H+ +C+CP  L  G+PY  C  + VE  C+   DC  +  C  I  KC+  CS  + C  +A C   N        C C    + D   +C ++ +P   P C  D DCP   AC+  +C++PC     C  +  C+V          C C      G +G       S  C +  +C     C++G CI+ C +N PCG NA C   S+ ++C C +GY GNP   C  +          GC +++DCPT   C+N  C+NPC   +PCAP A C+  NH  VC CP  ++G+P   CRP P+        CP R  C NE+CVDPC     C R A C+      + T +   PD         C+P P  + E   C  D DCP+  +C+N  C +PC     C  NAEC++ D  P+    CTC +GF G  +  C KIE      C  NS+C     C N  CI  C+    C S+A C    H+  CEC PG  G+    C+P     C+ D++CP++  C + KC++PC + +LC  + +C+V +H P C C        +   S      C  + DCP  K+C    C++PC  T  CG NA CSV         IC+C  G  G+P V C +
Sbjct: 20928 CLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLG---CRSDGECAANEACVNQQCVDPCGFTQ-CGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPC---NCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLAC--FGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQG--CTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQ----HRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQC----------YKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCI---TGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMA-CKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPR-IECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADD-CGIGAYCHVQQ----RKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPC----NCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIG---CRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLAC--IDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGAC-RKMMPPRLPGCESDQDCPDQEACIHAQCRNPCN----CGTNAVCQVTQ----HRAVCSCQD----GFEGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVI----------GCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPG-IKEVGGCISDSDCPTDKSCLNSVCRDPCN----CGLNAECRIKDHKPV----CTCRQGFEGNPEFECSKIE------CSINSDCPGTHVCRNQLCIPACQGEQ-CGSNAQCLAIEHRAVCECIPGHGGNARIACTPL---GCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDK 22412          

HSP 35 Score: 618.231 bits (1593), Expect = 9.947e-175
Identity = 1018/3985 (25.55%), Postives = 1445/3985 (36.26%), Query Frame = 0
Query: 1663 NACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDC---PSHAACKDRKC-----------INPCAESSPCASSARCKVINHEPECTCPDGFIG-SPTTD-CRPRD---------PYSFCRPYECLSDPECPDHLKCENEK---CVDPCECA-----RNADCDARNHRGICTCIPDFTGDPY---------------GIACE-------------------------PIPEPVIEEVE---------CKEDRDCPSQNACIN-EECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLAC--------RNGECLNPCIEND-------PCSNTAKCQVLNHNAKCICQIGYTG--DPYSQCVKIS-NSECKYDTDCASNEACINDQC---------------VDHCVVNLP-CGKDAECETIRHRSVCKCPKGLAGDP-----HVSCYSFECKKNEDCPFDKE-----CKSESCVDP------CIDT-----------QCGTLATCTVEYHKGICKCSSGYQGNPYLSCREV-QCRRN-SDCDSKEKC-NL------------------KTYKCTPL--CRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPAD------------KPECLVDSDXSRSEACIS-----DTCK-NPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQ-CITVQS-----QNECSIDNDCNQDDMCYEGTC-----------------VNACYVER----CGINAECIANFHRSKCSCYPGYLGDPKNACY---------QSPTEIEP---LLSPGCDVDRDCP------------SYTMCKNRLCINP---------CAEDSP--CAVTAICKVIQHKPVCTCPDGFIGSPSTNCQPPERPECRVDAECPLDRACIH-----------------QKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPCE---CARNADCKARNHRGYCTC----IPNFTGD---------------------------PYGIVCEPIPEPVIEEVECNEDRDCPSQNACINEECD-----------------------------NPCLMYKPCVLNAECK------VYDTLPLRTMTCTCIEGFTGKGDERCVKIEPII--ETGCRSDSECDRKLG------CRDGDCINPCI--------KDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQ--------RTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYCY----KYECKTDNDCPFDKACAK-----EKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNP---YVSCR--------EVECRNDNDCASNEKCDLRY---LKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIV--RRPDEPECRVDKDCPSDMACIS-----ARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTY--ESDGFECKEVELSTECQVNNDCQQFEICVDGT------CRKTCSINSCGANAVCTPVIHGFKCNCFDG-YTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTC--RNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTP-------------STDCRPINV----PECLL-------------------------DAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYI--------GSPHTVCEEQPVVD------------VGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGD--PHASCYKY--ECRISDDCPFDKTCLNEKCVDPC-DTTRCGSKAICKAEYHKGSCECPNG-LQG---NPYIFCKEVECRKDTDCASNEKCNLQNFRCLR-------LCSDNNNCA-----GFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDIC--QDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQV-------------------------ACYLPITPNEPSLVPG------CTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCS-SITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEE----------------------PGCKSDFECPNKQACINRECQNPCLFEN--------------------------------------------------CGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPC----ECARNADCDARNHRGICTCILDFTGDPY---------------------------------GIACEPIPEPVIEEVECNEDRDCPSQNACIN----EECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPII--------------------HTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGD--------PNSLHAHQGE------------CNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCYRYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPY-----INCKELECRKHQDCRD---------------------NEKCDMTTYKCTPLCTGSNKC------------------------------------------ASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVCYEGSCINACLIK-KCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLE---------PGCSYNDDCP-----SYNQCRNR-------------------------------------KCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTI-TCGRNAICQARNHRAICSCIKSFSGDPYTFCE--EPGCKSD--------------FECRDNQACINRECQ---------NPCLFEKCGLNAECNA-NGHRAICSCLQGH-KGDPYSFC---------------------KPYE---------CLSDPECPNHLKCKNEKCVDPCE----CARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVI--------EEVECNEDRDCPSQNACI-----NEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGK--GDERCV--KIEPVVDVGXRXXSECSPNLAXRXQNCVNPCI----NENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCK-CPQGQAGNPHAYCYKYE----CKTNQDCPLDKVC-TSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSV 4770
            N CK RPC V A CT    S  C+CF G+ GN    C       +P     C  N +C   P+H  CK +             ++ C     C  +A C        C+CPDG++G +P  + C+  D         P + C   E     +CP     +      CVD  ECA     RNADC   +    C C   ++GDP                G+  E                          +P+P+  +               R   +  AC++ +EC+ P  + K C  NA+C  +      +  C C  GF G+G   C  I    D  C  N+ C+ T+            G+    C++ D       PC   A C+       C C  GY G  DP   C ++  N  C  + DC +N  CI +QC               +D C  +   CG  A+C        C+C  G  G P        C    C  +  C  D+      C+     +P      C+D             CG  ATCT       C C  G+ G+P+  C +V +CR   S C +  +C N+                   + +C P+  C  N +C  +++C A    ++C CP P IG+    C  P +  +            + +CL     + + A        D C+ NPC  ++ C           YL     C+C  G+      + CIT ++      N C+    C QD       C                 V+ C V+R    CG+NA C       +C C  G+ G+P   C          QSP ++     +LS GC   + CP            SY  C       P         C E     CA  A C        C CP+G+ G          + +C  D EC  +  CI                   KC++PC R  CG NA C  ++    C C  G+ GDP     L GC  + EC +        C N     +C    +   + +++ C   SG          + +CL + DC ++L C+   CV PC    C  NA C+   H G+C C    + N  GD                           P G +  P P       +C+  R C  +  CIN  C                              NP L+  P +  A+C        +    L    C C  G  G   E C      +     C  ++EC R +G      C  G   NP I         + PC  +A C  R+    C C  G+AG+PYS C+ I +  C   N CQ           +C + QC   CS    CG  AIC+  N    C CP G+ GDPH   +    + +C  D DC   + C +      KC+D C    CG  A CV+E H+S+C CS G  GNP    V C+        E +C++D DC+    C        +C  LCS N +C  N  C+ IN     +C      + Y +   +    +P  P+C  D +CP   AC        +C   C     C  N +C  + +       C+C +G     +D   C+  +    C+ + +CQ+ E C+         CR  C    CG  AVC    H  +C C  G + GDP    Y P    + +    C  + DCP    C      C + C   S C  +AIC   +H+AVC C  GF G P             +  C P  +    PE  +                         DA+CP +  C    CQNPC    CG NA+C+V   + +C+C   +         G   T+ +    VD            + CR++ +CS   +C    C+  C++++ C +   C     E +C                   + C+ + +C  +++CI N+C++PC     CG NA C    H S C CP    G+  P   C +    C  S+ CP    C+  +C  PC  T  C     C  +  +  C   N  L G   N    C+   C  D DC   E C     +C          CSD + C        A CE      RC+CP    GDGYS      P+    +C    DC    ACI   C DPC +   C  N  C++     L    C CP G F+G          KVEC  + DC+ +  C  +   CI  C +  CG    C    H++ C C +GY     V                         +C  P       L  G      C SD DCP+  +C+N +C +PC     C   ANC+   H+A+CTCP    G PT +C   +  EC  + +C    AC+  KC +PCS    CG  A+C VQNH  +CSC  G  GD    C +                      P C ++ +C ++Q C+   CQ  C   +                                                  CG NAEC   +H   C C +G  GD  S C+  EC SD +C N   C+N  C   C     C  NA C   +H+ +C C   F+GDP                                  G+  +P  E     VEC  + DCP   AC       +C + C   + C  NAEC     +      C C  G+ G+  +R    +P+                        C  +TEC     C+   C +PCL+   CG  A+C ++NH   C CP GFTGD        P +     G             C+ D +C  N+ C+   C   C V+  C    +C+                  H+ C  Y C  ++DC   ++C ++KC++PC    CG  A C+V  H++SC C   +  NP      +    LECR+++DC +                     NE+C      C PLC   N+C                                           + A C+  +H+++C CP    G+    C +P        C  ++DCQS   C    C   C  +  CL  + C         T   +C +D        CE     + C  +  C + + C    C N C    +CG  A C  + H  QC+C   + G+  +GC +      P  E         P CS  +DC      +  +CRN+                                     KC DPC  +K C   A+C V  H  +C CPDG+ G P+  C    + EC +D DC+    C + KC+NPC     CG NA C+    +A CSC   F G+P + C   E GC S               +EC     CI    Q         N C  + CGLNA C+    ++A C C +    GD Y  C                     + YE         C SD +CP+   C    C DPC     C  NA C    HR  C+C     G P  I C+  P+ V         E++ C+ D +CP    C       + C+NP  +   C  N +C+     P+    C C  GF     G+  C   K E   D       +C+ N+A     C NPCI        C     C+V NH+  C C           C P S   C  D  C  +Q C   +C+DPC E +TC  ++ C  E+H+P+CK CP G   +    C K +    C +N DC     C +S KC+DPC T+  G      + +  +IC CP  L  N    C S 
Sbjct:  131 NECKQRPCDVFAHCTNTLGSFTCTCFPGYRGN-GFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAK-CGTNAKCINFPG----SYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDAT---KRCLCPEPNIGND---CRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEKAICS-----NTAGGYL-----CQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPECQCQSPYKLVGNSCVLS-GCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQ-CMCEAGFKGDP-----LLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGT--------PKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAEC-RAVGNHISCLCPQGFSGNPYIGCQDVDECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCS-QASCGPRAICDAGN----CICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCS-NVVCGPNELCK-INPAGHAIC---NCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFT-CPANSVCVARQHQ----GRCDCLNGFVGNPNDRNGCQPAQ-KHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDP----YDPFNGCQSVP---CVYNHDCPPSQMCNRMTHTCFDVCDEES-CGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKCPPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDN-ACGSNAECKVINRKPVCSCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNVCVVACLDHSQCASGLACV----EGHCT------------------IGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQP-GCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPR----QCHKPDDCANNLACIHGKCTDPCLHTV-CGINANCQSEGHEAL----CSCPAG-FLGDPNDTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKG-NCQVRDHKATCACYEGYQLVNDVCEDINECLSQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIEC---VHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSPLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVCAQLQ-CGPNAECVPKGHV----AQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVCL------------------HNKCV-YGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGV--CKPLCRHDNECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVP-----RIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCM------RGTCRTVCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKCRNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKEC---VQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRTLGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPE-IECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCTDPCNNPLFI---CESNKKCETRRHQPV----CICKSGFIVNEYGELTCAPDKRECYRD------DDCASNMACSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCIC--------MRDCQP-SISICLRDAGCPASQACRKLKCVDPC-EFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQAHQCGSSGKCIDPCLTSCAGGVKCVVSAHRVTICTCPATLTNNTDSNCTST 3951          

HSP 36 Score: 588.571 bits (1516), Expect = 9.925e-166
Identity = 990/3841 (25.77%), Postives = 1399/3841 (36.42%), Query Frame = 0
Query: 6074 NQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSY-ECKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGS-PYVTCKEIECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYS--FCTKKEESKKKPQCQIDGDCPQQMS-----CIDDRCQDP---------CQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKI-QIKTECKVDTDCARSDM------------CKDGNCVNACD-VVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDC------------PGHTACRNLKCINP---CAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDC---QLPIQPECTRDYECPDNKACIQQQCL---------NPCTSI--------ACGRNAECRVTKHRALCSCRSGYIGDPYTI-----CNEPGCKSDFECPQQQ-----ACLNRECQNPCH-----------------FEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPCKCARNADCEIKNHRGY-CTCQSDFTGDP-YGISCDPIPEPVLVEYECIEDKDCPSNQAC------------IDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPY-STCVPVNEKECQFDDECSSNQACV---------------------NNQCEDP-----CNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCY---NFECLSNDDCPFDKKCISEKCI-SPCLE-TICGNKAEC-TVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTDRDCPDSDVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSP-TTECQL---SPKPECIVDQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGDPYT--FCRPYECLVDRDCPDQLKCDHEKCVDPCQ---CAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHSYE-----------CLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPY---ISCKLL-DCHNDNDCKDDEKC---DRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIE-PPESIKPE----CQIDSDCSTNLACMNSV-----CQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGH------STGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNAC------HNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDG-YIGSPQTSCELPSEPECLVDDDCPSDLAC--IHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPY-------------------QICE----EPGCK----------------------SDIECPFDKACISRECQNPCLYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKP-------YECLYDPDCPDHL--------TCKNEK----------------CVDPCQCAKYAECDARNHRGIFPEPVEVEGCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKG--DEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHC----TCPPGMTGDPYSICVIIEDHECEQDSDCNGNKACVEYEC---------------IDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSF---CYEYECLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSP---FIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVC-------------------QP--------PLLGN-------GFVLCSLPVKTEEP-ECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLVVDSSPSKSVSCSCREGFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDACRI-RLCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCR----CPEGFEGDPSIECKPPTPLSIGCSADSDCPVVEACLN---------TKCVDPCNCGENALCRKINHKAVCFCPSGFSGNPEVLCEKLECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVS----------------------------------------KCRCPSDMNGDPYSLC--VDVECAINEDCNSERACYQD----KCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPF--VSCVEKEPSPIEVEKEC---------------VVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMC----RNPCNCGGGAKCFLSGHRPICQCPEG-FIGNPQIECN-PAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDP--YTGC---SIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPY----ESCTVIP-PPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCINAICRSPCA----CGLNADCKIIDHQPVC----TCKPGFYGDPEIECTDTVCQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNIVSCSDNSDCPTDKECINKLCTDSCSISNPCGSKSECKVKNHKVDCS----CALGFIGNKGTSCVKVSVTCEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECFPVKTCPANSGLILDNREECVCPTGFGFTENKDECI-PCLKENGFILNNEGKCVCNDARGYEYNPDSGKCECPPGERLNNFGICERVPDCEEDPDCPTQKYCEKTNGTCSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCI 9477
            ++C+DP  +   C +NAEC       +CKC+ G  G+    C    EC+  E+C                    G NA+C +      C CP G  G+ PY                +E C       V  C+ P +C   A C        C C P Y GDG S   C  ++E  + P C  + DC          C D    DP         C  N PC +G +C         S  C CPS  ++  +   +++ Q     ++      +D+            C D +  N  D V KCG N++C        C C  G+ G     C  I    E   NP C  +  C            P +T      C++     A+D+PC   A C+       C CP GY G P       Q+ +   C+ +++C +N  CI+ QC          + C  I         CG +A+C  T     C C +GY+G P  +     C +  C +   C   Q      C +    NP                   F  CG NA C+       C+C  G  GDP+S     +C+   +C T             KC   A+C      GY C C  +   DP   + C PI         C  ++DCP N  C            I  +C +PC     C   A C + +        C C  GYTG            +  GC   ++C  N                PC + + C       +C+C  G  GDPY   C+      C   + C++ + CV                     N QC+D            CG NA+C+       C CP+G  G+P   C      EC     C    K +   C+ S C     C + AEC ++    S C CP G Q  P           D  C++ +EC  R A+          C   A C     +  C CP  + GD  +    +                          Q  C  D  C++ +KC+       +   C C    +++ +                        D+  C   C +  CG  + C  S    +C C AG+ GDP                 GC  + +C             PCA    CV     K   ++  C CP  Y G P  + C     +PK +C+ + DC    AC+ G C SPCS+ +CG NA C    H   C C  GYV +                       + DC+  C    CG  A C P +    CKC +G  G+P+    C   +C   R C ++  C + +C + C+   C   A CD  N  G C C  ++ G+P  I   PI +     GC                            ENA C+      L    C C  G  G   E C         G  S   C                + + C   A+C    +  +C CP GF+G+PY  C  V        DEC+                N PC  NA C+ +     C C  G  G+P++ C   E           C    +CP   SCQ   C N CS+  CG  A C        C CP GY G P+     C +   C ND DC   E C    +    C   C S  +C   A C + DH   C CS    G+  ++ +   PE   PE    C+ D DCS    C  SV     C N C  N  C  N+ C +    P     C C + +      S+ +       T    C D+S CR  +V     C+  C  F C  N+VC +  H   C+CL  FVG+P+D         +P+    C    +C    AC          C   C    C   A C    H+  C C  G + G P           C+ + DCP    C  +  +C   C   +CG NA C  + HRA+C C  G+ GDP                     ICE     P CK                       D +CP +  C    CQNPC  + CG NAEC   + + +C C    +  P              +CL D DC   L         C+N +                C+D  QCA    C    H  I        GC+ +K+C   ++CI+ +C NPC S   C  NA C +          CSC EG+ G    ++ C  +  P    C     C +   C   +C  PC K   CA   RC     +  C     C  G   +    C       C+ D+DC   + C+  +C               ID C  ++PC  +A C+ +     C C  GT GD +S        +C + +DC  N AC+  KCTDPCL T CGI A C++E H  +C C  G  G P    + C +VEC    DC  +  CD  T +C   CD  + C +G +C  ++HK  C C                   QP         L G+       G +   L     +P EC  D DCP+  +C N +C++PC R+N C  +  C     + +    C+C          +C+ +    EC  + DC   + C    C+D C +   CG  A C  +NH   C+C    +G+ ++ C+ +           C+ D +C   + C +  C   C  N  C  +  C        C+    CP+      +I  K      + C +DS+C   E CL+         + C+    CG NA C   +H   C C  GF G+ +  C K+ECTSD+DCSNDK C  + C   C++  PC  N  C   +H                                          KC CP  + GDPY+      VEC  NEDC    AC +     KC D C     C PNA C    H + C C     G P   V+  +  PSP +V  +C               V+D++C +   C    C NPC     C  +A C + +        C C EG+     + C+ +    P  C  D EC     C + MC     N   C    KC        C+     F+G+  +      GC  D +C ++E+C    CVNPCL N PCG +A C+ + H A C C E    +P    GC     + C+ + +C N  AC    C   C  D      A C++ +   Q  CK   + D      E C  +   P C  D  C   ++C+ ++C +PC     C   A C  I+        C CP+G        CK   P I+ C RN+DC ++  C    C+  C     C  +  C     + VC     C  G     E     T C++D  C    AC N +C   C      CG  A+C  V H   C CPA   G+    C +     + DC  D+      C   CS +  C    +C     +  C     C +G +  +G +C+     C+ + DC + QSC+  +C +PC   + CG NA C+V +      M C C +GYEG+ S EC   + C  ++    D+ + C          ++ +C  PCL+      N + + V   A          +C CPP    + FG              PT + C    G CS+     PCG N+          C C+ G  GD + GC+
Sbjct:  170 DECQDP-AIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENC--------------------GPNALCTNTPGNYTCSCPDGYVGNNPY----------------REGCQD-----VDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTP-CGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGG----SFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENI---NECQDNP-CGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHS-----KCVDVDECRTGAS----------KCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPI-------VSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALN-CGAHAQCMLANG----QAQCLCAPGYTGNS---------ALAGGCNDIDECRAN----------------PCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPEC----QCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQP-----------DGSCVDVDECEERGAQL---------CAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALA-------------------------QRKCAADRECAANEKCI-------QPGECVCPPPYFLDPQ------------------------DNNKCKSPCERFPCGINAKCTPS-DPPQCMCEAGFKGDPLL---------------GCTDEDECSHL----------PCAYGAYCVN----KKGGYQ--CVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKN----------------------GDGDCVSQCQDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVCGIGATCDRNN--GKCICEPNFVGNPDLICMPPIEQAKCSPGCG---------------------------ENAHCEYG----LGQSRCACNPGTFGNPYEGC---------GAQSKNVC----------------QPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDV--------DECA----------------NKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQASCGPRAICDA----GNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDAC-SKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCS-NVVCGPNELCKIN---PAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRP-DVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDR-----NGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKCPPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPC-DNACGSNAECKVINRKPVCSCPL--RFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNVCVVACLDHSQCASGLAC-VEGHCTI--------GCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCSIDQ----HHSQCSCPEGFEGNPTPEQGCVRVPAP----CLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTC----QPGCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECT-EQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTS-CGKG-NCQVRDHKATCACYEGYQLVNDVCEDINECLSQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANC----QAQAHQAICTCPLNSRGDPTIECVHI----ECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQ---------YCQQDGQCAQGSICSHGICSPLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTK-----ELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVCAQLQ-CGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQN----HLKQCHCPEGFTGDSAKECVRV----PVAC--DGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVCLHNKCVYGCHVDDDCSASESCRNDKCVNPCLEN-PCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADD------AGCLTNERCQQGVCKPLCRHDNECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHR----KQCLCPEGLDGNANVACKV--PRIA-CGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRTVCNTDEACAQGQIC--ENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQ-CGQCADCLVVNHGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDEN--GAYCAPKCSRTEDCACGQQCARGKCRNKCGPKRQCTVGQLCERG-ACI---AGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTVSE----HRMLCYCPDGYEGEPSKECVQFE-CRVDTDC--DSNKRC----------DQGKCRNPCLEYGACGTNAQCRVVGRKA----------QCSCPP----DFFGN-------------PTSE-CRPLEGGCSS----KPCGENSKCTEVPGGYECACMDGCIGDAHQGCL 3544          

HSP 37 Score: 511.146 bits (1315), Expect = 2.110e-142
Identity = 864/3394 (25.46%), Postives = 1246/3394 (36.71%), Query Frame = 0
Query: 6472 NPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPCKCARNADCEIKNHRGYCTCQSDFTGD-PYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFA--GDPH---------TSCYNFECLSNDDCPFDKKCIS-------EKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTDRDCPDSDVCDDGTC---------------VDACRKNS--CGSYSTCLTSFHNSKCSCVAGYTGDP-YTACYFPVPQPEPSITPGCQSDQDCPSYNSCRNRLCINP------CAEDDICVI----------NANCKVINHEPVCSCPNGYIGSPTTECQLSPKPECIVDQDCPLTKACIIGKCESPCSANICGINALC-RANNHRATCVCVSGYVGDP--------YTVCEX----PG---CKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGDPYTFCRPYECLVDRDCPDQLKCDHEKCVDPCQCAKYANCDAKNHRGY-CNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCL-----TYRPCVENAKCKVYDTLPLR-----------------TMTCTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCV-NPCIEESPCTSTAKC-SVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHN---FCHSYECLSNKDCPLDKSC-----------------QNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLDCHNDNDCKDDEKCDRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGY-SVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDG----KCKKVT-------------------------PQP-------QCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCELPSEPECLVDDDCPSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEEPGCKSDIECPFDKACISRECQNPCLYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPD-----------CPDHLTCKNEKCVDPCQ---CAKYAECDARN---HRGIFPEPV-EVEGCQM------DKDCPSQEACID-----RECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDE-----KCELITEPIVVGCSNDRDCSTSLACRNT-----ECVNPCAKDRPCAQTARCEVN-RHKSHCTCPPGMTGDPY-SICVIIEDHECEQDSDCNGNKACVE-----YECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSF-----CYEYECLRDNDCPLNKACVSQK------CTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGS----PFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGF--VLCSLP---------------VKTEEPECR----------------------IDDDCPSKHACINRKCQNPCSRRNPCLPSETCLVVDSSPSKSVSCSCREGFY----VGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDACR-------IRLCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIE---CKPPTPLSIGCSADSDCPVVEACLNTKCVDPC----NCGENALCRKINHKAVCF----CPSGFSGNPEVLCEKLECTSDEDCSNDKMCHENTCANPCILLN--------------PCAINGECIPSNHVSKCRCPSDMNGDPYSL---CVDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLAC--LNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCNCGGGAKCFLSGHRPICQCPEGFIGNP-QIEC-NPAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAE-----QAICHVI-ESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCIN---------AICRSPCACGLNADCKIIDHQPVCTCKPGFYGDPEIECTDTVCQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNI------------------------------------------VSCSDNSDCPTDKECIN----KLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFIG---NKGTSCVKVSVTCEVDEDCPSKQSCIEK---------------------ECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECFPVKTCPANSGLILDNREECVCPTGFGFTENKDECIPCLKENGFILNNEGKCVCNDARGYEYNPDSGKCECPPGERLNN---FG-ICER---VPDCEEDPDCPTQKYCEKTNGTCSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGD--PNLGCI 9477
            N C    C   A C  T     C+C  GY G+             F C         ECQ+P    +C  NA C       +C C +G++GD    C                 + ++C +P  C  NA C        C+C   + G+ PY   C              +D D          EC  P +    C   A C   +     +  C C  GY G G  +         +GC   ++CA+                +PCG  + C   +    C C  GY GDP + C  V        DEC++N               N CG  A C        C CP GF    DPH         T    +   + D  P+ +   +       ++C  P     CG  A+C     +  C CPSG QG  Y+ C+ +            EC            ++N C ++AIC  T  + +CTC   + GD    C++I            ++C +              LD PC   Q  V  +T+P     C    +   + +  CE +   + C ++ DC ++  C +  C               +D CR ++  CG ++ CL +  +  C C AGY G P   AC  P           C+ DQ+  +Y  C +    NP      C + D C +          NA C        C+CP G+ G P ++C         VD D      C  G       A+ CG  A C        TC C    + DP           C      PG   C +   CL  +  I  DC  PC    CG +AQC   N +A C C  G+ G+           +   C D  +C    C +   C+  A        GY C C    +GDPY   C  I    V  GC     C + + C+        +      Y    EN +C+  D   ++                 +  C C +G++G     CE+   P       + +C +       +CV + C     C S A+C S+    + C CP G+   P   CV V        DEC       E +  Q+C      +  A C+ +     C CP G  GD +N        +C ++++C  ++ C                  N  C +PC +  CG NA+C+       C C  G++G P     LL C ++++C                  S+  CA GA C  +    +C C     GD Y S CI    + K +C  + DC++NLAC+   C +PC  +  C +N  C  E      +  C C  G+    DG    +C+ V                          P P       QC  +  C   ++C  G C   C    CG  A C    ++  C C PNFVG+P   C+       P   A C+                        C +NA C     +  C C+ G  G+P   C   S                     K  C  ++CG NA+C    +   C+C  G+ G+PY  C+      D++          EC N      CG+NA C+ ++    C C  GH GNPY  C+P E  +  D           CP+  +C+  +C + C    C   A CDA N     G   +P  +V GC +      D DC   E C       R+C + C   + C  NA C   +       +C C +G+ G         + E         C +D+DCS    C+ +     EC+N C+ +  C     C++N    + C C      +P  S C      +C  D++C    AC        +C+  C     C  N++C    H+  C C +G  G+P+         ++ C    +C  ++AC+  +      C   C T  CG +A C T  H+  C C  G        PF  C+ V C    DC  ++ C+  T+ CF +CD E+ C + A CLA++H+  C C P   G+    V C+                 V  E P C+                       D DCP+   C    CQNPC   N C  +  C V++  P     CSC   F       K+G    +    +C +  DC     C +G C  ACR          C  N   VA    S CA     SG   +AC+     +      GCRS+ EC     C  NKC++PC   + CG +A C ++ H   C CPEGFEG+P+ E    + P P    C A + CP    C+  +C  PC    +C     C +   + VC+    C +G   N +  C+   C SD DC   ++C    C      +               PC  +  C       +C CP    GD YS        +C   +DC +  AC   KC DPC L   C  NA C++  H + C C    +G+P  + V         + EC+   DC    AC    + C  PC  LT C     C V D        C C EG+                   + +D C     C+++ C +   C      +       CQCPEG IG+P Q  C +P  C SD +C ++ +C  + C +PC   + CG++A C    H A C C     GDP   C  I C  + +C  +KAC +  CIDPC   N C   A C  ++H   C C+ G  GD    C  +    C +DG C  G  C +  C   C   + C       Q +C    +S    P    C +     EL+           C  + +C    +C++         ++C    ACG NA+C    H P C CK GF+GD +  C    C SD++C    +C N  C   C     PCG  A C    HQ  C+C  G +G+P V C++                                          V C  N DCP    C        C D C+    CG  +EC  K H   C+C  G+ G   ++   C  +   C+V  DCP+   C +                      +C NPC+  + CG NA C + + +      C C EG+ GD++ EC  V        +  D   EC    G G+T     C+P    +    +NE KC+              K  C    R++N    G +C     V  C  D DC   + C   N  C NPC  NPCGPNA     +H   C C++    +  P +GC+
Sbjct:  131 NECKQRPCDVFAHCTNTLGSFTCTCFPGYRGN------------GFHCEDID-----ECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCT----------------DVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGC--------------QDVD----------ECSYPNV----CGPGAICTNLEG----SYRCDCPPGYDGDGRSE---------SGCVDQDECAR----------------TPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDV--------DECATN---------------NPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENIN-----------EC------------QDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDI------------DECTA--------------LDKPCG--QHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQN-EAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKC---------VDVD-----ECRTG-------ASKCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGN---------SALAGGCNDIDECRANPCAEKAICSNTAG-------GYLCQCPGGSSGDPYREGC--ITSKTV--GCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTP-------ECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDV--------DEC-------EERGAQLC------AFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCT-PSDPPQCMCEAGFKGDP-----LLGCTDEDEC------------------SHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCS-SLLCGSNAYCETEQ----HAGWCRCRVGYVKNGDGDCVSQCQDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVCGIGATCDR--NNGKCICEPNFVGNPDLICM------PPIEQAKCSPG----------------------CGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQS---------------------KNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQ------DVD----------ECAN----KPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKIQ-CGPNALCVSED----HRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCS-NVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFT-CPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEES-CGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKCPPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCD--NACGSNAECKVINRKPV----CSCPLRFQPISDTAKDGCARTIS---KCLTDVDCG-GALCYNGQCRIACRNSQDCSDGESCLKNVCVVACLDHSQCA-----SG---LACVEGHCTI------GCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAP----CLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQP-GCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPC-LHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGC------FKVECIDHVDCAGDRACDAETNRCIKPC-DLTSCG-KGNCQVRD----HKATCACYEGYQ------------------LVNDVCEDINECLSQPCHSTAFCNNLPGSYS------CQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQ--YCQQDGQCAQGSICSHGICSPLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELE-----------CRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQ-PCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVCAQLQ-CGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHL----KQCHCPEGFTGDSAKECVRVP-------VACDG--EC----GPGYTCRDSMCLPVCHNDLECASNE-KCL--------------KGSCMLTCRVDNDCFLGHVCLHNKCVYGCHVDDDCSASESCR--NDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCV 3067          

HSP 38 Score: 400.979 bits (1029), Expect = 2.989e-109
Identity = 451/1664 (27.10%), Postives = 673/1664 (40.44%), Query Frame = 0
Query:    1 MACTCIEGYEEPIIASGCQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGDAY-SNCSPINEDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCK-STKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVE-CRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYKHRETC----VCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISE-----KCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVGGTCLNSCRV-HPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPG--------------------------------CDSNQDCPTYSSCRNR----LCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSP---TTDCRPQP--------------------EPECRLDSDCSDHLACIGQQCLTPCSR-NTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFE-KCGENAECSPRNHRATCK----CNKGHKGNPYSYCNAYECLSDPECPDHLHCISEKCVDPC---KCAANAECDARNHRGYCACIIDFTGDPY-GIECTPIPEPVIEEVECVEDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDS--QSNCYEYECLRNSDCPFDKACVSEKCINPCKNT-LCGTRAECSVEYHKPICKCPKGLQGSPYIECK-------------------NVECKRHED---------------CGDQEKCNLISL-------------------------KCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVV------------------GIDGRCNRVQTSPECEIANDCKISDI---CV-SGSCIDACKVNPCGVNAICKSASHD-SRCSCPNGY-TGNPSHECYFVSPTSE--------------------PLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRPHP---------------------ECPDRLKC-ENEKCVDPCE-----CARNADCDARNHRGICTCIPDFTGDPYG-IACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLM----YKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCE-CSPGFTGDPYSLCSPTRE-DECKHDEDCPSNMVCADN-KCSNPCRSNSLCGNNAVCEVMNHS-PVCKCLENFAGDPHSSC 1440
              C C EGY+  ++   C+  +EC S                 PC   A C+      +C C  G  GD   + C   + +EC  D+DCP + +C   +C  PCER   CG  A C+ Q+H+ +C CP    GDP   C   EC  N+DC  EKAC++ KC+DPC     CG  A+CSV+ H  +C C  G  G   L C +++ C+ +  C   + C  ++  C  LC ++  C    +C     + TC     CP       + +C   + +  + EC  DS+C +   C+S+     KC++ C+    C    EC      P     C+C +         C +I    EC +++DC +   C    C  +C +  PCG NA C    H+  C C  G++G+P+  C  I      P  PG                                C++N+DCP +++C        C + CA+ + C   A C    H   C C +GY G P      C+P P                    +P C LD++C     C G QC  PC +   CG NA+C ++NH   C C  G+ GD    C       D EC    TC +  C   C  + +C  N +C   +   TC+    C  GH    ++ C  Y C  D +C     C ++KCV+PC    C  NA C   NHR  C+C+     +P   + C   P      +EC E++DC +  AC    C   C   + C+ N  C+     PL      C  G      E C+ +  +   GCRSD+ C   L+C  Q+C++PC   T CG +A C   +H+  C C  G  G+A   C ++ +  C  ++DC  N+ C +  C   C N Q C  +  C     R +C      A     ++   +  C  +  C  D+ACV++KC NPC+    CG  A+C V  H   C+CP    G     C+                     +C R ED               CG + +C +  L                         KC   C+    C  +A+C  S HR  C CP    G+    C +        EC VD DC     C   KC++PC     C  + +C+V      +   C CP D                     G + +C  V    EC   + C I D    C+  G  ++AC+  PCG+NA C    ++ + C CP  +  G+   +CY  +P  +                       T  C +D DCP+   C    C +PC     C   A C+ + H P C+CP+ +IG P   C+  P                     ECP+ L+C +  +C DPC      C  N  C+ R H+ +C C   F  + YG + C P      ++ EC  D DC S  AC + +C NPC++       C +N  C+V +  P+    C C+              +P + + C  ++ C  + AC   KC++PC     C+ ++ C  ++H+P C+ C  GF  D  + C   +    C  + DC     C  + KC +PC ++  C     C V  H   +C C      +  S+C
Sbjct: 2376 ATCACYEGYQ--LVNDVCEDINECLSQ----------------PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCR--DPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSIC--SHGICSPLCSTNRDCISEQLCLQGVCQGTCKSNSSCP------QFQFCSNNICT-KELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAP----DCLCKEGFFGDAKSGCRKI----ECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVCAQLQ-CGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVCL-HNKC-VYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSP-----PLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDNECGHG------ELCLGLNCV--PGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVAC-KVPRIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRTVCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKCRNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKECVQF-------ECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVG----RKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGC-IGDAHQGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRTLGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCTDPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAP------DKRECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPV----CICMR-----------DCQPSISI-CLRDAGCPASQACRKLKCVDPCEFAT-CAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQAHQCGSSGKCIDPCLTS--CAGGVKCVVSAHRVTICTCPATLTNNTDSNC 3948          

HSP 39 Score: 112.079 bits (279), Expect = 3.991e-22
Identity = 121/440 (27.50%), Postives = 177/440 (40.23%), Query Frame = 0
Query:   25 DSNQACRNRVCVNPCTNS---NPCGVLAECSV-RNHRTTCVCTIGF-TGDAYSNC---SPINE------------------------DECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCY----------------EFECKINNDCPFEKACVE-EKCVDPCKSTK--CGTNAKCSVEYHNAICKCPQGLQGSPY--LSCK--EVECRHNDDCPDNAKCNLNNFKCEELCI----SSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVC-VGGTCLNSCRVHPCGPNAQCIASSHRST-CSCSRGYTGNPQDSCQRIQVT 403
            D++Q C   +C  P  N+    PCG+ A C V  N++  C C   F  GDAY  C   +P  +                        ++C  D+DCP   +C++  C DPC     CG  A+C+T  H+P C CP    G P   C                 +  C  +++CP    C +  +C DPC +    C +N KC    H  +C C  G   + Y  L+C   + EC  +DDC  N  C+  + KC   CI     + +CA +  CE   H+  C+C           C+  +   L+     D+ CP   AC   KC +PC     C+    C V D  P   +   CP          C + +    C +N DC     C   G C++ C    C    +C+ S+HR T C+C    T N   +C    +T
Sbjct: 3538 DAHQGC---LCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRTLGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCTDPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMACS--DGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCIC--------MRDCQPSISICLR-----DAGCPASQACRKLKCVDPCEFAT-CAPNSPCIVEDHKP---ICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQAHQCGSSGKCIDPCLTS-CAGGVKCVVSAHRVTICTCPATLTNNTDSNCTSTDIT 3954          

HSP 40 Score: 64.3142 bits (155), Expect = 8.578e-8
Identity = 42/128 (32.81%), Postives = 60/128 (46.88%), Query Frame = 0
Query: 7741 VTPQPQCYDSSDCRSSEVCHTGTCITACLVFR----CGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPC-VNDPCVKNAKCRVIYHEPVCTCSDG 7863
              P P C    DC   + C  G CI+ C  F       +  +C++ +H+  C C  +   +  D  + A I        GC    +CPS  AC N LC+DPC  N+PC +N  CRV  H+P+C+   G
Sbjct: 8125 TVPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEI--------GCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHG 8244          

HSP 41 Score: 62.003 bits (149), Expect = 4.300e-7
Identity = 51/128 (39.84%), Postives = 59/128 (46.09%), Query Frame = 0
Query:  463 SPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPCS--RNTCGVN--AQCRVKNHRAICSC-LSGYVGDPY-SVCEEPGCRNDFECPDTQTCINRECQNPCLFEK-CGENAECSPRNHRATCKCNKGH 583
            SPTT     P P C+ D DC D   CIG QC++PC    N C V     CR  NH   C C     V  P  S+  E GC +  ECP  Q CIN  C +PC F   C  N +C   NH+  C    G 
Sbjct: 8122 SPTT----VPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHGR 8245          

HSP 42 Score: 62.003 bits (149), Expect = 4.793e-7
Identity = 50/128 (39.06%), Postives = 63/128 (49.22%), Query Frame = 0
Query: 7155 SPTTECQLSPKPECIVDQDCPLTKACIIGKCESPCS--ANICGINAL--CRANNHRATCVC-VSGYVGDPY-TVCEXPGCKSNLECLTTQACINKDCLDPCLFEQ-CGQNAQCNPRNHRAMCKCKEGH 7275
            SPTT     P P C  D DC   + CI G+C SPC    N+C +  L  CR  NH   C C     V  P  ++    GC S+ EC + QACIN  C+DPC F   C +N  C   NH+ +C  + G 
Sbjct: 8122 SPTT----VPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHGR 8245          

HSP 43 Score: 61.2326 bits (147), Expect = 7.781e-7
Identity = 38/118 (32.20%), Postives = 53/118 (44.92%), Query Frame = 0
Query: 5165 CLVDNDCLDHLRCTNTKCVDPC-------ACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEP---LKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPL 5272
            C  D DCLD   C   +C+ PC              C   NH   C C  D          D +  P   +K E  C +  +CPS++ C +  C +PC FN PC++N +CRV++  PL
Sbjct: 8131 CKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTD----------DDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPL 8238          

HSP 44 Score: 60.4622 bits (145), Expect = 1.284e-6
Identity = 40/122 (32.79%), Postives = 54/122 (44.26%), Query Frame = 0
Query: 5606 CTTNNDCRXTDVCLSGTCIDACKVFP----CGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDG 5723
            C T+ DC     C+ G CI  C+ F           C    H  +C C T    N R  C+        + EIGC+   +CP   AC N  C++PC  + PC+    C+V NH+P CS   G
Sbjct: 8131 CKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVN-RPDCS-------MKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHG 8244          

HSP 45 Score: 60.077 bits (144), Expect = 1.583e-6
Identity = 39/122 (31.97%), Postives = 60/122 (49.18%), Query Frame = 0
Query:  342 CENNNDCGDQDVCVGGTCLNSCRVHPCGPNAQ----CIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNG 459
            C+ + DC D+  C+GG C++ C         Q    C   +H + C C      N  D   + ++        GC S+ +CP+  +C N LC++PC  + PCS    CRV NHQP+C+  +G
Sbjct: 8131 CKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEI--------GCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHG 8244          

HSP 46 Score: 58.5362 bits (140), Expect = 5.403e-6
Identity = 52/158 (32.91%), Postives = 74/158 (46.84%), Query Frame = 0
Query: 7000 VFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTDRDCPDSDVCDDGTCVDACR--KNSCG--SYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITP--GCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNG 7151
            V D LPT TIS   +D+              +  C+TD DC D   C  G C+  C    N C   + + C T  H +KC C               V +P+ S+    GC S  +CPS  +C N LC++PC  ++ C  N +C+V NH+P+CS  +G
Sbjct: 8107 VSDNLPT-TISITVTDS---------PTTVPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDD----------VNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHG 8244          

HSP 47 Score: 56.9954 bits (136), Expect = 1.472e-5
Identity = 44/117 (37.61%), Postives = 59/117 (50.43%), Query Frame = 0
Query: 6451 PECTRDYECPDNKACIQQQCLNPC---TSIACGRNAE-CRVTKHRALCSCRSGY-IGDPY-TICNEPGCKSDFECPQQQACLNRECQNPCHFEK-CGVNAMCSPKNHRGICSCIEGH 6560
            P C  DY+C D + CI  QC++PC   T++   +N   CR   H   C C +   +  P  ++  E GC S  ECP QQAC+N  C +PC F   C  N  C   NH+ +CS   G 
Sbjct: 8129 PTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHGR 8245          

HSP 48 Score: 56.9954 bits (136), Expect = 1.574e-5
Identity = 44/156 (28.21%), Postives = 71/156 (45.51%), Query Frame = 0
Query: 1023 VFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECEIANDCKISDICVSGSCIDACK--VNPCGVN--AICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNG 1174
            V D  PT     +  + T V +          P C+   DC     C+ G CI  C+   N C V    IC++ +H ++C C      N   +C   +         GC + D+CP+   C N +C++PC  ++PC+   +C+V NH P+C+  +G
Sbjct: 8107 VSDNLPTTISITVTDSPTTVPV----------PTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVN-RPDCSMKAEI-------GCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHG 8244          

HSP 49 Score: 56.6102 bits (135), Expect = 2.056e-5
Identity = 36/109 (33.03%), Postives = 57/109 (52.29%), Query Frame = 0
Query: 8634 CTSDEDCSNDKMCHENTCANPC-ILLNPCAINGECI--PSNHVSKCRCPSD--MNGDPYSLCVDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSC 8737
            C +D DC +++ C    C +PC    N C +    I    NH +KC C +D  +N    S+  ++ CA +++C S++AC    C+DPC  +NPC+ N  C+   H   C
Sbjct: 8131 CKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLC 8239          

HSP 50 Score: 56.225 bits (134), Expect = 2.471e-5
Identity = 42/124 (33.87%), Postives = 54/124 (43.55%), Query Frame = 0
Query: 8439 PECRSHSDCRYNEQCQSGSCLDACR--IRLCGIN--AICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEG 8558
            P C++  DC   + C  G C+  C     LC +    IC   NH + C C      N      P   +  E    GC S  ECP+   C N  CVDPC  N+PC ++  C+V  H PLC    G
Sbjct: 8129 PTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVN-----RPDCSMKAEI---GCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHG 8244          

HSP 51 Score: 56.225 bits (134), Expect = 2.512e-5
Identity = 43/117 (36.75%), Postives = 54/117 (46.15%), Query Frame = 0
Query: 5043 PECRYDTECPDHLACIQQKCQNPCTSVT--CGLN--AVCRVQNHRAVCSC-LGGYVGDPY-KFCDEPGCKSDFECPNSQACYNKNCQDPCLFDE-CGQNAKCFANNHRSMCVCNEGH 5152
            P C+ D +C D   CI  +C +PC   T  C +    +CR  NH   C C     V  P      E GC S  ECP+ QAC N  C DPC F+  C +N  C   NH+ +C    G 
Sbjct: 8129 PTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHGR 8245          

HSP 52 Score: 56.225 bits (134), Expect = 2.555e-5
Identity = 34/115 (29.57%), Postives = 56/115 (48.70%), Query Frame = 0
Query: 9200 VTCNIVSCSDNSDCPTDKECINKLCTDSCS-ISNPCGSK--SECKVKNHKVDCSCALGFIGNKGTSCVKVSVTCEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPV 9311
             T  + +C  + DC  ++ CI   C   C   +N C  +  + C+  NH   C C      N+    +K  + C   ++CPS+Q+CI   C++PC +N PC  N  C V++  P+
Sbjct: 8124 TTVPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPL 8238          

HSP 53 Score: 55.4546 bits (132), Expect = 4.819e-5
Identity = 40/116 (34.48%), Postives = 52/116 (44.83%), Query Frame = 0
Query: 6710 CKSDNKCAQNLACVRGNCVNPC---INDSPCGDFSSCQTQNHKSVCKCSLGY-IGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKG 6821
            CK+D  C     C+ G C++PC    N     + + C+T NH + C C     +  P   C    E  C   DEC S QAC+N  C DPC   N C  N  C   NH+ +C    G
Sbjct: 8131 CKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVNRP--DCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHG 8244          

HSP 54 Score: 55.0694 bits (131), Expect = 5.152e-5
Identity = 45/118 (38.14%), Postives = 58/118 (49.15%), Query Frame = 0
Query: 3614 VPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQ----CRVQNHRAICSC-FGGYVGDPYTACE-EPGCKSDFECPNKQACINRECQNPCLFEN-CGINAECSPENHRAVCACLKGH 3724
            VP C +D +C D   CI  +C +PC   T     Q    CR  NH   C C     V  P  + + E GC S  ECP++QACIN  C +PC F N C  N +C   NH+ +C+   G 
Sbjct: 8128 VPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHGR 8245          

HSP 55 Score: 54.299 bits (129), Expect = 9.640e-5
Identity = 38/122 (31.15%), Postives = 54/122 (44.26%), Query Frame = 0
Query: 6319 CKVDTDCARSDMCKDGNCVNACDVVK----CGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDG 6436
            CK D DC     C  G C++ C+           + C+   H   C C      D   + N      +A I  GC+  D+CP   AC N  C++PC  + PC+   DC+V +HQ LC+   G
Sbjct: 8131 CKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYC------DTDDDVNRPDCSMKAEI--GCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHG 8244          

HSP 56 Score: 54.299 bits (129), Expect = 1.031e-4
Identity = 41/118 (34.75%), Postives = 57/118 (48.31%), Query Frame = 0
Query: 6387 PGCSHDDDCPGHTACRNLKCINPCA-MDEPCAI--TADCKVVHHQSLCTC-PDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPCT-SIACGRNAECRVTKHRALCSCRSG 6499
            P C  D DC     C   +CI+PC      C +     C+ ++H + C C  D  +  P  DC +  +  C    ECP  +ACI   C++PCT +  C RN +CRV  H+ LCS   G
Sbjct: 8129 PTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVNRP--DCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHG 8244          

HSP 57 Score: 53.5286 bits (127), Expect = 1.526e-4
Identity = 48/164 (29.27%), Postives = 69/164 (42.07%), Query Frame = 0
Query: 7329 IADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTM--TCTCF-EGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACT-----------CPIGFNGDPYS 7478
            ++D       I     P  V    C++D DCL +Q CI  +C +PC  +        C V +    RT+  T  C+ +         C +  E   +GC S  EC +  AC N  CV+PC   +PC+    C V NH+  C+           CP G N DP +
Sbjct: 8107 VSDNLPTTISITVTDSPTTVPVPTCKTDYDCLDEQTCIGGQCISPCEYF-----TNLCTVQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAE---IGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHGRTPGCEHCPPGANCDPTT 8262          

HSP 58 Score: 53.5286 bits (127), Expect = 1.632e-4
Identity = 35/111 (31.53%), Postives = 53/111 (47.75%), Query Frame = 0
Query: 3159 CRSNSECSPTLACKNGECINPC-IENNPCGTS--AQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCK 3266
            C+++ +C     C  G+CI+PC    N C       C+   H   C C    + +   +C+   ++ C    +C S +ACIN  C+DPCT N PC  N +C   NH+  C 
Sbjct: 8131 CKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVN-RPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCS 8240          

HSP 59 Score: 53.5286 bits (127), Expect = 1.659e-4
Identity = 45/143 (31.47%), Postives = 64/143 (44.76%), Query Frame = 0
Query: 6501 IGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHF--EKCGVN--AMCSPKNHRGICSC-IEGHKGDPY-SFCKPYECLIDSDCPTNLQCNNEKCVDPCK----CARNADCEIKNHRGYCTCQSDFTGD----PYGISCDPI 6629
            + D  T    P CK+D++C  +Q C+  +C +PC +    C V    +C   NH   C C  +     P  S      C    +CP+   C N  CVDPC     C+RN DC + NH+  C+ +   T      P G +CDP 
Sbjct: 8119 VTDSPTTVPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHGRTPGCEHCPPGANCDPT 8261          

HSP 60 Score: 53.1434 bits (126), Expect = 1.896e-4
Identity = 41/121 (33.88%), Postives = 53/121 (43.80%), Query Frame = 0
Query: 1249 CNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCECSPGFT 1369
            C  D DC  +  CI  +C +PC  +          +  TL   T  C C         +  +K E    +GC S+ EC    AC N  C++PC  NNPCS +  CR  NHQP C    G T
Sbjct: 8131 CKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTL-NHTTKCYCDTDDDVNRPDCSMKAE----IGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHGRT 8246          

HSP 61 Score: 53.1434 bits (126), Expect = 1.944e-4
Identity = 46/157 (29.30%), Postives = 67/157 (42.68%), Query Frame = 0
Query: 4879 DTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCV-------DACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDG 5028
            D LP      V  S TT+ +          P C+ D DC     C  G C+       + C++ N  +   C T  H + C C +    N R  C +           GC++  +CPS  +C N LC+DPC  + PC+    CRV NH+ +C+   G
Sbjct: 8109 DNLPTTISITVTDSPTTVPV----------PTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTI---CRTLNHTTKCYCDTDDDVN-RPDCSM-------KAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHG 8244          

HSP 62 Score: 53.1434 bits (126), Expect = 2.096e-4
Identity = 37/117 (31.62%), Postives = 57/117 (48.72%), Query Frame = 0
Query: 1921 CRSNSECSPTLACRNGECLNPC-IENDPCS--NTAKCQVLNHNAKCICQIGYTGDPYSQ--CVKISNSECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIRHRSVCKCPKG 2032
            C+++ +C     C  G+C++PC    + C+  N   C+ LNH  KC C    T D  ++  C   +   C    +C S +ACIN  CVD C  N PC ++ +C    H+ +C    G
Sbjct: 8131 CKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCD---TDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHG 8244          

HSP 63 Score: 52.7582 bits (125), Expect = 2.540e-4
Identity = 44/139 (31.65%), Postives = 62/139 (44.60%), Query Frame = 0
Query: 9008 ESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVL-KPCAEQ--AICHVIESLPVKPMTCEC--------PDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCINAICRSPCA----CGLNADCKIIDHQPVCTCKPG 9131
            +S T +P P C  D DC     CI  +C +PCE     C  Q   IC  +         C C        PD  +K E+           GC  +D+C +  +CINA+C  PC     C  N DC++ +HQP+C+ + G
Sbjct: 8121 DSPTTVPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHT----TKCYCDTDDDVNRPDCSMKAEI-----------GCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHG 8244          

HSP 64 Score: 52.7582 bits (125), Expect = 2.928e-4
Identity = 40/112 (35.71%), Postives = 53/112 (47.32%), Query Frame = 0
Query: 5738 PECTKDSECANHLACIQQKCQDPCA--SPICGIN--ARCRVKRHRAICVC-LENYIGDPY-SVCKEAGCRSDYECPSDKACINRECQDPCLLEQ-CGENAECLVNNHEARCK 5842
            P C  D +C +   CI  +C  PC   + +C +     CR   H   C C  ++ +  P  S+  E GC S  ECPS +ACIN  C DPC     C  N +C V NH+  C 
Sbjct: 8129 PTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCS 8240          

HSP 65 Score: 52.7582 bits (125), Expect = 3.156e-4
Identity = 43/142 (30.28%), Postives = 59/142 (41.55%), Query Frame = 0
Query: 3089 INVPECLLDAECPDHLACINRKCQNPCSTL----TCGDNAQCRVQRHRAICTC-LSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCI-----------CPAGYNGDPYSN 3214
            + VP C  D +C D   CI  +C +PC       T  +   CR   H   C C     +  P    +     ++GC S+ EC    AC N  C++PC  NNPC  +  C+V  H+  C            CP G N DP + 
Sbjct: 8126 VPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVNRPDCSMK----AEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHGRTPGCEHCPPGANCDPTTG 8263          

HSP 66 Score: 52.7582 bits (125), Expect = 3.183e-4
Identity = 44/134 (32.84%), Postives = 59/134 (44.03%), Query Frame = 0
Query: 7421 VVGCTSDKECSTSLACDNGNCVNPC-IEESPCT--STAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICK-----------CPPGTIGDP 7540
            V  C +D +C     C  G C++PC    + CT  +   C   NH   C C    + +    C    +  C+  DEC   Q+CI   C+  C  NNPCSRN  C + NH+P+C            CPPG   DP
Sbjct: 8128 VPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVN-RPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHGRTPGCEHCPPGANCDP 8260          

HSP 67 Score: 52.373 bits (124), Expect = 3.578e-4
Identity = 41/114 (35.96%), Postives = 49/114 (42.98%), Query Frame = 0
Query: 4651 CNYDGDCSDNQVCINNQCIDPCKEKS---TCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYE--CKTNQDCPLDKVCTSEKCVDPCD-TTQCGLKALCRTEYHQSICECPQG 4758
            C  D DC D Q CI  QCI PC+  +   T     ICRT NH   C C      N      K E  C ++ +CP  + C +  CVDPC     C     CR   HQ +C    G
Sbjct: 8131 CKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHG 8244          

HSP 68 Score: 52.373 bits (124), Expect = 3.699e-4
Identity = 39/115 (33.91%), Postives = 53/115 (46.09%), Query Frame = 0
Query:   18 CQSDDECDSNQACRNRVCVNPCTN-SNPCGV--LAECSVRNHRTTCVCTIGFTGDAYSNCSPINEDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEG 129
            C++D +C   Q C    C++PC   +N C V  L  C   NH T C C      +   +CS   E  C    +CP   AC+   C+DPC  N PC     CR  +H+P+C    G
Sbjct: 8131 CKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVN-RPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHG 8244          

HSP 69 Score: 51.9878 bits (123), Expect = 4.873e-4
Identity = 40/113 (35.40%), Postives = 54/113 (47.79%), Query Frame = 0
Query: 1320 CRSNSECDRNLACDNGKCINPCRN-NNPCSSS--AICRTQNHQPTCECSPGFTGDPYSL--CSPTREDECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPVCK 1427
            C+++ +C     C  G+CI+PC    N C+     ICRT NH   C C    T D  +   CS   E  C   ++CPS   C +  C +PC  N+ C  N  C V NH P+C 
Sbjct: 8131 CKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCD---TDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCS 8240          

HSP 70 Score: 51.9878 bits (123), Expect = 5.039e-4
Identity = 37/109 (33.94%), Postives = 57/109 (52.29%), Query Frame = 0
Query: 5487 CRRNNDCNFDEKCDLNSFKCIRLCSQ-SNICAIN--AFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRI 5592
            C+ + DC  ++ C     +CI  C   +N+C +     C ++NH  KC C TD   D  +  D  + +     C    +CP +QACIN  C +PC  NNPCS +++CR+
Sbjct: 8131 CKTDYDCLDEQTCI--GGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTD---DDVNRPDCSMKA--EIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRV 8232          
BLAST of EMLSAG00000008211 vs. GO
Match: - (symbol:fbn-1 species:6239 "Caenorhabditis elegans" [GO:0002119 "nematode larval development" evidence=IMP] [GO:0018996 "molting cycle, collagen and cuticulin-based cuticle" evidence=IMP] [GO:0040011 "locomotion" evidence=IMP] [GO:0000003 "reproduction" evidence=IMP] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR018097 Pfam:PF07645 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 GO:GO:0005509 InterPro:IPR013032 PROSITE:PS00022 PROSITE:PS01186 eggNOG:NOG12793 PROSITE:PS00010 InterPro:IPR009030 SUPFAM:SSF57184 Pfam:PF12661 InterPro:IPR024731 Pfam:PF12947 InterPro:IPR001507 SMART:SM00241 PROSITE:PS51034 Gene3D:2.40.155.10 InterPro:IPR023413 GeneTree:ENSGT00740000114996 EMBL:FO080623 EMBL:FO081701 RefSeq:NP_498670.2 UniGene:Cel.39280 IntAct:Q23587 MINT:MINT-3386706 STRING:6239.ZK783.1 PaxDb:Q23587 PRIDE:Q23587 EnsemblMetazoa:ZK783.1e GeneID:176076 KEGG:cel:CELE_ZK783.1 UCSC:ZK783.1 CTD:176076 WormBase:ZK783.1e HOGENOM:HOG000214265 InParanoid:Q23587 OMA:IGSFKCV OrthoDB:EOG7TMZQW ArrayExpress:Q23587 Uniprot:Q23587)

HSP 1 Score: 147.517 bits (371), Expect = 6.224e-33
Identity = 119/404 (29.46%), Postives = 195/404 (48.27%), Query Frame = 0
Query: 9439 SNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIPPVKTDFPRPEMVVNCLSDGVLVNVDLKDGGNFRGVMYVKGHSKDSNCIKHIDSG-GSLKPIDFQVSFGKCG--LFHSQGEANFVLVVQKHPKLETYKAQAYRIKCLYDVGETNINVNFNVSMITTAGTV--RNDGPPPNCTMKICNENGEDISSANVGEKLMLKVIVSPREIYGGLARSCIARSLDDSKFEEEYAVTDANGCATDPEIFQEWKLDRNTGYLTALFDAFKFPDSINLKFKCIVRICFGQCQPQNCGGRNAFGRRRKRESSHIIDGKVYTGQLREETDVYSNAIETLESSPQNEPFNSATLGSGLESEGDEEVCVSKIGFIISLVITALLALVAVAIAVSCWLMAYRKRPKS 9837
            S+ C R     N FG    H+C C    G+ GD  + C+P +         + ++ V C +DG+ + V   +  +F G ++VKG +++  C K   S   S KP  F+V F  C   L  +   A+ V VVQKH    T KA +Y ++C Y +G   +  + NVS + T  T+  +N    P C + + N+    ISSA VG+ L L + V+P E +G L R+C A +++     E Y +TD  GCA D  +F +W     +  + A+F  FK+PDS  ++F+C    C GQC    C     F  RR + +S +++ ++   ++   + V S A+ ++ +   +   N++       S  D     SK   I   +   L+AL + A+  +  L    K+PK+
Sbjct: 2300 SHKCDRVATCRNTFGS---HVCTCP--DGHVGD-GITCVPHV--------NQGKLSVYCEADGMTL-VLGNETADFEGKIFVKGQAENPYCSKSFSSLLNSRKPYVFKVVFQHCDVQLLDNHTMASTV-VVQKHAMFLTNKADSYDLRCQYPIGSRAVESHVNVSELATTSTLTEKNSTLAPICRLSVSNDQHSSISSAMVGDTLKLALEVTPSENFGILPRNCFAINIESG---ERYTLTDDMGCAIDESLFPQWSA-ATSSKVQAVFRTFKWPDSSMIRFQCDCNPCVGQCSTPTCISSARF--RRHQTTSPVVNDEIRQ-EMVLMSGVESLAVSSIINVHDSHDMNTSDDDDVTSSHVDATSKESK--SICVKMAPLLIALGSFAVCSAILLYLCSKKPKT 2678          
BLAST of EMLSAG00000008211 vs. GO
Match: - (symbol:fbn-1 "Protein FBN-1, isoform e" species:6239 "Caenorhabditis elegans" [GO:0005509 "calcium ion binding" evidence=IEA] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR018097 Pfam:PF07645 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 GO:GO:0005509 InterPro:IPR013032 PROSITE:PS00022 PROSITE:PS01186 eggNOG:NOG12793 PROSITE:PS00010 InterPro:IPR009030 SUPFAM:SSF57184 Pfam:PF12661 InterPro:IPR024731 Pfam:PF12947 InterPro:IPR001507 SMART:SM00241 PROSITE:PS51034 Gene3D:2.40.155.10 InterPro:IPR023413 GeneTree:ENSGT00740000114996 EMBL:FO080623 EMBL:FO081701 RefSeq:NP_498670.2 UniGene:Cel.39280 IntAct:Q23587 MINT:MINT-3386706 STRING:6239.ZK783.1 PaxDb:Q23587 PRIDE:Q23587 EnsemblMetazoa:ZK783.1e GeneID:176076 KEGG:cel:CELE_ZK783.1 UCSC:ZK783.1 CTD:176076 WormBase:ZK783.1e HOGENOM:HOG000214265 InParanoid:Q23587 OMA:IGSFKCV OrthoDB:EOG7TMZQW ArrayExpress:Q23587 Uniprot:Q23587)

HSP 1 Score: 147.517 bits (371), Expect = 6.224e-33
Identity = 119/404 (29.46%), Postives = 195/404 (48.27%), Query Frame = 0
Query: 9439 SNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIPPVKTDFPRPEMVVNCLSDGVLVNVDLKDGGNFRGVMYVKGHSKDSNCIKHIDSG-GSLKPIDFQVSFGKCG--LFHSQGEANFVLVVQKHPKLETYKAQAYRIKCLYDVGETNINVNFNVSMITTAGTV--RNDGPPPNCTMKICNENGEDISSANVGEKLMLKVIVSPREIYGGLARSCIARSLDDSKFEEEYAVTDANGCATDPEIFQEWKLDRNTGYLTALFDAFKFPDSINLKFKCIVRICFGQCQPQNCGGRNAFGRRRKRESSHIIDGKVYTGQLREETDVYSNAIETLESSPQNEPFNSATLGSGLESEGDEEVCVSKIGFIISLVITALLALVAVAIAVSCWLMAYRKRPKS 9837
            S+ C R     N FG    H+C C    G+ GD  + C+P +         + ++ V C +DG+ + V   +  +F G ++VKG +++  C K   S   S KP  F+V F  C   L  +   A+ V VVQKH    T KA +Y ++C Y +G   +  + NVS + T  T+  +N    P C + + N+    ISSA VG+ L L + V+P E +G L R+C A +++     E Y +TD  GCA D  +F +W     +  + A+F  FK+PDS  ++F+C    C GQC    C     F  RR + +S +++ ++   ++   + V S A+ ++ +   +   N++       S  D     SK   I   +   L+AL + A+  +  L    K+PK+
Sbjct: 2300 SHKCDRVATCRNTFGS---HVCTCP--DGHVGD-GITCVPHV--------NQGKLSVYCEADGMTL-VLGNETADFEGKIFVKGQAENPYCSKSFSSLLNSRKPYVFKVVFQHCDVQLLDNHTMASTV-VVQKHAMFLTNKADSYDLRCQYPIGSRAVESHVNVSELATTSTLTEKNSTLAPICRLSVSNDQHSSISSAMVGDTLKLALEVTPSENFGILPRNCFAINIESG---ERYTLTDDMGCAIDESLFPQWSA-ATSSKVQAVFRTFKWPDSSMIRFQCDCNPCVGQCSTPTCISSARF--RRHQTTSPVVNDEIRQ-EMVLMSGVESLAVSSIINVHDSHDMNTSDDDDVTSSHVDATSKESK--SICVKMAPLLIALGSFAVCSAILLYLCSKKPKT 2678          
BLAST of EMLSAG00000008211 vs. GO
Match: - (symbol:fbn-1 "Protein FBN-1, isoform g" species:6239 "Caenorhabditis elegans" [GO:0005509 "calcium ion binding" evidence=IEA] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR018097 Pfam:PF07645 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 GO:GO:0005509 InterPro:IPR013032 PROSITE:PS00022 PROSITE:PS01186 PROSITE:PS00010 InterPro:IPR009030 SUPFAM:SSF57184 Pfam:PF12661 InterPro:IPR024731 Pfam:PF12947 InterPro:IPR001507 SMART:SM00241 PROSITE:PS51034 Gene3D:2.40.155.10 InterPro:IPR023413 GeneTree:ENSGT00740000114996 EMBL:FO080623 EMBL:FO081701 RefSeq:NP_001263716.1 EnsemblMetazoa:ZK783.1g WormBase:ZK783.1g ArrayExpress:I7J4C9 Uniprot:I7J4C9)

HSP 1 Score: 147.517 bits (371), Expect = 6.411e-33
Identity = 119/404 (29.46%), Postives = 195/404 (48.27%), Query Frame = 0
Query: 9439 SNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIPPVKTDFPRPEMVVNCLSDGVLVNVDLKDGGNFRGVMYVKGHSKDSNCIKHIDSG-GSLKPIDFQVSFGKCG--LFHSQGEANFVLVVQKHPKLETYKAQAYRIKCLYDVGETNINVNFNVSMITTAGTV--RNDGPPPNCTMKICNENGEDISSANVGEKLMLKVIVSPREIYGGLARSCIARSLDDSKFEEEYAVTDANGCATDPEIFQEWKLDRNTGYLTALFDAFKFPDSINLKFKCIVRICFGQCQPQNCGGRNAFGRRRKRESSHIIDGKVYTGQLREETDVYSNAIETLESSPQNEPFNSATLGSGLESEGDEEVCVSKIGFIISLVITALLALVAVAIAVSCWLMAYRKRPKS 9837
            S+ C R     N FG    H+C C    G+ GD  + C+P +         + ++ V C +DG+ + V   +  +F G ++VKG +++  C K   S   S KP  F+V F  C   L  +   A+ V VVQKH    T KA +Y ++C Y +G   +  + NVS + T  T+  +N    P C + + N+    ISSA VG+ L L + V+P E +G L R+C A +++     E Y +TD  GCA D  +F +W     +  + A+F  FK+PDS  ++F+C    C GQC    C     F  RR + +S +++ ++   ++   + V S A+ ++ +   +   N++       S  D     SK   I   +   L+AL + A+  +  L    K+PK+
Sbjct: 2269 SHKCDRVATCRNTFGS---HVCTCP--DGHVGD-GITCVPHV--------NQGKLSVYCEADGMTL-VLGNETADFEGKIFVKGQAENPYCSKSFSSLLNSRKPYVFKVVFQHCDVQLLDNHTMASTV-VVQKHAMFLTNKADSYDLRCQYPIGSRAVESHVNVSELATTSTLTEKNSTLAPICRLSVSNDQHSSISSAMVGDTLKLALEVTPSENFGILPRNCFAINIESG---ERYTLTDDMGCAIDESLFPQWSA-ATSSKVQAVFRTFKWPDSSMIRFQCDCNPCVGQCSTPTCISSARF--RRHQTTSPVVNDEIRQ-EMVLMSGVESLAVSSIINVHDSHDMNTSDDDDVTSSHVDATSKESK--SICVKMAPLLIALGSFAVCSAILLYLCSKKPKT 2647          
BLAST of EMLSAG00000008211 vs. GO
Match: - (symbol:fbn-1 "Protein FBN-1, isoform d" species:6239 "Caenorhabditis elegans" [GO:0005509 "calcium ion binding" evidence=IEA] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR018097 Pfam:PF07645 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 GO:GO:0005509 InterPro:IPR013032 PROSITE:PS00022 PROSITE:PS01186 PROSITE:PS00010 InterPro:IPR009030 SUPFAM:SSF57184 Pfam:PF12661 InterPro:IPR024731 Pfam:PF12947 InterPro:IPR001507 SMART:SM00241 PROSITE:PS51034 Gene3D:2.40.155.10 InterPro:IPR023413 GeneTree:ENSGT00740000114996 EMBL:FO080623 EMBL:FO081701 RefSeq:NP_001263714.1 ProteinModelPortal:I7K4J2 SMR:I7K4J2 EnsemblMetazoa:ZK783.1d WormBase:ZK783.1d ArrayExpress:I7K4J2 Uniprot:I7K4J2)

HSP 1 Score: 147.517 bits (371), Expect = 6.474e-33
Identity = 119/404 (29.46%), Postives = 195/404 (48.27%), Query Frame = 0
Query: 9439 SNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIPPVKTDFPRPEMVVNCLSDGVLVNVDLKDGGNFRGVMYVKGHSKDSNCIKHIDSG-GSLKPIDFQVSFGKCG--LFHSQGEANFVLVVQKHPKLETYKAQAYRIKCLYDVGETNINVNFNVSMITTAGTV--RNDGPPPNCTMKICNENGEDISSANVGEKLMLKVIVSPREIYGGLARSCIARSLDDSKFEEEYAVTDANGCATDPEIFQEWKLDRNTGYLTALFDAFKFPDSINLKFKCIVRICFGQCQPQNCGGRNAFGRRRKRESSHIIDGKVYTGQLREETDVYSNAIETLESSPQNEPFNSATLGSGLESEGDEEVCVSKIGFIISLVITALLALVAVAIAVSCWLMAYRKRPKS 9837
            S+ C R     N FG    H+C C    G+ GD  + C+P +         + ++ V C +DG+ + V   +  +F G ++VKG +++  C K   S   S KP  F+V F  C   L  +   A+ V VVQKH    T KA +Y ++C Y +G   +  + NVS + T  T+  +N    P C + + N+    ISSA VG+ L L + V+P E +G L R+C A +++     E Y +TD  GCA D  +F +W     +  + A+F  FK+PDS  ++F+C    C GQC    C     F  RR + +S +++ ++   ++   + V S A+ ++ +   +   N++       S  D     SK   I   +   L+AL + A+  +  L    K+PK+
Sbjct: 2347 SHKCDRVATCRNTFGS---HVCTCP--DGHVGD-GITCVPHV--------NQGKLSVYCEADGMTL-VLGNETADFEGKIFVKGQAENPYCSKSFSSLLNSRKPYVFKVVFQHCDVQLLDNHTMASTV-VVQKHAMFLTNKADSYDLRCQYPIGSRAVESHVNVSELATTSTLTEKNSTLAPICRLSVSNDQHSSISSAMVGDTLKLALEVTPSENFGILPRNCFAINIESG---ERYTLTDDMGCAIDESLFPQWSA-ATSSKVQAVFRTFKWPDSSMIRFQCDCNPCVGQCSTPTCISSARF--RRHQTTSPVVNDEIRQ-EMVLMSGVESLAVSSIINVHDSHDMNTSDDDDVTSSHVDATSKESK--SICVKMAPLLIALGSFAVCSAILLYLCSKKPKT 2725          
BLAST of EMLSAG00000008211 vs. GO
Match: - (symbol:fbn-1 "Protein FBN-1, isoform h" species:6239 "Caenorhabditis elegans" [GO:0005509 "calcium ion binding" evidence=IEA] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR018097 Pfam:PF07645 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 GO:GO:0005509 InterPro:IPR013032 PROSITE:PS00022 PROSITE:PS01186 PROSITE:PS00010 InterPro:IPR009030 SUPFAM:SSF57184 Pfam:PF12661 InterPro:IPR024731 Pfam:PF12947 InterPro:IPR001507 SMART:SM00241 PROSITE:PS51034 Gene3D:2.40.155.10 InterPro:IPR023413 GeneTree:ENSGT00740000114996 EMBL:FO080623 EMBL:FO081701 RefSeq:NP_001263717.1 ProteinModelPortal:I7LHV9 SMR:I7LHV9 EnsemblMetazoa:ZK783.1h WormBase:ZK783.1h ArrayExpress:I7LHV9 Uniprot:I7LHV9)

HSP 1 Score: 147.517 bits (371), Expect = 6.877e-33
Identity = 119/404 (29.46%), Postives = 195/404 (48.27%), Query Frame = 0
Query: 9439 SNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIPPVKTDFPRPEMVVNCLSDGVLVNVDLKDGGNFRGVMYVKGHSKDSNCIKHIDSG-GSLKPIDFQVSFGKCG--LFHSQGEANFVLVVQKHPKLETYKAQAYRIKCLYDVGETNINVNFNVSMITTAGTV--RNDGPPPNCTMKICNENGEDISSANVGEKLMLKVIVSPREIYGGLARSCIARSLDDSKFEEEYAVTDANGCATDPEIFQEWKLDRNTGYLTALFDAFKFPDSINLKFKCIVRICFGQCQPQNCGGRNAFGRRRKRESSHIIDGKVYTGQLREETDVYSNAIETLESSPQNEPFNSATLGSGLESEGDEEVCVSKIGFIISLVITALLALVAVAIAVSCWLMAYRKRPKS 9837
            S+ C R     N FG    H+C C    G+ GD  + C+P +         + ++ V C +DG+ + V   +  +F G ++VKG +++  C K   S   S KP  F+V F  C   L  +   A+ V VVQKH    T KA +Y ++C Y +G   +  + NVS + T  T+  +N    P C + + N+    ISSA VG+ L L + V+P E +G L R+C A +++     E Y +TD  GCA D  +F +W     +  + A+F  FK+PDS  ++F+C    C GQC    C     F  RR + +S +++ ++   ++   + V S A+ ++ +   +   N++       S  D     SK   I   +   L+AL + A+  +  L    K+PK+
Sbjct: 2294 SHKCDRVATCRNTFGS---HVCTCP--DGHVGD-GITCVPHV--------NQGKLSVYCEADGMTL-VLGNETADFEGKIFVKGQAENPYCSKSFSSLLNSRKPYVFKVVFQHCDVQLLDNHTMASTV-VVQKHAMFLTNKADSYDLRCQYPIGSRAVESHVNVSELATTSTLTEKNSTLAPICRLSVSNDQHSSISSAMVGDTLKLALEVTPSENFGILPRNCFAINIESG---ERYTLTDDMGCAIDESLFPQWSA-ATSSKVQAVFRTFKWPDSSMIRFQCDCNPCVGQCSTPTCISSARF--RRHQTTSPVVNDEIRQ-EMVLMSGVESLAVSSIINVHDSHDMNTSDDDDVTSSHVDATSKESK--SICVKMAPLLIALGSFAVCSAILLYLCSKKPKT 2672          
BLAST of EMLSAG00000008211 vs. GO
Match: - (symbol:fbn-1 "Protein FBN-1, isoform b" species:6239 "Caenorhabditis elegans" [GO:0005509 "calcium ion binding" evidence=IEA] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR018097 Pfam:PF07645 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 GO:GO:0005509 InterPro:IPR013032 PROSITE:PS00022 PROSITE:PS01186 PROSITE:PS00010 InterPro:IPR009030 SUPFAM:SSF57184 Pfam:PF12661 InterPro:IPR024731 Pfam:PF12947 InterPro:IPR001507 SMART:SM00241 PROSITE:PS51034 Gene3D:2.40.155.10 InterPro:IPR023413 GeneTree:ENSGT00740000114996 EMBL:FO080623 EMBL:FO081701 RefSeq:NP_001263712.1 ProteinModelPortal:I7LHV8 SMR:I7LHV8 EnsemblMetazoa:ZK783.1b WormBase:ZK783.1b ArrayExpress:I7LHV8 Uniprot:I7LHV8)

HSP 1 Score: 147.132 bits (370), Expect = 7.117e-33
Identity = 119/404 (29.46%), Postives = 195/404 (48.27%), Query Frame = 0
Query: 9439 SNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIPPVKTDFPRPEMVVNCLSDGVLVNVDLKDGGNFRGVMYVKGHSKDSNCIKHIDSG-GSLKPIDFQVSFGKCG--LFHSQGEANFVLVVQKHPKLETYKAQAYRIKCLYDVGETNINVNFNVSMITTAGTV--RNDGPPPNCTMKICNENGEDISSANVGEKLMLKVIVSPREIYGGLARSCIARSLDDSKFEEEYAVTDANGCATDPEIFQEWKLDRNTGYLTALFDAFKFPDSINLKFKCIVRICFGQCQPQNCGGRNAFGRRRKRESSHIIDGKVYTGQLREETDVYSNAIETLESSPQNEPFNSATLGSGLESEGDEEVCVSKIGFIISLVITALLALVAVAIAVSCWLMAYRKRPKS 9837
            S+ C R     N FG    H+C C    G+ GD  + C+P +         + ++ V C +DG+ + V   +  +F G ++VKG +++  C K   S   S KP  F+V F  C   L  +   A+ V VVQKH    T KA +Y ++C Y +G   +  + NVS + T  T+  +N    P C + + N+    ISSA VG+ L L + V+P E +G L R+C A +++     E Y +TD  GCA D  +F +W     +  + A+F  FK+PDS  ++F+C    C GQC    C     F  RR + +S +++ ++   ++   + V S A+ ++ +   +   N++       S  D     SK   I   +   L+AL + A+  +  L    K+PK+
Sbjct: 2369 SHKCDRVATCRNTFGS---HVCTCP--DGHVGD-GITCVPHV--------NQGKLSVYCEADGMTL-VLGNETADFEGKIFVKGQAENPYCSKSFSSLLNSRKPYVFKVVFQHCDVQLLDNHTMASTV-VVQKHAMFLTNKADSYDLRCQYPIGSRAVESHVNVSELATTSTLTEKNSTLAPICRLSVSNDQHSSISSAMVGDTLKLALEVTPSENFGILPRNCFAINIESG---ERYTLTDDMGCAIDESLFPQWSA-ATSSKVQAVFRTFKWPDSSMIRFQCDCNPCVGQCSTPTCISSARF--RRHQTTSPVVNDEIRQ-EMVLMSGVESLAVSSIINVHDSHDMNTSDDDDVTSSHVDATSKESK--SICVKMAPLLIALGSFAVCSAILLYLCSKKPKT 2747          
BLAST of EMLSAG00000008211 vs. GO
Match: - (symbol:fbn-1 "Protein FBN-1, isoform i" species:6239 "Caenorhabditis elegans" [GO:0005509 "calcium ion binding" evidence=IEA] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR018097 Pfam:PF07645 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 GO:GO:0005509 InterPro:IPR013032 PROSITE:PS00022 PROSITE:PS01186 PROSITE:PS00010 InterPro:IPR009030 SUPFAM:SSF57184 Pfam:PF12661 InterPro:IPR024731 Pfam:PF12947 InterPro:IPR001507 SMART:SM00241 PROSITE:PS51034 Gene3D:2.40.155.10 InterPro:IPR023413 GeneTree:ENSGT00740000114996 EMBL:FO080623 EMBL:FO081701 RefSeq:NP_001263710.1 EnsemblMetazoa:ZK783.1i WormBase:ZK783.1i ArrayExpress:I7KSC8 Uniprot:I7KSC8)

HSP 1 Score: 147.132 bits (370), Expect = 7.126e-33
Identity = 119/404 (29.46%), Postives = 195/404 (48.27%), Query Frame = 0
Query: 9439 SNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIPPVKTDFPRPEMVVNCLSDGVLVNVDLKDGGNFRGVMYVKGHSKDSNCIKHIDSG-GSLKPIDFQVSFGKCG--LFHSQGEANFVLVVQKHPKLETYKAQAYRIKCLYDVGETNINVNFNVSMITTAGTV--RNDGPPPNCTMKICNENGEDISSANVGEKLMLKVIVSPREIYGGLARSCIARSLDDSKFEEEYAVTDANGCATDPEIFQEWKLDRNTGYLTALFDAFKFPDSINLKFKCIVRICFGQCQPQNCGGRNAFGRRRKRESSHIIDGKVYTGQLREETDVYSNAIETLESSPQNEPFNSATLGSGLESEGDEEVCVSKIGFIISLVITALLALVAVAIAVSCWLMAYRKRPKS 9837
            S+ C R     N FG    H+C C    G+ GD  + C+P +         + ++ V C +DG+ + V   +  +F G ++VKG +++  C K   S   S KP  F+V F  C   L  +   A+ V VVQKH    T KA +Y ++C Y +G   +  + NVS + T  T+  +N    P C + + N+    ISSA VG+ L L + V+P E +G L R+C A +++     E Y +TD  GCA D  +F +W     +  + A+F  FK+PDS  ++F+C    C GQC    C     F  RR + +S +++ ++   ++   + V S A+ ++ +   +   N++       S  D     SK   I   +   L+AL + A+  +  L    K+PK+
Sbjct: 2380 SHKCDRVATCRNTFGS---HVCTCP--DGHVGD-GITCVPHV--------NQGKLSVYCEADGMTL-VLGNETADFEGKIFVKGQAENPYCSKSFSSLLNSRKPYVFKVVFQHCDVQLLDNHTMASTV-VVQKHAMFLTNKADSYDLRCQYPIGSRAVESHVNVSELATTSTLTEKNSTLAPICRLSVSNDQHSSISSAMVGDTLKLALEVTPSENFGILPRNCFAINIESG---ERYTLTDDMGCAIDESLFPQWSA-ATSSKVQAVFRTFKWPDSSMIRFQCDCNPCVGQCSTPTCISSARF--RRHQTTSPVVNDEIRQ-EMVLMSGVESLAVSSIINVHDSHDMNTSDDDDVTSSHVDATSKESK--SICVKMAPLLIALGSFAVCSAILLYLCSKKPKT 2758          
BLAST of EMLSAG00000008211 vs. GO
Match: - (symbol:fbn-1 "Protein FBN-1, isoform f" species:6239 "Caenorhabditis elegans" [GO:0005509 "calcium ion binding" evidence=IEA] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR018097 Pfam:PF07645 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 GO:GO:0005509 InterPro:IPR013032 PROSITE:PS00022 PROSITE:PS01186 PROSITE:PS00010 InterPro:IPR009030 SUPFAM:SSF57184 Pfam:PF12661 InterPro:IPR024731 Pfam:PF12947 InterPro:IPR001507 SMART:SM00241 PROSITE:PS51034 Gene3D:2.40.155.10 InterPro:IPR023413 GeneTree:ENSGT00740000114996 EMBL:FO080623 EMBL:FO081701 RefSeq:NP_001263715.1 EnsemblMetazoa:ZK783.1f WormBase:ZK783.1f ArrayExpress:I7LFE6 Uniprot:I7LFE6)

HSP 1 Score: 147.132 bits (370), Expect = 7.374e-33
Identity = 119/404 (29.46%), Postives = 195/404 (48.27%), Query Frame = 0
Query: 9439 SNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIPPVKTDFPRPEMVVNCLSDGVLVNVDLKDGGNFRGVMYVKGHSKDSNCIKHIDSG-GSLKPIDFQVSFGKCG--LFHSQGEANFVLVVQKHPKLETYKAQAYRIKCLYDVGETNINVNFNVSMITTAGTV--RNDGPPPNCTMKICNENGEDISSANVGEKLMLKVIVSPREIYGGLARSCIARSLDDSKFEEEYAVTDANGCATDPEIFQEWKLDRNTGYLTALFDAFKFPDSINLKFKCIVRICFGQCQPQNCGGRNAFGRRRKRESSHIIDGKVYTGQLREETDVYSNAIETLESSPQNEPFNSATLGSGLESEGDEEVCVSKIGFIISLVITALLALVAVAIAVSCWLMAYRKRPKS 9837
            S+ C R     N FG    H+C C    G+ GD  + C+P +         + ++ V C +DG+ + V   +  +F G ++VKG +++  C K   S   S KP  F+V F  C   L  +   A+ V VVQKH    T KA +Y ++C Y +G   +  + NVS + T  T+  +N    P C + + N+    ISSA VG+ L L + V+P E +G L R+C A +++     E Y +TD  GCA D  +F +W     +  + A+F  FK+PDS  ++F+C    C GQC    C     F  RR + +S +++ ++   ++   + V S A+ ++ +   +   N++       S  D     SK   I   +   L+AL + A+  +  L    K+PK+
Sbjct: 2316 SHKCDRVATCRNTFGS---HVCTCP--DGHVGD-GITCVPHV--------NQGKLSVYCEADGMTL-VLGNETADFEGKIFVKGQAENPYCSKSFSSLLNSRKPYVFKVVFQHCDVQLLDNHTMASTV-VVQKHAMFLTNKADSYDLRCQYPIGSRAVESHVNVSELATTSTLTEKNSTLAPICRLSVSNDQHSSISSAMVGDTLKLALEVTPSENFGILPRNCFAINIESG---ERYTLTDDMGCAIDESLFPQWSA-ATSSKVQAVFRTFKWPDSSMIRFQCDCNPCVGQCSTPTCISSARF--RRHQTTSPVVNDEIRQ-EMVLMSGVESLAVSSIINVHDSHDMNTSDDDDVTSSHVDATSKESK--SICVKMAPLLIALGSFAVCSAILLYLCSKKPKT 2694          
BLAST of EMLSAG00000008211 vs. GO
Match: - (symbol:fbn-1 "Protein FBN-1, isoform k" species:6239 "Caenorhabditis elegans" [GO:0005509 "calcium ion binding" evidence=IEA] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR018097 Pfam:PF07645 PROSITE:PS01187 PROSITE:PS50026 SMART:SM00179 SMART:SM00181 InterPro:IPR000152 GO:GO:0005509 InterPro:IPR013032 PROSITE:PS00022 PROSITE:PS01186 PROSITE:PS00010 InterPro:IPR009030 SUPFAM:SSF57184 Pfam:PF12661 InterPro:IPR024731 Pfam:PF12947 InterPro:IPR001507 SMART:SM00241 PROSITE:PS51034 Gene3D:2.40.155.10 InterPro:IPR023413 GeneTree:ENSGT00740000114996 EMBL:JQ990141 EMBL:FO080623 EMBL:FO081701 RefSeq:NP_001263709.1 EnsemblMetazoa:ZK783.1k WormBase:ZK783.1k PRO:PR:I6Z0I7 Uniprot:I6Z0I7)

HSP 1 Score: 147.132 bits (370), Expect = 7.633e-33
Identity = 119/404 (29.46%), Postives = 195/404 (48.27%), Query Frame = 0
Query: 9439 SNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIPPVKTDFPRPEMVVNCLSDGVLVNVDLKDGGNFRGVMYVKGHSKDSNCIKHIDSG-GSLKPIDFQVSFGKCG--LFHSQGEANFVLVVQKHPKLETYKAQAYRIKCLYDVGETNINVNFNVSMITTAGTV--RNDGPPPNCTMKICNENGEDISSANVGEKLMLKVIVSPREIYGGLARSCIARSLDDSKFEEEYAVTDANGCATDPEIFQEWKLDRNTGYLTALFDAFKFPDSINLKFKCIVRICFGQCQPQNCGGRNAFGRRRKRESSHIIDGKVYTGQLREETDVYSNAIETLESSPQNEPFNSATLGSGLESEGDEEVCVSKIGFIISLVITALLALVAVAIAVSCWLMAYRKRPKS 9837
            S+ C R     N FG    H+C C    G+ GD  + C+P +         + ++ V C +DG+ + V   +  +F G ++VKG +++  C K   S   S KP  F+V F  C   L  +   A+ V VVQKH    T KA +Y ++C Y +G   +  + NVS + T  T+  +N    P C + + N+    ISSA VG+ L L + V+P E +G L R+C A +++     E Y +TD  GCA D  +F +W     +  + A+F  FK+PDS  ++F+C    C GQC    C     F  RR + +S +++ ++   ++   + V S A+ ++ +   +   N++       S  D     SK   I   +   L+AL + A+  +  L    K+PK+
Sbjct: 2394 SHKCDRVATCRNTFGS---HVCTCP--DGHVGD-GITCVPHV--------NQGKLSVYCEADGMTL-VLGNETADFEGKIFVKGQAENPYCSKSFSSLLNSRKPYVFKVVFQHCDVQLLDNHTMASTV-VVQKHAMFLTNKADSYDLRCQYPIGSRAVESHVNVSELATTSTLTEKNSTLAPICRLSVSNDQHSSISSAMVGDTLKLALEVTPSENFGILPRNCFAINIESG---ERYTLTDDMGCAIDESLFPQWSA-ATSSKVQAVFRTFKWPDSSMIRFQCDCNPCVGQCSTPTCISSARF--RRHQTTSPVVNDEIRQ-EMVLMSGVESLAVSSIINVHDSHDMNTSDDDDVTSSHVDATSKESK--SICVKMAPLLIALGSFAVCSAILLYLCSKKPKT 2772          
BLAST of EMLSAG00000008211 vs. C. finmarchicus
Match: gi|592769106|gb|GAXK01185462.1| (TSA: Calanus finmarchicus comp321180_c3_seq1 transcribed RNA sequence)

HSP 1 Score: 1306.58 bits (3380), Expect = 0.000e+0
Identity = 1655/5967 (27.74%), Postives = 2277/5967 (38.16%), Query Frame = 0
Query:  437 KPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPYSYC-NAYECLSDPECPDHLHCISEKCVDPCKCAANAECDARNHRGYCACIIDFTGDPYGXXXXXXXXXXXXXXXXXXDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCS-NGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYE----CLRNSDCPFDKACVSEKC---------------INPCKNT--LCGTRAECSVEYHKPICKCPKGLQGSP-----YIECKNVECKRHEDCGDQEKCNL-------------ISLKCEKL--CSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGL-----LACMSEKCQDP-----CTFNKPCSDSQECKVFDT-SPTKTVACICPT------------DTVVGIDGRCNRVQTSPECEIANDCKISDICVSGSCIDA--CKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRPHPECPDRLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCIXXXXXXXXXXXXAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCAD-----------------NKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYVA-CK----EVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYT----GDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGF--GNCKRVETATECQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINXXXXXXXXXXXXRCKVINHEPECTCPDGFIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPY--------------GIACXXXXXXXXXXXXCKEDRDCPSQNACINEECDNPCL-MYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIE---NDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVK-ISNSECKYDTDCASNEAC-IN----DQCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSF----ECKKNEDCPFDKECKSES-----CVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNP--YLSCREV---QCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEAC--ISDTCKNPCIVES-----PCHPSQN-------------------CRVLESYLLK-------------TVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLL--SPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICK----VIQHKPVCTCPDGFIGSPSTNCQPPERPECRVDAECPLDRACIHQKCQNPCSR-LTCGKNADCKVNNHRAICTCLKGYNGDP---YSLCKLSGCESDFECPNHQACINRECQNPC-LFEKCGXXXECKXENHRAICH----CLSGH---------KGQAYVNCKRYECLRDSDCPNHLHCVNDKC----VDPCE---CARNADCKARNHRGYCTCIPNFTGDPYGXXXXXXXXXXXXXXXXNEDRDCPSQNACINE-----ECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDE--RCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYCYKY-ECKTDNDCPFDKACAKEKCIDPCK-DTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGT-----CRKTCSINS-CGANAVCTPVIHGFKCNCFDGYTGDPN--------------------SACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPE-CLLDAECPDHLACINRKCQNPCST-LTCGDNAQCRVQRHRAICT----CLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGY--NGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYEC----RISDDCPFDKTCLNEKCVDPCD--TTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKE--------VECRKDTDC----------ASNEKCNLQNF----RCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGSCIDAC-RVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCA-EDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCS-SITCGKNAQCRVQNHRAICSCFGGYVGDPYTAC-------------EEPGCK---SDFECPNKQACINRECQ---------NPCLFENCGINAECSPENHRAVCACLKGH-KGDPYSFC---KPYECLSDPECPNHLKCENEKCVDPCE----CARNADCDARNHRGICTCILDFTGDPYGIAC--------XXXXXXXXXXXXCNEDRDCPSQNAC--INEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCK-CPPGLAGDPHSTCYR-YECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSC------KCPAGLQGNPYINCKELECRKH----------------------QDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGD---GYSFCSLPIEPAIEPECRVDQDCQ-----SVFACIRDKCTDPCFT---------NNPCLPLQECKVLNSSPL-----------KTVSCICPSDM----YIGSSGQCERVEGTSECIVNEDCTSTDVCYEG------SCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFC-EEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPYECLSDPECPNHLKCKNEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINE-ECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNE----------------------------------------------ECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPC--ACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTK-----------------------------------------------ECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQITIQT----QAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQLPQKPECTKDSECANHLACIQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCRSYECLVDSDCPRHLACENEKCVDPCK--CAKYADCKVTNHQGYCTCNSYYTGDPY 5909
            +PC ++A C        CTC  GY G                  +C D       +C  P     C  NA+C       +C C  G+ GD              EC D   C  RE         CG N+ CS      TC C +G+ G+PY+ C +  ECLS+P                  C A A+C  +     C C     GDPY                      C + + C S+    PC + + C  +            +  C C +G+ G   ++C+ +   +                           R  CG +A C        C C+ G TGD ++ C                         TD CS     CG+NA+C   N   +C+CPPGF+ +    C   E    C  N DC  +  C   +C               ++ C++T  +CG  A C        C C     GSP        CK V C +H  C  ++K                I+  C  +  C     C  +++C        C C P   G+    C   +       C     C  L       C S    DP     C   K C  + +C      SP+K   C+CP             +     + +C  +   P C      + +     G CID   C   PCG  A C++     RC CP+G +G+P+  C         +    C     CP+  LC    C+                         C  G+    + +CR   EC      E   C        NA C        C C   + G+P+             +   ++D +      CI   C N       C + AEC    T+      C C  GF  + D  C  I+  +            +  C  G               A+C  +    +C C  G TGDPYS      + +C  D DC  N  C +                  KC +PC    +CG NA C   N  P C C   + GDP   C                      +D C    CG  A C  E     C+CP G +G PY+A CK     V+C +D +C     C  Q   C   CS S  C  NA C    H   C C   Y     G   S C  ++                                  C  + +C ++ T P+    C C   T  N F  G+C        C   N CP    C  G C   C S  CG+NA C    +++ C C +GF G+   +C   P ++ PI  PGC S+  C                                  +C C   F G+P   C P                             V  C+C  NA+C       +CTC   F G+P+              G     I      +  C+ D       AC  E+     L   K C  NA C V          C C+ GF G  ++     Q      C +N +C     C++ +    CI+   N  C   ++C   NH++ CICQ GY+G+P       +    CK   DC +   C IN      CVD C + + CGK   C    +R  C+C      +P            C  +  C  D+ C+ +S     C   C    C   + C    H+G C+C  GY GNP     C  +   QC  ++ C  +E C+L   KC P C     C   AVC  +NH  +C+CP    G      N PV       CL ++D   ++ C  +S TC + C  ++      C P Q                    C  L +   K               SC C +G QVG   +       +  + D DC    +C  G C N CY + CG N EC  N  +++C C  G++         SP +    +  S GC  D DC   + C+   C   C   + C V   C     +I       CP   + S            CR +  CP D  CI  KC NPC +   CG NA CKV+     C+C + + G P       ++     + +CP    C    C   C +   C     C       +CH    CL G                +C+  E  +   C   +  +N       ++ CE   C  +A+C        CTC     GDPY        +      EC  +RDC  Q AC  +     +C NPC   K C  NA C+V    P     C C +   G       C K+E    T C  D  C       +  CI+ C   +       CS  +H   C C  GY             ++C   ++CQ                N  C   AIC N      C+CP G   D    C    +C +DNDCP   AC   KC +PC+    CG  A C    H+  C C     GNP V C  +EC +++DC S   C     KC  +CS  N+C  N  C A NH  RC C   FTG+    C+++        C V++ CPS M C    C  PC  ++ CL NQ+C   +       S +CP      +G   +E    + C  + DC + + CV        C   C+    CG NA CT + H   C C DG+ GDPN                    S C +  +  +P +   C+ND +C +   C   QC +PC I   C  +A C   +H+  C C   F G P  +C  + +P  C   ++CP  + C +  C  PCS+   C  N +C        C     C  G+      VC  +  + VGCR+NS+C  +  C N  C +PC   + CG +A+C+V  H A C CP  +  N  P   C   Q   C  +  C   + C    C D C  ++ C  N  C     +  C+   +   +    C    C    R S +CP D  C+N +C DPC   TT CG+ A+C    H+  C CP GL G+P   C+          +CR+   C          +SNE C L        C  LC+ N +C+                      DGY  C E+   A    C  D  C+  +ACI   C+DPC   + C +  EC    SV      C CP  +    +  C  +     C  + DC     C+DG C+  C   + C     C+S   R EC         + V C         + +PGC  D DC     C   +C NPC  E   CA +A C+V  H+ +C CP G  G+P  +CK+    EC ++ EC    +CI+  C N C     CG +AQC+   H+  CSC   YVG+P   C             E   C+     ++C  K  C               +PC    CG++A C+     A+C C      GDP   C   K  +C +D +CP+   C+  KCVDPC     C  NA C  R H+  C C     G P+ + C         P    ++E + C  D+DC    AC   N +C +PC     C  N +C V +  P+      C   ++   +++ V   P     CR++ EC  + AC+N  C SPC     C    +C V  H+A C C  G        +     C  D  CP  +ACI  QCKNPC     C  N  CI E H+ VCK CPPG   D +  C +   C+++ +CP  +AC ++KC++PC    CG+   C V  H + C      +C +     P   C++ EC K+                       DC +++ CD    KC  +C G   C     C   NH   C C   + G+   G +F   P  P I   C  D  C+      + +C R K  +P             N C P   C+++   P+             + C+ P         G++ +C  V     C      T +    +G        I+ C    CG NA+C        C+C  G+ GNP  GC        P     C  N +C                ED+   I           VC+C  G+ G PT++     K EC  + DC+ A ACI QKC +PC   TCG  A+C+ +NH  ICSC     GDP++ C ++P        +D           PC    CG NA+C     +AIC C++ ++GDP   CKP ECL   +CP    C N KC DPC   C  NA+C   NH  IC C   +TGDP+                      C      IN  E  +PC    PC  NAEC++ ++ P+    CTC  G+ G       + E V++      SEC+P LA     C NPC+    CG  AKC V NH   C C  G+IGDP+SSC    +E                                              EC  + DC+  Q C NN+C+DPC    TCG +A C+  NH P C C +G  GN    C K +       P+  V   E   DPC    CG  +  R + ++ +C C  G  G P   C+  +C    DC  N  C  Q  KCS  C G+  C   A C   +H   C C     GD ++ C +KRP               S         NPC    PC P   CK L   P     C C +G  IG   NC     RPEC    +C  +  C +  CVD C    CG NAEC    H+ ICSC  G++G+P   C      V PS  P                     PC+  +PC   A CR +N    C+C  GYIGSP     P  +PEC  + ECP + ACIQQKC +PC    CG NA C   NH A+C+C  GY GDP+      GC    E             DPC    CG NA+C + N    C C + H GDPY  C+P +CL++ +C +HL C+  KC DPC   C + A+C  RNH   C+C   ++GDP   AC  IP P  +E +                   +PC  N PC  N++ R  + +      C C   Y G          P     C  +S+C    AC   KC++PC     CG+ A+C V NH P C C PG+TGDP++ C                                                     EC+ + +C ++  C++ +C DPC     CG NA+C  + H+P+C+CP G +GDP   C +    T        T      +DPC+ + CG  A C +    G CTC+ G  G+PY+ C+  EC  N DC  +  C  N  KC+  C    +C INA C +  H+  C C     GD  + C      V   E ++D   P           NPC   +         +   S+  I +    + EC  +++C     C+  TC D C    CG  A+C    H   C C  GY G+P + CT+  I V + V       +  PR T        NPC  D PC   A CK +     CSC  GY+G          +PEC   SEC ++LACI +KC+DPC    CG  A C V +H A+C C + Y GDP+S C+                ++ E +DPC    CG NA C   N  A C C+  + GDPYV CR  EC +++DCP + AC+  KCVDPC   C   A CKV NH   CTC+  Y GDP+
Sbjct:  574 RPCDVFAHCTNNIGSYACTCFPGYEGD---------------GHNCQDI-----DECTIPELAAKCVENAECCNLPAEYVCKCKPGFEGD-----------GQVECRDIDEC--RE------SNACGANSLCSNFAGNYTCSCQEGYAGDPYTGCIDLNECLSNP------------------CGAGAKCINQYGGYLCECPAGAKGDPY--------------------TSCGTLDQCQSK----PCGLNAKCYNDGG----------SYRCECPQGFQGNPKQQCLDVNECL---------------------------RNPCGQNAACINTEGSYQCACKQGLTGDPFTACSD-----------------------TDECSAQSNPCGSNAVCRNTNPGFVCECPPGFSGNGNVACEATEVRTLCQSNFDCTNNAVCQKGECLCRSGFTAAGTLCLDVDECRSTPGICGANAVCRNTLGSFTCSCLTSFVGSPPSVPCSEPCKGVTCSQHAYCKAEQKDAYCVCEDGWTYDPKNIAAGCIDVNECGAPGTCGENSLCTNLPGSFICQCKPGYTGNPQVRCIDIDECKSVSTCGFGTTCENLPGSYKCGCPSGSVADPNNPAECISVKTCQKNNDCPGNAFCSPSKM--CVCPEPNQGPNCESPCENVFCAANSQCTLINGQPRCMCHQGYQPAGQGKQG-CIDINECLGQPCGKGAFCENTPGGYRCKCPSGLSGDPNIAC------KGEIEAIQCSVSKPCPSGELCSQGKCV-------------------------CQRGFQRESSGLCRDLDECTRASASEEPAC------GLNAFCKNLPGSFDCECPAGYNGNPFVKCSSCNGPDCGCQPPYSQDGE-----NCILAGCKN----KGDCSEGAECI---TIAGGVSYCACPSGFNVQPDGTCADIDECLST----------SRPCGFG---------------ALCENKIGSFSCVCPIGTTGDPYSGVCSANQAQCSRDNDCRPNEKCVEPGQCICPPPFFSDTTDGGKCKSPCE-RFMCGINADCSPTN-PPQCLCKAGYNGDPIQGCLD--------------------VDECAQNPCGPEARCLNEAGSYKCQCPKGTRGDPYLAGCKGTPSRVECTRDEECPGLLSC--QASVCINPCS-SIPCGENAVCIPENHAAWCRCKVGYKENSEGKCTSMCDGVI----------------------------------CGLNAQCIISPTGPT----CACSKGTLGNPFPGGSC----VPETCSGANPCPQPLSCISGKCRERCDSFSCGLNAACDG--NTNKCFCREGFVGDGNFLC--MPPILPPICTPGCGSHSHC----------------------------AYGIPNQCICNSEFGGNPYEGCSP------------------------STIDIVQDCKCGSNAECVTDGTSKVCTCKEGFDGNPFIGCFDINECTNKICGKNAVCINTIGNYDCRCELDYKGNPFEACFPEQPTIADLCTEKQCGPNAVCSVGQ--------CLCLTGFKGDAEDLRTGCQSST---CSNNLDCGYNEICQSVKGQYRCIDACGNVQCGPNSRCVTDNHHSTCICQDGYSGNPLDLSGGCVREVTCKTQNDCPTGSVCSINISGKRSCVDPCRI-MSCGKYEICSVKNNRPFCQCSPTHIRNPVTGQCEIASVPSCSNDGQCSEDQVCRPDSLGILRCTPICQLFTCPQNSQCRASNHQGFCQCFEGYNGNPNDRTGCSLISKDQCLSDAQCSEEEVCSLTLKKCIPAC-NTIVCGPQAVCITQNHSPQCTCPP---GKFKGDPNDPVLGCKAVSCLTNTDCPPTKFCDRLSYTCMDVCTADTCGKNAVCLPEQQRPKCSCPPGTKPDPLPEVRCSTLNACSKKPCHSSASCSSTTTGFSCSCPQG-QVGDPNKSGCFPEGSCPNGDRDCPDKSICIRGMCKNICY-DSCGPNTECSINNRQAQCQCLQGFI--------PSPLDARTCIRDSQGCRKDADCIGGSTCQGGQCRYSCRGQNDCLVGEQCSDSMCMISCISSQQCPSSQVCSNGVC-----SIGCRNNENCPSDEVCISFKCVNPCQQEGACGPNALCKVSGKNVQCSCPERFAGVPTPQQGCVRIPARCPNGKCPPQHTCKGGMCHWQCQINANCAKGERCLDGLCTKVCHSDKNCLQGEICIDSTCQPGCNKEEDCRPGEICQGGSCVCAIGFINTPAGCQDINECENSICHPSANCANIPGSFKCTCPRGLVGDPY-------TKGCKNPNECTTNRDCGPQLACAGDGSGYRKCVNPCDRAK-CGTNANCEVQKHKPF----CKCFDKHVGNPSSPLGCTKVECEKNTDCNGDKVCQVA----NNRCIDACNIVS--CGRGTCSATNHVPSCRCEPGYI---------FSNNQCVDIDECQ----------------NSPCEPTAICINTVGAYQCQCPPGTVPDAFGRCRSSDQCLSDNDCPKTAACNNGKCQNPCEIPGSCGADAICTPANHRPMCSCPPRTNGNPQVRCVPLECVSNSDCNSERTCVRN--KCVDVCSLPNVCGQNTNCRATNHIARCFCLPGFTGEPTLGCTQLQL------CTVEEQCPSGMLCSFGICSPPCQSSRDCLDNQLCNGGSCISKCQDSTQCPPLHSCQNGLCIQE----SRCSNDVDCDEVDTCVGRENGLFECEDACAGPVICGRNAKCTSLGHKAVCTCPDGFFGDPNNEKIGCQKKQCLVNGDCPGDSVCDK-FICTQPPVTGTCTNDRNCQANEVCDKGQCKDPCGIQGSCGINAFCSVQSHRKQCVCPQDFTGNPEVEC--VRIPSTCYSSSDCPQPMQCADGICMPPCSSDENCAINERCLQGLCMLTCRVDNDCFLGH------VCLNKMCI-VGCRANSDCPESNTCINNRCTDPC-RGDTCGPNAKCQVVDHRAQCSCPPRFIPNPTPVVGCV-KQPQTCSSNAQCPERQVCDGKFCKDVCFNDKNCLVNEVCDNGICKPLCR--RDDDCNSQEICKGVTCVLGCRSSSNCPNDLACINNQCTDPCSSSTTSCGNNALCSVANHQAVCSCPAGLTGDPTRGCRHPVQVCSSSTQCRQGYKCVGGVCAASCSSSNENCLLNEVCVKGTCRPLCNSNADCS----------------------DGY-ICKERFCVAG---CSSDSQCKENQACINSQCQDPCLSSS-CGQCAEC----SVSNHQAFCSCPASSTGNPSIGC--LPLTYTCGKSSDCGRGQRCEDGVCVKKCGSSSSCECGKTCVSGQCRQECT--------SSVPCPQGHLCKGGTCLPGCIGDNDCSDQELCLAGKCQNPCLLESTGCAKSAECRVTNHRPVCLCPQGLQGNPKIECKRI---ECRTNSECEHTKSCIEGSCVNLCLLPNACGISAQCKSIRHQKKCSCPQKYVGNPNIECVLDKNECLSSPCGENAICQDLVGGYDCKCKAGCTGDGFSGCICGGPLIDPCRNARCGLDALCTVGGGIALCVCPNNKPNGDPLVECTSEKEGKCRADFDCPSSQSCKKGKCVDPCSLRAACGVNAICTVRIHKPRCECPQCHIGRPH-VRCRPDPSCNTLPTKPQIVEPIGCQGDKDCSLGTACNRQNGKCFDPCGSTS-CDFNKKCIVSNHKPI------CKCKYSLVVNQQGVLTCPDRQVECRTHNECPSNQACDNGRCKSPCDNPRICPAGKECQVLEHKAVCICTTG-------CNPEVSICLKDRGCPRGQACIGYQCKNPC-EGTTCPGNTPCIVEDHKAVCKFCPPGFTTDANYGCIQGVGCRSSSECPSKQACQNKKCVNPCGLGQCGATQDCEVANHLARCIDVPRCECSSRRDCLPGFTCEDCECVKNPDVDATVCEPSEGDCFEQCTINSDCPEDKYCDRFKRKCISVCPGF--CGDNTQCRFVNHNPICSCKQGFNGNPDVGCTFNQPPSNPCIPSPCGSDAICELDNGNPICSCPRGKTGNPFVRCIQDGKKCRGNQCGPNSGCRMIADRPVCYCLPRFEGNPPAIPCVKPMKQCKPNPCGANTECVVVNNVQRCTCKPGYTESVNTIQGCVLISEPVISLCEPGPCGDNAECLVNDLGEDCRCNAGFGGNPFQGC----TPQNPCNPSPCGPNTEC---------------NEDRAGQI-----------VCSCRRGYQGDPTSD--QGCKAECLRNSDCSRALACIAQKCIDPCPG-TCGIFAVCEVQNHNPICSCPPGTVGDPFSRCTQQPVVTEPPRPKD-----------PCNPSPCGTNAQCRQQSGQAICQCIRDYQGDPLIGCKP-ECLLSFDCPQDKACINSKCKDPCPGTCGINAECQISNHNAICKCHEGYTGDPFA--------------------QCSLIPGVINPPEPADPC-QPSPCGPNAECRIVESRPV----CTCFPGYYGAPPS--CRPECVIN------SECAPALACINLKCSNPCVGV--CGINAKCDVVNHNPICSCPQGYIGDPFSSCRRKPDEIRPTPKPDICNPNPCGPSAIRKPRNGVCTCACPPGLFGDPYLGCRPECILNSDCNRLQACSNNKCVDPCP--GTCGTNAECKIINHIPTCGCRKGFTGNAFEECTKPK-------PVQPVEGKE---DPCGGNFCGAYSTQRVQGNRCVCSCLPGYFGFP-PNCRP-ECVVSSDCSQNLACLSQ--KCSDPCPGR--CGVNARCHVISHHPICTCPPDYEGDPFTSC-QKRP---------------STVTPPPKPSNPC-YPSPCGPYSSCKPLRDRPM----CSC-NGGYIGSPPNC-----RPECLLSSECQLTKACVQQHCVDPCP-GTCGANAECKVVNHNPICSCPRGYSGDPFFNCNKDPEVVTPSERPH-------------------IPCVP-SPCGPNALCREVNGHEACSCVAGYIGSP-----PNCRPECVLNAECPSNKACIQQKCSDPCVGA-CGYNARCTAVNHNAICTCPTGYTGDPFS-----GCSLVPEVIREPP----EIIDPCNPSPCGANAECSSRNRAGACRCIKDHIGDPYVGCRP-ECLINTECPNHLACSQKKCRDPCPGTCGRNAQCSVRNHNPICTCNPGYSGDPTS-ACQIIPPPQPIEVD------------------TDPCDPN-PCGPNSQHREVNGV----CVCACAPTYQG--------TPPNCRPECVVSSDCNQLTACVNQKCVDPCPGT--CGNNARCQVTNHNPICQCPPGFTGDPFSNCVRVVVTQPPPRPQPVDPCNPTPCGQFSQCRNSNEVAACSCLPNYIGIPPNCRPECSINAECPSNRACVRERCIDPCP--GACGPNAVCKVQNHQPICQCPTGFSGDPFRDCRRVVIPT--------TVRTTEVIDPCEPSPCGANAQCRSRQRAGACTCVPGYFGDPYLACRP-ECVMNTDCPTNRACVNN--KCVDPCP--GVCGINAICNANRHQPICTCLNGYTGDAITQCSLIPTGVPVVE-ELDPCDP-----------NPCGAYSQHKEQNGVCVCSCSRNMIGSPPNCRPECLVSSECSQVTACMQQTCRDPCPGL-CGRNAECRVTNHNPICTCQRGYQGDPFTGCTK--IPVTERV-------TQPPRPT--------NPCQPD-PCGRYAQCKNVRGVAACSCLVGYVGVPPNC-----RPECLIHSECPSNLACINEKCRDPCPG-ACGAYAECSVIKHNAVCRCQQGYEGDPFSSCRRVTTIPPR--------VSTERRDPCQPSPCGANALCTERNFAAACTCIQDYFGDPYVACRP-ECTINADCPSNKACQRYKCVDPCPGLCGVNAQCKVINHIPTCTCDRGYVGDPF 16194          

HSP 2 Score: 1282.32 bits (3317), Expect = 0.000e+0
Identity = 1650/6006 (27.47%), Postives = 2308/6006 (38.43%), Query Frame = 0
Query:   21 DDECDSNQACRNRVCVNPCTNS---NPCGVLAECSVRNHRTTCVCTIGFTGDAYSNCSPINE-------DECRYDSDC---PLNNAC-----------MKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKC--NLNNFKCE----------ELCIS-----SGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVGGTCL---------------NSCRVHP--CGPNAQCIASSHRSTCSCSRGYTGNPQD---------------------------SCQRIQVTGATPLQPGCDSNQDCPTYSSC-RNRLC-------------------------INPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACI------------GQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPYSYCN----AYECLSDPECPDHLHCISEKCV----------------DPC---------KCAANAECDARNHRGYCACIIDFTGDPYGXXXXXXXXXXXXXXXXXXDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQ-----------ECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSP---------------------ECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDC----PTYSLCKNTMCINP----------CAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRPHPECPDRLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNG----------KCIXXXXXXXXXXXXAICRTQNHQPTCECSPGFTGDPYSLCSP-TREDECKHDEDCPSNMVCADN-----KCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKY----ECQKNEDCPFDKSCSSNN-----CIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSP--YVACKEV---QCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCIC-SSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSC--ISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVN-----------------------------GFG-NCKRVETATECQS-----------NNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINXXXXXXXXXXXXRCK----VINHEPECTCPDGFIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCENEKCVDPCE----CARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGK---GDERCVKIQPVVDV----GCRSNSECSPTLACRNGEC---------------LNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKISNSECKYDTDCASNEACIND-----QCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPH--VSCYSFECKKNEDCPFDKECK--SESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVER-CGINAECIANFHRSKCSCYPGYLGDPKNACYQS---------PTEIE---PLLSPGCDVDRD---------------------CPSYTMCKNRLCI----------------------------NPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTN--------------------------CQPPERPECRVDAECPLDRACIHQKCQNPCS-RLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKL--SGCESDFECPNHQACINRECQNPCLF-EKCGXXXECKXENHRAICH----CLSGH---KGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPCE---CARNADCKARNHRGYCTCIPNFTGDPYGXXXXXXXXXXXXXXXXNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKD-NPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCS-------LNEICGKGAICENRNHRSVCK----CPRGFSGDPHSYCYKYECKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREV--ECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCV----CPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIV-NKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTCRKTCSI-NSCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQC--------INPCSIGSP---------CAKSAICKPINHKAVCTCLDGFV-GTPSTDCRPINVPECLLDAECPDHLACINRKCQNPCST-LTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQP-----------VVDVGCRSNSECSPTLAC--KNGECINPCIENNPCGTSAQCKVKRHEANCICPAGY--NGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCE-CPNGLQGNPYIFC-KEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCI------------CPPPF---------EGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINP--CSENQECKAFASVPLRTVSCICPQG---------TF------------IGSNGICQEVETKVECEYNDDCSTNDIC---QDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGN-AQVACYLPITPNEPSLVPGCTSDQDC------------PSYTACRNRQCINPCA----------EDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRV-QNHRAICSCFGGYVGDPYTACEEPGCKSD----FECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPCECARNADCDARNHRGICTCILDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCYRYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLP-----------------------------------------IEPAIEPECRVDQDCQSVFACIRDKCTDPC-----------------------------FTN--------------------NPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPYECLSDPECPNHLKCKNEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCV-----------------------------------------------PASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCP-SGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPC--ACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNH 5340
            D +C  N     + C  P  N     PC V A C+       C C  G+ GD + NC  I+E        +C  +++C   P    C           ++ + ID C  +  CG  ++C   +    C C EG AGDP+  C +                     + C S  CG  AKC  +Y   +C+CP G +G PY SC  ++   +  C  NAKC  +  +++CE          + C+         C  +A C   +    C C   LTGD ++ C +        EC   S              NPC     C  T    V          C CP     + N  C   E +T C++N DC +  VC  G CL               + CR  P  CG NA C  +    TCSC   + G+P                              C+         +  GC    +C    +C  N LC                         I+ C     C    TC  +     C CP+G +  P           C+ ++DC  +  C             G  C +PC    C  N+QC + N +  C C  GY         +P  +    C D          N CL + CG+ A C        CKC  G  G+P   C     A +C     CP    C   KCV                D C          C  NA C        C C   + G+P+    +        +    +D      E CI   C N       C E A C    T+      C C  G+  + D  C  I+  +                         +T   CGF A C  K     C C +G TGD YS     +Q +C  D+DC  N+ C+                            C CPP F +D+                        KC +PC+  +CG  A+CS   + P C C  G  G P   C +V+      CG + +C                     + EA ++  KC CP    GD Y +  K   PS + EC  D++CPGLL+C +  C +PC+ + PC ++             CKV     ++          + G++ +C    T P                      C  AN C     C+SG C + C    CG+NA C   ++  +C C  G+ G+ +  C  + P   P+ TPGC +   C    P   +C +    NP            +D  C   A C     + VCTC  G+ G+P   C    EC +++            C +NA C        C C  D+ G+P+                      C  +   I + C       K C  NA C V          C C+ GF G  ++        +  GC+S S C  NL C             +CI     N  C  ++ C T NH  TC C  G++G+P  L     RE  CK   DCP+  VC+ N      C +PCR  S CG   +C V N+ P C+C      +P +   +      C  +  C  D+ C  ++     C   CQ   C +N++C    H+  C+C  G  G+P     C  +   QC  D  C ++E C L    C   C N+ VC   A C    H  +C C    + GD        V+      C  + DCP    C  +S TC + C+ +  C  +  C      P     C CPP T  +                             GF  +C + +     +S           + DCPD  +C RG C N C    CG N +C+     + C C  GF  +P      A   +   +  GC  + DC   + C+  +C   C   + C    +C     +I+      CP   + S             C    C ++  CP    C + KCV+PC+    C  NA C        C+C   F G P      P    V     C   + CP Q+ C    C   C +   C +                  C++G   K    D+ C++ +  +D     GC    +C P   C+ G C               +N C EN  C  +A C  +  + KC C  G  GDPY++  K  N EC  + DC    AC  D     +CV+ C     CG +A CE  +H+  CKC     G+P   + C   EC+KN DC  DK C+  +  C+D C    CG   TC+   H   C+C  GY               N+ C   ++C            +N+ C  +A+C       +C CP   + D +  C          +CL D+D  ++ AC +  C+NPC +   C     C       +    C C   T      +C+ +    EC  ++DCN +  C    CV+ C +   CG N  C A  H ++C C PG+ G+P   C Q          P+ +     + SP C   RD                     CP    C+N LCI                            + CA    C   A C  + HK VCTCPDGF G P+                             QPP    C  D  C  +  C   +C++PC  + +CG NA C V +HR  C C + + G+P   C    S C S  +CP    C +  C  PC   E C     C        C     C  GH        V C+      +SDCP    C+N++C DPC    C  NA C+  +HR  C+C P F  +P      P+   V +   C+ +  CP +  C  + C + C   K C++N  C      PL      C         E C  +  ++  GCRS S C   L C +  C +PC      C  +A CSV +H+A+CSCP G  GDP   C+  +   C+    C++   C+   C+  CS       LNE+C KG        R +C     C  G+      +C    C +D+ C  ++AC   +C DPC  + CG  AEC    HQ+ C C     GNP + C  +   C   +DC   ++C+     C   C  ++ C     C +   ++ C     CP      G             P C  D DC     C++ +CQNPC++ +  C ++  C+V N+ P+    C CP G   +   ECK +    EC+ N++C+  + C++G+C   C + N+CG +A C  + H  KC+C   Y G+PN  C   VL+    L   C  +  C       + +C         + C  G P         C   A+C      A+C C +    G P  +C      +C  D +CP   +C   KC +PCS    CG NA C V+ H+  C C   +IG PH  C   P           V  +GC+ + +CS   AC  +NG+C +PC   + C  + +C V  H+  C C      N      C P + +EC+   +C SN+AC N +C  PC   R C    EC    H++ C C      +P  S     C     CP  + C+  +C +PC+ T C     C  E HK  C+ CP G   +    C + V CR  ++C S + C  QN +C+  C     C    +CE +NH  RCI            C P F           D  +   E        +C I+ DC   K C     K  C  + P  C +N +C+     P+    C C QG         TF             GS+ IC+       C      + N      QDG     CR N+CG N+ C     R  C CL  + GN   + C  P+   +P+    C ++ +C            P YT   N   I  C           E  PC   A C V      C C  GF G+P   C                         QNPC+   CG N +C   +  + +CSC  GY GDP +   + GCK++     +C    ACI ++C +PC    CGI A C  +NH  +C+C  G  GDP+S C     +++P  P           +P  C  NA C  ++ + IC CI D+ GDP  I C         + EC    DCP   ACIN +C +PC     C  NAEC++ +        C C EG+TG    +C  I  +I+               E A+   P    +PCG  A+C +   R  CTC  G+ G P S      EC  +++C    ACIN +C NPC+    CG NA C    H P+C CP G  GDP S+C R   K +E  P  K        D C    CG  AI        +C CP GL G+PY+ C+  EC  + DC   + C  +  KC   C G+  C + A C+  NH   C C   + G+ +  C+ P                                           P   PEC V  DC    AC+  KC+DPC                             FT+                    +PC P   CK L   P+    C C +  YIGS   C       EC+++ +C  T  C +  C++ C    CG NA+C  + H+  C C  GY+G+P   CN     V PS  P                     PC+   PC   A+C+ V+    C+C  G++GSP  NCR    PEC ++ +C    ACI+QKC +PC    CG NA C A NH AIC+C   ++GDP++     GC    E          E  +PC    CG NAEC++      C C++ H GDPY  C+P ECL + ECPNHL C  +KC DPC   C RNA C  RNH  ICTC P ++GDP   AC+ IP               P Q   ++ +  +P     PC  N++ +  + +      C C    T +G     + E VV       S+C+   A   Q CV+PC     CG  A+CQVTNH   C C  GF GDP+S+CV                                               P    EC+ + +C  N+ C+  +CIDPC     CG +A+C+ +NH+P+C+CP G +G+P   C +    T        V T+E  +DPC+ + CG  A CR+      C C  G  G+PY+ C+  +C  + DC  N  C   N KC   C G   C   A+C A  H+  C C +  +GD  + C      VP  E                      +L DPC P+  C        +   CVC  S   IG   NC     RPEC    +C   + C + TC D C    CG NAEC  T H+ IC+C  G+ G+P   C   +P  E    P        P  T        +PC  D PC   A C+ +   + C+C  GY+G P     P  +PEC   +ECP +LACI +KC++PC    CG  A C V  H AVC C  GY GDP+       C+     P   +   +   DPC    CG NA C   N  + C C + + GDPY  C+P +C ++ DC  +  C   KCVDPC   C   A+C   NH   C+C   + GDP+  +C    EPL +E   +AD  C            NPC  N     N   ++ D        C C+    G          P     C  NS+C   LAC   KC +PC     CG  A C V+NH
Sbjct:  499 DSQCHCNDGWGGKGCSMPDDNECKYRPCDVFAHCTNNIGSYACTCFPGYEGDGH-NCQDIDECTIPELAAKCVENAECCNLPAEYVCKCKPGFEGDGQVECRDIDECRESNACGANSLCSNFAGNYTCSCQEGYAGDPYTGCIDL--------------------NECLSNPCGAGAKCINQYGGYLCECPAGAKGDPYTSCGTLDQCQSKPCGLNAKCYNDGGSYRCECPQGFQGNPKQQCLDVNECLRNPCGQNAACINTEGSYQCACKQGLTGDPFTACSD------TDECSAQS--------------NPCGSNAVCRNTNPGFV----------CECPPGFSGNGNVACEATEVRTLCQSNFDCTNNAVCQKGECLCRSGFTAAGTLCLDVDECRSTPGICGANAVCRNTLGSFTCSCLTSFVGSPPSVPCSEPCKGVTCSQHAYCKAEQKDAYCVCEDGWTYDPKNIAAGCIDVNECGAPGTCGENSLCTNLPGSFICQCKPGYTGNPQVRCIDIDECKSVSTCGFGTTCENLPGSYKCGCPSGSVADPNNPAECISVKTCQKNNDCPGNAFCSPSKMCVCPEPNQGPNCESPCENVFCAANSQCTLINGQPRCMCHQGY---------QPAGQGKQGCIDI---------NECLGQPCGKGAFCENTPGGYRCKCPSGLSGDPNIACKGEIEAIQCSVSKPCPSGELCSQGKCVCQRGFQRESSGLCRDLDECTRASASEEPACGLNAFCKNLPGSFDCECPAGYNGNPFVKCSSCNGPDCGCQPPYSQDG-----ENCILAGCKN----KGDCSEGAECI---TIAGGVSYCACPSGFNVQPDGTCADIDECL-------------------------STSRPCGFGALCENKIGSFSCVCPIGTTGDPYSGVCSANQAQCSRDNDCRPNEKCV------------------------EPGQCICPPPFFSDTTD--------------------GGKCKSPCERFMCGINADCS-PTNPPQCLCKAGYNGDPIQGCLDVDECAQNPCGPEARC---------------------LNEAGSY--KCQCPKGTRGDPYLAGCK-GTPS-RVECTRDEECPGLLSCQASVCINPCS-SIPCGENAVCIPENHAAWCRCKVGYKENSEGKCTSMCDGVICGLNAQCIISPTGPTCACSKGTLGNPFPGGSCVPETCSGANPCPQPLSCISGKCRERCDSFSCGLNAACDGNTN--KCFCREGFVGDGNFLC--MPPILPPICTPGCGSHSHCAYGIPNQCICNSEFGGNPYEGCSPSTIDIVQDCKCGSNAECVTDGTSKVCTCKEGFDGNPFIGCFDINECTNKI------------CGKNAVCINTIGNYDCRCELDYKGNPF--------------------EACFPEQPTIADLC-----TEKQCGPNAVCSVGQ--------CLCLTGFKGDAED--------LRTGCQS-STCSNNLDCGYNEICQSVKGQYRCI-DACGNVQCGPNSRCVTDNHHSTCICQDGYSGNPLDLSGGCVREVTCKTQNDCPTGSVCSINISGKRSCVDPCRIMS-CGKYEICSVKNNRPFCQCSPTHIRNPVTGQCEIASVPSCSNDGQCSEDQVCRPDSLGILRCTPICQLFTCPQNSQCRASNHQGFCQCFEGYNGNPNDRTGCSLISKDQCLSDAQCSEEEVCSLTLKKCIPAC-NTIVCGPQAVCITQNHSPQCTCPPGKFKGDP----NDPVLGCKAVSCLTNTDCPPTKFCDRLSYTCMDVCTADT-CGKNAVCLPEQQRPK----CSCPPGTKPDPLPEVRCSTLNACSKKPCHSSASCSSTTTGFSCSCPQGQVGDPNKSGCFPEGSCPNGDRDCPDKSICIRGMCKNICYDS-CGPNTECSINNRQAQCQCLQGFIPSPLD----ARTCIRDSQ--GCRKDADCIGGSTCQGGQCRYSCRGQNDCLVGEQCSDSMCMISCISSQQCPSSQVCS----------NGVCS-IGCRNNENCPSDEVCISFKCVNPCQQEGACGPNALCKVSGKNVQCSCPERFAGVP-----TPQQGCVRIPARCPNGK-CPPQHTCKGGMCHWQCQINANCAKGER---------------CLDGLCTKVCHSDKNCLQGEICIDSTCQPGCNKEEDCRPGEICQGGSCVCAIGFINTPAGCQDINEC-ENSICHPSANCANIPGSFKCTCPRGLVGDPYTKGCKNPN-ECTTNRDCGPQLACAGDGSGYRKCVNPC-DRAKCGTNANCEVQKHKPFCKCFDKHVGNPSSPLGCTKVECEKNTDCNGDKVCQVANNRCIDACNIVSCGR-GTCSATNHVPSCRCEPGYI------------FSNNQCVDIDEC------------QNSPCEPTAICINTVGAYQCQCPPGTVPDAFGRCR------SSDQCLSDNDCPKTAACNNGKCQNPCEIPGSCGADAICTPANHRPM----CSCPPRTNGNPQVRCVPL----ECVSNSDCNSERTCVRNKCVDVCSLPNVCGQNTNCRATNHIARCFCLPGFTGEPTLGCTQLQLCTVEEQCPSGMLCSFGICSPPCQSSRDCLDNQLCNGGSCISKCQDSTQCPPLHSCQNGLCIQESRCSNDVDCDEVDTCVGRENGLFECEDACAGPVICGRNAKCTSLGHKAVCTCPDGFFGDPNNEKIGCQKKQCLVNGDCPGDSVCDKFICTQPPVTGTCTNDRNCQANEVCDKGQCKDPCGIQGSCGINAFCSVQSHRKQCVCPQDFTGNPEVECVRIPSTCYSSSDCPQPMQCADGICMPPCSSDENCAINERCLQGLCMLTCRVDNDCFLGHVCLNKMCIVGCR-----ANSDCPESNTCINNRCTDPCRGDTCGPNAKCQVVDHRAQCSCPPRFIPNP-----TPVVGCVKQPQTCSSNAQCPERQVCDGKFCKDVCFNDKNCLVNEVCDNGICKPL------CRRDDDCNSQEICKGVTCVL--GCRSSSNCPNDLACINNQCTDPCSSSTTSCGNNALCSVANHQAVCSCPAGLTGDPTRGCRHPV-QVCSSSTQCRQGYKCVGGVCAASCSSSNENCLLNEVCVKGTC------RPLCNSNADCSDGYICK-ERFCVA-GCSSDSQCKENQACINSQCQDPCLSSSCGQCAECSVSNHQAFCSCPASSTGNPSIGCLPLTYTCGKSSDCGRGQRCEDGV--CVKKCGSSSSCECGKTCVSGQCRQECTSSVPCPQGHLCKGGTC---------LPGCIGDNDCSDQELCLAGKCQNPCLLESTGCAKSAECRVTNHRPV----CLCPQGLQGNPKIECKRI----ECRTNSECEHTKSCIEGSCVNLCLLPNACGISAQCKSIRHQKKCSCPQKYVGNPNIEC---VLDKNECLSSPCGENAICQDLVGGYDCKCKAGCTGDGFSGCICGGPLIDPCRNARCGLDALCTVGGGIALCVCPNNKPNGDPLVECTSEKEGKCRADFDCPSSQSCKKGKCVDPCSLRAACGVNAICTVRIHKPRCECPQCHIGRPHVRCRPDPSCNTLPTKPQIVEPIGCQGDKDCSLGTACNRQNGKCFDPCGSTS-CDFNKKCIVSNHKPICKCKYSLVVNQQGVLTC-PDRQVECRTHNECPSNQACDNGRCKSPCDNPRICPAGKECQVLEHKAVCIC--TTGCNPEVS----ICLKDRGCPRGQACIGYQCKNPCEGTTCPGNTPCIVEDHKAVCKFCPPGFTTDANYGCIQGVGCRSSSECPSKQAC--QNKKCVNPCGL-GQCGATQDCEVANHLARCIDVPRCECSSRRDCLPGFTCEDCECVKNPDVDATVCEPSEGDCFEQCTINSDCPEDKYCDRF--KRKCISVCPGFCGDNTQCRFVNHNPI----CSCKQGFNGNPDVGCTFNQPPSNPCIPSPCGSDAICELDNGNPICSCPRGKTGNPFVRCIQDGK---KCRGNQCGPNSGCRMIADRPVCYCLPRFEGNPPAIPCVKPMKQCKPNP---CGANTECVVVNNVQRCTCKPGYTESVNT--IQGCVLISEPVISLCEPGPCGDNAECLVNDLGEDCRCNAGFGGNPFQGCTP-----------------------QNPCNPSPCGPNTECNEDRAGQIVCSCRRGYQGDPTS---DQGCKAECLRNSDCSRALACIAQKCIDPCP-GTCGIFAVCEVQNHNPICSCPPGTVGDPFSRCTQQPVVTEPPRPKDP-------CNPSPCGTNAQCRQQSGQAICQCIRDYQGDPL-IGC---------KPECLLSFDCPQDKACINSKCKDPCPGT--CGINAECQISN----HNAICKCHEGYTGDPFAQCSLIPGVINPP-------------EPADPCQP----SPCGPNAECRIVESRPVCTCFPGYYGAPPSCRP---ECVINSECAPALACINLKCSNPCV--GVCGINAKCDVVNHNPICSCPQGYIGDPFSSCRR---KPDEIRPTPKP-------DICNPNPCGPSAIRKPRNGVCTCACPPGLFGDPYLGCRP-ECILNSDCNRLQAC--SNNKCVDPCPGT--CGTNAECKIINHIPTCGCRKGFTGNAFEECTKPKPVQPVEGKEDPCGGNFCGAYSTQRVQGNRCVCSCLPGYFGFPPNCRPECVVSSDCSQNLACLSQKCSDPCPGRCGVNARCHVISHHPICTCPPDYEGDPFTSCQKRPSTVTPPPKPSNPCYPSPCGPYSSCKPLRDRPM----CSC-NGGYIGSPPNCR-----PECLLSSECQLTKACVQQHCVDPCP-GTCGANAECKVVNHNPICSCPRGYSGDPFFNCNKDPEVVTPSERPH-------------------IPCVP-SPCGPNALCREVNGHEACSCVAGYIGSP-PNCR----PECVLNAECPSNKACIQQKCSDPC-VGACGYNARCTAVNHNAICTCPTGYTGDPFS-----GCSLVPEVIREPP----EIIDPCNPSPCGANAECSSRNRAGACRCIKDHIGDPYVGCRP-ECLINTECPNHLACSQKKCRDPCPGTCGRNAQCSVRNHNPICTCNPGYSGDPTS-ACQIIP---------------PPQPIEVDTDPCDP----NPCGPNSQHREVNGV------CVCACAPTYQGTPPNCRPECVVS------SDCNQLTACVNQKCVDPCPGT--CGNNARCQVTNHNPICQCPPGFTGDPFSNCVRVVVTQPPPRPQPVDPCNPTPCGQFSQCRNSNEVAACSCLPNYIGIPPNCRPECSINAECPSNRACVRERCIDPC--PGACGPNAVCKVQNHQPICQCPTGFSGDPFRDCRRVVIPTT-------VRTTEV-IDPCEPSPCGANAQCRSRQRAGACTCVPGYFGDPYLACRP-ECVMNTDCPTNRAC--VNNKCVDPCPGV--CGINAICNANRHQPICTCLNGYTGDAITQCSLIPTGVPVVE----------------------EL-DPCDPN-PCGAYSQHKEQNGVCVCSCSRNMIGSPPNC-----RPECLVSSECSQVTACMQQTCRDPCP-GLCGRNAECRVTNHNPICTCQRGYQGDPFTGCTK-IPVTERVTQP--------PRPT--------NPCQPD-PCGRYAQCKNVRGVAACSCLVGYVGVP-----PNCRPECLIHSECPSNLACINEKCRDPCPGA-CGAYAECSVIKHNAVCRCQQGYEGDPFS-----SCRRVTTIPPRVSTERR---DPCQPSPCGANALCTERNFAAACTCIQDYFGDPYVACRP-ECTINADCPSNKACQRYKCVDPCPGLCGVNAQCKVINHIPTCTCDRGYVGDPF-TSCR--KEPLTIE-PVIADDPCD----------PNPCGPNS----NQPRQIGDRC-----HCTCLPDMIGS--------PPNCRPECVINSDCAQELACISRKCQDPCPGL--CGINAYCRVRNH 16473          

HSP 3 Score: 1241.87 bits (3212), Expect = 0.000e+0
Identity = 1619/5998 (26.99%), Postives = 2256/5998 (37.61%), Query Frame = 0
Query: 3113 NPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQ-----PVVDVGCRSNSECSPTLA-----CKNG-------EC--INPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEV-ECRKDTDCASNEKC--NLQNFRC----------LRLCSDNNNCAGFAN-------CEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINP---CSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGS--CIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVA---------CYLPITPNEPSL---VPGCTSDQDCPSYTACRNRQCIN--PCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQK------------CQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCK----PYECLSDPECPNHLKCENEKCV--------------DPCECAR-----------NADCDARNHRGICTCILDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNS--LHAHQGECNFDTDCPDNKACI-----------------NNQCKNPC--------------------------------------IVNKPCGSNAICITEIHRPVCKCPPGLAGDPH-----STCYRYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFT------------NNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGT-SECIVNEDCTSTDVCYEG---SCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDP---YTFCEEPGCKSDFECRDNQACINRECQNPCLFE----KCGLNAECNANGHRAICSCLQGHKGDPYSF----CKPYECLSDPECPNHLKCK-----NEKCVDPCE---CARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXX-XXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDER-----CVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIG-FIGDPYSSCVPASNEECNYDGDCSDNQVC--INNQCIDPCKEKSTCGKDAICRTENHRP------------------------------------------VCKCPQGQAGNPH-AYCYKYEC--KTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQ----CRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPS--GTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSL-SNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLC---------------IDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPET-SCRPPIKPECRYDTECPDHLACIQ-----QKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYK--FCDEPGCKSDFECPNSQACY--NKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPCACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTKDDCPFD------KTCLAKN-----CVDPCKN-TICGVRASCNAEHHQGICTCISGLQGNP---YIMCKEVECRRNNDCNFDEKCDL------------------------NSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQITIQTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQLPQKPE-CTKDSECANHLACIQQKCQDPCASPI-CGINARCRVKRHRAIC--VCLENYIGDPYSVCKEA----GCRSDYECPSDKACINRECQDPCL--LEQCGENAECLVNNHEARCKCLSSFKGDPYVKCR--------------SYECLVDSDCPRHLACENEKCVDPCKCAKYADCKVTNHQGYCTCNSYYTGDPYGLAXXXXXXXXXXXXXLDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDXXXXXXXXXXXXKG---------YSGKGDEKCTRVEEIKE----YGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKV-YTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQKCVNPCDT-TLCGTNAVCKSEYHQSICHCPRGLQGSPYVTC--KEIECKSD--------------IDCNTKEKCNLENY---ICVPLCTDP---KLCAVNANCEITNHKETCQCLPFY-YGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICE------------KIQIKTECKVDTDCARSDMC--KDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPCTSIACGRNAECRVTKHRALCS-CRSGYIGDP-YTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGIC------------SCIEGHKGDP----------YSFCKPYE------CLIDSDCPTNLQCNN--EKCVDPCK--CARNADCEIKNHRGYCTCQSDFTGDP-YGISCDPIPEPVLVEYECIEDKDCPSNQ-----ACIDTECINPCLT---------YEPCADKATCKVYDTLPLRTMTCSCIEGYTGKG-DVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCI--------------------------NDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAIC-ETKNHRAICMCPKGFAGDPHTSCY-NFECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTXXXXXXXXXXXXGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLSPKPECIVDQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGDPY---------------------TFCRPY---------------------------ECLVDRDCPDQLKCDHEKCVDPC--QCAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHSYECLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLXXXXXXXXXXXXXXXRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTP--------------------------------------------QPQCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPIT----------------------------------------IEPSLTAGCTIDTDCPSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCELPSEPECLVDDDCPSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEEPGCKSDIECPFDKACISRECQNPCLYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPCQ---CAKYAECDARN-------HRGIFPEPVEVE-GCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEYECLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSE------------TCLXXXXXXXXXXXXXCREGFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDACRIRLCGINAICVAENH 8478
            N C    C   A C        CTC  GY G  H  C++      P +   C  N+EC    A     CK G       EC  I+ C E+N CG ++ C        C C  GY GDPY+ C  +                   N+C+     + PCG  A+C+       C+CP    GDP+ SC                      +D C +  CG  A C  +     CECP G QGNP   C +V EC ++  C  N  C     +++C             CSD + C+  +N       C  +N    C CPP F G+G   C        +  CQ + DC     C +  C     +      C +  EC++   +               G+N +C+       C     C T+ +    S  C + C+   C  +  C +    + CVC  G+T + +           C  P T  E SL   +PG    Q  P YT     +CI+   C     C     C+ +     C CP G +  P N  +   V  C  + +CP +  C   K            C++PC ++ C  N+QC + N +  C C  GY         +P  +       KQ CI+    N CL + CG  A C        C C  G  GDP   CK      +C     CP+   C   KCV              D  EC R           NA C        C C   + G+P+             +   ++D +      CI   C N       C + AEC    T+      C C  GF  + D  C  I+  + T                         + PCG  A C  +    +C CP+G TGDP S    A+Q +C+ D DC  N+ C+                   +CK+PC                                          PCG  A C+ E     C+CP G  GDP+      T  R EC  +E+CP   +C +  CI+PC +  CG  A+C  E H + C+C  G + N                        +  KCT +C G   C   A C  +     C C    +G+ +     P    +   C     C    +CI  KC + C +             N C   +    +       +  I P     G         G  ++CI N +       YEG   S I+     KCG NA+C T      C C EG+ GNP  GC                        N+C N          K C   A+C        C C   + G+P   C P +       P   D            C+   CG NA+C        C C+  F GD     T C+   C ++ +C  N+ C + + Q  C+      +CG N+ C  + H + C C  G+ G+P        +   C +  +CP    C         CVDPC    C +   C  +N+R  C C P    +P    CE    P    + +C+ED+ C   +  I   C   C ++  C QN++C+  +        C C EG+ G  ++R       K + + D        CS  L    + C+ P  N   CG  A C   NH  QC C  G F GDP    +      C  + DC   + C  ++  C+D C    TCGK+A+C  E  RP                                           C CPQGQ G+P+ + C+        ++DCP   +C    C + C  + CG    C     Q+ C+C QG   +P      ++    CRKD DC     C  Q  +C   C G+N+C     C   +      C S         C      V    C+ + +C     CIS  C NPCQ    C P+  CK    +  + V C CP            C R+ +R  C   + C     C  G C   C + +NC     C   L   +C  HS         C      ++ +  PGC+  +DC     C+   C               I+ C E++ C   A C  I     CTCP G +G P T  C+ P   EC  + +C   LAC       +KC NPC    CG NA C VQ H+  C C   +VG+P     C +  C+ + +C   + C   N  C D C    CG+   C A NH   C C  G     Y F        +N C+D   C N+       C   A C        C C      D +G          +   +CL+D DCP    C + +C+NPC     C  +A C   +  P+    C C     G    +CV +E      C SNS+C     C   KC++ C+    CG    C   NH   C C PG+TG+P   C  T  + CT ++ C +   C    C+ PCQ ++ C  N LC+      + KC +     P   C    C+ +  C  D       TC+ +      C D C    ICG  A C +  H+ +CTC  G  G+P    I C++ +C  N DC  D  CD                         +  +C   C     C INAFC   +H+++C CP D  G+    C +  ++     C   SDCP+   C +  C  PC  +  C+ ++ C +  L  +T      C  +NDC    VCL+  CI                                                 +GC  +SDCP    C N +C +PC  D  C   A C+V++H+  CSC   +I +        ++P+ C+ +++C     C  + C+D C +   C +N  C       IC  +C  +   +   +CK      GCRS   CP+D ACIN +C DPC      CG NA C V NH+A C C +   GDP   CR               Y+C V   C    +  NE C+    C K     + N    C+ + Y   + + +A              D  C   +ACI  +CQ+PCL  S C   AEC V +     +   +             Y+      C R +  ++      C ++S       C+  QC   C    PC     C+                    +CLP     C  D+DC + E C+  +C++PC +  T C ++AEC  TNHR VC C +GL GNP  +C   EC+TN +C   K C+   CVN C     CG +A CKS  HQ  C CP+   G+P + C   + EC S                DC  K  C  + +   IC     DP     C ++A C +      C C      GD    CT ++E K    C+ D DCP   SC   +C DPC L   C V   C+V    P     CECP   I   +  C             +I     C+ D DC+    C  ++G C + C    C +N +C  S H+  C+C   Y+    ++  L  P ++      C   ++CP + AC N +C +PC     C    +C+V+ H+++C C  G           P    C +D  CP  +ACI  QC NPC    C  N  C V  H+A+C  C  G+  D  Y      GC+S  ECP +QAC N++C NPC   +CG    C   NH   C             C+ G   +            + C+P E      C I+SDCP +  C+    KC+  C   C  N  C   NH   C+C+  F G+P  G + +  P    +   C  D  C  +      +C   +  NP +             C   + C++    P+    C C+  + G    + CVK  P+    CK  N C  N  CV  N V  C                              PCGD + C   +    C+C+ G+ G+P+  C P N                       PCN  + CG N  C E +  + +C C +G+ GDP +      ECL N DC     CI++KCI PC  T CG  A C V+ HN +C CP G  G+P+  C +     +      + CN      N  C+++   +  AIC+  R  +      P IG               P C +  DCP   ACI+ +C++PC     C    +C + +        C+C +    +    C  I G++                    D C+ + CG  + C        C+C  GY G P            PS  P C  + +C    +C N  C NPC    +C INA C V+NH P+CSCP GYIG P + C+  P      D+  P  K  I       C+ N CG +A+ +  N   TC C  G  GDPY  C  P C  N +C   QAC N  C+DPC    CG NA+C   NH   C C++G  G+ +                      FC  Y                           EC+V  DC   L C  +KC DPC  +C   A C   +H   C C  DY GDP+  +C+  P  V      S                NPC    PC   + CK     P+    C+C  GY G                C    EC  + AC   +CV+PC     C + A+C V NH   C+CP G++GDP+          C+ D E           C     V +PC  NALC   N    C C  G IG P N     EC+ N +CP +K+C  + C +PC    CG NA C+   H A+C CP GY G P+  C L+               R+       CN +  C   A+C++R+    C C    IGD Y  C       +PEC I+++C  +LAC    C++PC     C  N QC V N  PI    C C  G+S      C+ + P                                            +P+C  SSDC     C    C+  C    CG+NA C+  +H+  C+C P F GDP   C+   +T                                        I P+    C+I+ +CPS  AC    CIDPC    C  NA C+V  H+P+C C  G+ G P   C     P  +   +              PC  S CG NA+C  +     C C+ GY GDPY  C  P C  + +CP ++AC++ +C +PC    CG+NA C    H+ +C C  G+ G+    C           P  +    E  +DPC    C  Y++   +N        R +   P      C +  +C    AC+ + C++PC     C  NAECRV N  P+    C+C+ GY G     C  I  P+           T    +     NPC  D PC + A+C+  R  + C+C  G  G P +        EC   S+C  N AC+  +C DPC     CG  A C  I H  VC+CQ G  GDP S C     +           VS +  DPC  + CG  A C        C C +   G P++ C+  EC    DC +N+ C    YKC   C     C   A C   NH   C C    +G+ F  C     T EP   I DD              PC   NPC P+             TCL                   +G   +C     +PEC  +SDC     C S  C D C   LCGINA C   NH
Sbjct:  559 NECKYRPCDVFAHCTNNIGSYACTCFPGYEGDGHN-CQDIDECTIPELAAKCVENAECCNLPAEYVCKCKPGFEGDGQVECRDIDECRESNACGANSLCSNFAGNYTCSCQEGYAGDPYTGCIDL-------------------NECL-----SNPCGAGAKCINQYGGYLCECPAGAKGDPYTSCGT--------------------LDQCQSKPCGLNAKCYNDGGSYRCECPQGFQGNPKQQCLDVNECLRNP-CGQNAACINTEGSYQCACKQGLTGDPFTACSDTDECSAQSNPCGSNAVCRNTNPGFVCECPPGFSGNGNVACEAT---EVRTLCQSNFDCTNNAVCQKGECLCRSGFTAAGTLCLDVDECRSTPGI--------------CGANAVCRNTLGSFTCS----CLTSFVGSPPSVPCSEPCKGVTCSQHAYCKAEQKDAYCVCEDGWTYDPKNIAAGCIDVNECGAPGTCGENSLCTNLPGSFICQCKPGYTGNPQVRCIDIDECKSVSTCGFGTTCENLPGSYKCGCPSGSVADPNNPAECISVKTCQKNNDCPGNAFCSPSKMCVCPEPNQGPNCESPCENVFCAANSQCTLINGQPRCMCHQGY---------QPAGQG------KQGCIDI---NECLGQPCGKGAFCENTPGGYRCKCPSGLSGDPNIACKGEIEAIQCSVSKPCPSGELCSQGKCVCQRGFQRESSGLCRDLDECTRASASEEPACGLNAFCKNLPGSFDCECPAGYNGNPFVKCSSCNGPDCGCQPPYSQDGE-----NCILAGCKN----KGDCSEGAECI---TIAGGVSYCACPSGFNVQPDGTCADIDECLST-------------------------SRPCGFGALCENKIGSFSCVCPIGTTGDPYSGVCSANQAQCSRDNDCRPNEKCVEPGQCICPPPFFSDTTDGGKCKSPCERFMCGINADCSPTNPPQCLCKAGYNGDPIQGCLDVDECAQNPCGPEARCLNEAGSYKCQCPKGTRGDPYLAGCKGTPSRVECTRDEECPGLLSCQASVCINPCSSIPCGENAVCIPENHAAWCRCKVGYKEN------------------------SEGKCTSMCDGV-ICGLNAQCIISPTGPTCACSKGTLGNPF-----PGGSCVPETCSGANPCPQPLSCISGKCRERCDSFSCGLNAACDGNTNKCFCRE--GFVGDGNFLCMPPILPPICTPGCGSHSHCAYGIPNQCICNSEFGGNP--YEGCSPSTIDIVQDCKCGSNAECVTDGTSKVCTCKEGFDGNPFIGCF---------------------DINECTN----------KICGKNAVCINTIGNYDCRCELDYKGNPFEACFPEQ-------PTIADL-----------CTEKQCGPNAVCSV----GQCLCLTGFKGDAEDLRTGCQSSTCSNNLDCGYNEICQSVKGQYRCIDACGNVQCGPNSRCVTDNHHSTCICQDGYSGNPLDLSGGCVREVTCKTQNDCPTGSVCSINISGKRSCVDPCRIMSCGKYEICSVKNNRPFCQCSPTHIRNPVTGQCEIASVPSCSNDGQCSEDQVCRPDSLGI-LRCTPICQLFT-CPQNSQCRASN----HQGFCQCFEGYNGNPNDRTGCSLISKDQCLSDAQCSEEEVCSLTL----KKCI-PACNTIVCGPQAVCITQNHSPQCTCPPGKFKGDPNDPVLGCKAVSCLTNTDCPPTKFCDRLSYTCMDVCT-ADTCGKNAVCLPEQQRPKCSCPPGTKPDPLPEVRCSTLNACSKKPCHSSASCSSTTTGFSCSCPQGQVGDPNKSGCFPEGSCPNGDRDCPDKSICIRGMCKNICYDS-CGPNTECSINNRQAQCQCLQGFIPSPLDARTCIRDSQGCRKDADCIGGSTC--QGGQCRYSCRGQNDCLVGEQCS--DSMCMISCISSQQCPSSQVCSNG---VCSIGCRNNENCPSDEVCISFKCVNPCQQEGACGPNALCK----VSGKNVQCSCPERFAGVPTPQQGCVRIPAR--CPNGK-CPPQHTCKGGMCHWQCQINANCAKGERCLDGLCTKVC--HSDKN------CLQGEICIDSTCQPGCNKEEDCRPGEICQGGSCVCAIGFINTPAGCQDINEC-ENSICHPSANCANIPGSFKCTCPRGLVGDPYTKGCKNPN--ECTTNRDCGPQLACAGDGSGYRKCVNPCDRAKCGTNANCEVQKHKPFCKCFDKHVGNPSSPLGCTKVECEKNTDCNGDKVCQVANNRCIDACNIVSCGR-GTCSATNHVPSCRCEPG-----YIF-------SNNQCVDIDECQNS------PCEPTAICINTVGAYQCQCPPGTVPDAFGRC--------RSSDQCLSDNDCPKTAACNNGKCQNPCEIPGSCGADAICTPANHRPM----CSCPPRTNGNPQVRCVPLE------CVSNSDCNSERTCVRNKCVDVCSLPNVCGQNTNCRATNHIARCFCLPGFTGEPTLGC--TQLQLCTVEEQCPSGMLCSFGICSPPCQSSRDCLDNQLCNGGSC--ISKCQDSTQCPPLHSCQNGLCIQESRCSNDVDCDEVDTCVGRENGLFECEDACAGPVICGRNAKCTSLGHKAVCTCPDGFFGDPNNEKIGCQKKQCLVNGDCPGDSVCDKFICTQPPVTGTCTNDRNCQANEVCDKGQCKDPCGIQGSCGINAFCSVQSHRKQCVCPQDFTGNPEVECVRIPST-----CYSSSDCPQPMQCADGICMPPCSSDENCAINERC-LQGLCMLT------CRVDNDCFLGHVCLNKMCI-------------------------------------------------VGCRANSDCPESNTCINNRCTDPCRGDT-CGPNAKCQVVDHRAQCSCPPRFIPNPTPVVGCVKQPQTCSSNAQCPERQVCDGKFCKDVCFNDKNCLVNEVC----DNGICKPLCRRDDDCNSQEICKGVTCVLGCRSSSNCPNDLACINNQCTDPCSSSTTSCGNNALCSVANHQAVCSCPAGLTGDPTRGCRHPVQVCSSSTQCRQGYKC-VGGVCAASCSSSNENCLLNEVCVKGTCRPLCNSNADCS-DGYICKERFCVAGCSS----------DSQCKENQACINSQCQDPCLSSS-CGQCAECSVSNHQAFCSCPASSTGNPSIGCLPLTYTCGKSSDCGRGQRCEDGVCVKKCGSSSSCECGKTCVSGQCRQECTSSVPCPQGHLCK------------------GGTCLP----GCIGDNDCSDQELCLAGKCQNPCLLESTGCAKSAECRVTNHRPVCLCPQGLQGNPKIECKRIECRTNSECEHTKSCIEGSCVNLCLLPNACGISAQCKSIRHQKKCSCPQKYVGNPNIECVLDKNECLSSPCGENAICQDLVGGYDCKCKAGCTGDGFSGCICGGPLIDPCRNARCGLDALCTVGGGIALCVCPNNKPNGDPLVECTSEKEGK----CRADFDCPSSQSCKKGKCVDPCSLRAACGVNAICTVRIHKP----RCECPQCHIGRPHVRCRPDPSCNTLPTKPQIVEPIGCQGDKDCSLGTACNRQNGKCFDPCGSTSCDFNKKCIVSNHKPICKCK--YSLVVNQQGVLTCPDRQVE----CRTHNECPSNQACDNGRCKSPCDNPRICPAGKECQVLEHKAVCICTTGC---------NPEVSICLKDRGCPRGQACIGYQCKNPCEGTTCPGNTPCIVEDHKAVCKFCPPGFTTDANYGCIQGVGCRSSSECPSKQACQNKKCVNPCGLGQCGATQDCEVANHLARCIDVPRCECSSRRDCLPGFTCEDCECVKNPDVDATVCEPSEGDCFEQCTINSDCPEDKYCDRFKRKCISVCPGFCGDNTQCRFVNHNPICSCKQGFNGNPDVGCTFNQPPSNPCIPSPCGSDAICELDNGNPICSCPRGKTGNPFVRCIQDGKKCRGNQCGPNSGCRMIADRPV----CYCLPRFEGNPPAIPCVK--PMKQ--CKP-NPCGANTECVVVNNVQRCTCKPGYTESVNTIQGCVLISEPVISLCEPGPCGDNAECLVNDLGEDCRCNAGFGGNPFQGCTPQN-----------------------PCN-PSPCGPNTECNEDRAGQIVCSCRRGYQGDPTSDQGCKAECLRNSDCSRALACIAQKCIDPCPGT-CGIFAVCEVQNHNPICSCPPGTVGDPFSRCTQQPVVTEPP-RPKDPCNPSPCGTNAQCRQQ---SGQAICQCIRDYQG----DPLIG-------------CKPECLLSFDCPQDKACINSKCKDPC--PGTCGINAECQISN----HNAICKCHEGYTGDPFAQCSLIPGVINPPEP--------------ADPCQPSPCGPNAECRIVESRPVCTCFPGYYGAP------------PSCRPECVINSECAPALACINLKCSNPCV--GVCGINAKCDVVNHNPICSCPQGYIGDPFSSCRRKP------DEIRPTPKPDI-------CNPNPCGPSAIRKPRNGVCTCACPPGLFGDPYLGCR-PECILNSDCNRLQACSNNKCVDPCP-GTCGTNAECKIINHIPTCGCRKGFTGNAFEECTKPKPVQPVEGKEDPCGGNFCGAYSTQRVQGNRCVCSCLPGYFGFPPNCRPECVVSSDCSQNLACLSQKCSDPCPGRCGVNARCHVISHHPICTCPPDYEGDPF-TSCQKRPSTVTPPPKPS----------------NPCYP-SPCGPYSSCKPLRDRPM----CSCNGGYIGSPPN--------CRPECLLSSECQLTKACVQQHCVDPC--PGTCGANAECKVVNHNPICSCPRGYSGDPFF--------NCNKDPEVVTPSERPHIPC-----VPSPCGPNALCREVNGHEACSCVAGYIGSPPNC--RPECVLNAECPSNKACIQQKCSDPCVGA-CGYNARCTAVNHNAICTCPTGYTGDPFSGCSLVPEVI-----------REPPEIIDPCNPS-PCGANAECSSRNRAGACRCIKDHIGDPYVGC-------RPECLINTECPNHLACSQKKCRDPCPGT--CGRNAQCSVRNHNPI----CTCNPGYSGDPTSACQIIPPPQPIEVDTDPCDPNPCGPNSQHREVNGVCVCACAPTYQGTPPNCRPECVVSSDCNQLTACVNQKCVDPC-PGTCGNNARCQVTNHNPICQCPPGFTGDPFSNCVRVVVTQPPPRPQPVDPCNPTPCGQFSQCRNSNEVAACSCLPNYIGIPPNCRPECSINAECPSNRACVRERCIDPCPGA-CGPNAVCKVQNHQPICQCPTGFSGDPFRDCRRVVIPTTVRTTEV-----------IDPCEPSPCGANAQCRSRQRAGACTCVPGYFGDPYLACR-PECVMNTDCPTNRACVNNKCVDPCP-GVCGINAICNANRHQPICTCLNGYTGDAITQCSLI--------PTGVPVVEE--LDPCDPNPCGAYSQHKEQNGVCVCSCSRNMIGSPPNCRPECLVSSECSQVTACMQQTCRDPCPGL--CGRNAECRVTNHNPI----CTCQRGYQGDPFTGCTKI--PV-----------TERVTQPPRPTNPCQPD-PCGRYAQCKNVRGVAACSCLVGYVGVPPNC-----RPECLIHSECPSNLACINEKCRDPC--PGACGAYAECSVIKHNAVCRCQQGYEGDPFSSCRRVTTIPPR--------VSTERRDPCQPSPCGANALCTERNFAAACTCIQDYFGDPYVACRP-ECTINADCPSNKACQR--YKCVDPC--PGLCGVNAQCKVINHIPTCTCDRGYVGDPFTSCRKEPLTIEP--VIADD--------------PCDP-NPCGPNSNQPRQIGDRCHCTCLPD----------------MIGSPPNC-----RPECVINSDCAQELACISRKCQDPCP-GLCGINAYCRVRNH 16473          

HSP 4 Score: 1193.33 bits (3086), Expect = 0.000e+0
Identity = 1612/5893 (27.35%), Postives = 2225/5893 (37.76%), Query Frame = 0
Query: 2217 LKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNCQPPERPECRVDAECPLDRACIHQKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLFEKCGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVND------------------KCVDPCECARN-----ADCKARNHRGYCTCIPNFTGDPYGXXXXXXXXXXXXXXXXNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCI---------NPCIKDNPCHTS-------AQCSVRSHKALCSCPVGYAGDPYSF-----CKKILTHECNYDNDCQRTQACI--ENQCSEP------------CSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYCYKY-ECKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVE-CRNDNDCASNEKCDLRYL----------KCSALCSDNNLCANNAKCEAINHQERCVCPSQF--TGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTC-------RKTCSI---------------NSCGANAVCTPVIHGFKCNCFDGYTGDPN---SACYQPVLNVEP--------LLEPGCSNDDDCP------------SYTTCRNRQCINP----------CSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLACI-----------------NRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPY-SNCAPI-QDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGD----------------------------------------PHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCK--------EVECRKDTDCASN----------------EKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCK--------DPCFYINP-----CSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVE---CEYNDDCSTNDICQDGS----CIDACRVNKCGANTRCISSFHRSECVCLQGYTGN---AQVACYLPITPNEPSLVPGCTSDQDCPSYTACR-----NRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSP-TNDCKKPIVPECLSDPEC-------PDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDP--YTACE---EPGCKSDFECPNKQAC--INRECQNPCLFENCGINAECSPENHRAVCAC----LKGHKGDPYSFCKPYECLSDPECPNHLKCE--NEKCVDPCE---CARNADCDARNHRGICTCILDFTGDP-----------------------------YGIACXXXXXXXXXXXXC-------NEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFT-GKGDER-CVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNF----DTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAG--DPHSTCYRYECK-TNEDCPFDKACASEKCIDPCQTTL-CGSKAICNVEYHQSSCKCPAG-LQGNPYINCK-ELECRKHQDCRDNEKCDMTTYKC------TPL-CTGSNKCASK-----ATCEATNHQEKCFCPSNYIGDGYS-FCSLPIEPAIEPECRVDQDCQSVFACIRD-----KCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIG---SSGQCERVEGTSECIVNEDCTSTDVCYEGS--CINACLIKKCGFNAQCSTILHDAQCKCFEGYTGN----------------PESGCNIAMVHVEPSLEPG--------------CSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTI-TCGRNAICQARNHRAICSCIKSFSGDPYTFCEE----------------------PGCKSDFECRDNQACINRECQNPC-----------------------------------------LFE---------KCGLNAECNANGHRAICSCLQGHKGDPYS---FCKPYECLSDPECPN--------------------------HLKCKNEKCVDPC----ECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDP--YSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYEC----KTNQDCPLDKVCTSEKCVDPCD--TTQCGLKALCRTEYHQSICECPQGLQGNPYVECKS-VQ-CRKDQDCRDNEKCNLQNFKCSPLCLGKN-NCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSL------TPGCSNHQDCPSYTSCRNRLCIDPCI-EDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSV-TCGLNAVCRVQNHRAVCSCLGGYVGDP-------YKFCDEPGCKSDFECPNSQACYNKNCQ------------------DPCLFDECGQNAKCFANNHRSMCVC-NEGHKGDPYTFC---KPYDCLVDNDCLDHLRCTNTKCVDPC----ACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIP-------EPLKVE-YECLADKDCPSKEVCYDQ--ECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCK-CPNGLAGDPHSYCYK-YECVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNP--CSSSQECRIAELSQITIQTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCT------RVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVD----------KPCASTAICKVINHKPFCSCRDGYIGSSET--SCQLPQKP--------ECTKDSEC------------ANHLACIQQKC--QDPCASPICGINARCRVKRH-RAICVCLENYIGDPYS--VCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCRSYECLVDSDCPRHLACENEKCVDPCKCAKYADCKVTNHQGYCTCNSYYTGDPYGLAXXXXXXXXXXXXXLDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDXXXXXXXXXXXXKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKE-----ESKK------------------------------------KPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSN-------------------------------------------EIISENG--ICEKIQIKTECKVDTDCARSDMCKDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPC--KCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEY----------------------------------------ECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNFECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCM----------------------------------------EIVKPPS-SPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTXXXXXXXXXXXXGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTEC------------------QLSP------------------------------KPECIVDQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVCEX-------------------------------------------------PGCKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPRNH 7265
            L T    C+ G  + +   C        CS+ +D             N C    C + A C  N     C+C+PGY GD  N C        P L+                           + C   A C  +  + VC C  GF G            ECR   EC    AC              G N+ C        C+C +GY GDPY+                  CI+    N CL   CG   +C  +    +C C +G KG  Y +C   +  +   C  +  C ND                  +C+D  EC RN     A C        C C    TGDP+                C++  +C +Q+               PC  NA C+  +T P     C C  GF+G G+  C   E  + T C+S+ +C     C+ G+C+           C+  + C ++       A C        CSC   + G P S      CK +   +  Y    Q+   C+  +    +P            C     CG+ ++C N     +C+C  G++G+P   C    ECK+ + C F                  GT  E +   ++  C        N    C  V+ C+ +NDC  N  C    +           C + C +N  CA N++C  IN Q RC+C   +   G G   C +I                           N C+  +PC +   C+   N P     C+CPSG        CK    + +C V+  C   E+C  G C       R++  +                +CG NA C  +   F C C  GY G+P    S+C  P    +P         +  GC N  DC             SY  C +   + P           S   PC   A+C+       C C  G  G P +     N  +C  D +C  +  C+                   KC++PC    CG NA C    +   C C +GY G P            GC    EC+                 NPCG  A+C  +     C CP G  GDPY + C      +EC  D +C    +C  + CI+PC+ + PCG NA C+  NH ++C+C   +  +                                        P  SC    C  ++ CP   +C++ KC + CD+  CG  A C    +K  C C  G  G+    C            C   + CA                  E C+      ++ C     C   A C      + C C   F+G+ +  C + I +     C  +  C  T    +  C+        + CF   P     C+E Q C   A   +    C+       G  G  +++ T  +   C  N DC  N+ICQ       CIDAC   +CG N+RC++  H S C+C  GY+GN       C   +T         C +  DCP+ + C       R C++PC     C     C V  ++  C C    I +P T  C+   VP C +D +C       PD L  +  +C   C   TC +N+QCR  NH+  C CF GY G+P   T C    +  C SD +C  ++ C    ++C   C    CG  A C  +NH   C C     KG   DP   CK   CL++ +CP    C+  +  C+D C    C +NA C     R  C+C      DP                             +  +C         +  C       N DRDCP ++ CI   C N C  Y  C  N EC + +    R   C C++GF     D R C++       GCR + +C     C+   C   C   N C    QCS      +C   +     P+S     G C+     + +CP ++ CI+ +C NPC     CG NA+C        C CP   AG   P   C R   +  N  CP    C    C   CQ    C     C        C      LQG   I+   +  C K +DCR  E C   +  C      TP  C   N+C +      A C       KC CP   +GD Y+  C  P E      C  ++DC    AC  D     KC +PC     C     C+V    P     C C  D ++G   S   C +VE    C  N DC    VC   +  CI+AC I  CG    CS   H   C+C  GY  +                P + C   +   +    PG              C  ++DCP    C N KC +PC     C   AIC   +H  +C+CP    G+P   C P    EC  + DCN    C+R KC + CS    CG+N  C+A NH A C C+  F+G+P   C +                      P C+S  +C DNQ C    C + C                                         LFE          CG NA+C + GH+A+C+C  G  GDP +    C+  +CL + +CP                           +  C   +C DPC     C  NA C  ++HR  C C  DFTG+P  + C  IP        C    DCP    C +  C  PC   + C  N  C     +    +   C  G         V +  +  VG R  S+C  +       C +PC  +  CG  AKCQV +HR+QC C   FI +P     CV    + C+ +  C + QVC    C D C     C  + +C     +P+C+  +    N    C    C    +++ +CP D  C + +C DPC   TT CG  ALC    HQ++C CP GL G+P   C+  VQ C     CR   KC      C+  C   N NC    +C     +  C+  +  S DGY  C E+  +   A C +D  C+ + ACI+  CQ+PC L+  C    EC   +   F    C CP+ +T   +  C  +     C K  DC     C +G CV  C  S+   + EC  T       C SG     R  C   +P  +  L       PGC    DC     C    C +PC+ E T CA  A CRV NH+ VC CP G  G+P+  C+   + ECR ++EC    +CI+  C N C     CG++A C+   H+  CSC   YVG+P          C    C  +  C +    Y+  C+                  DPC    CG +A C      ++CVC N    GDP   C   K   C  D DC     C   KCVDPC    AC   A C  R HK  C C     G P+ + C P P       +P  VE   C  DKDC     C  Q  +C +PC     C  N +C V +  P      +C   Y+   ++Q V   P   + C++++EC  N AC+ G+C +PC   R C +  +C V  H+  C C+ G   +            C  D  C   + CI YQC +PC+    C  N  C  E H+ VCK CP G   D +  C +   C +  +CP  + C  K CV+PC    CG    C   +H   C           I     EC    DC       L  F C                      E C C  +   D  + C+         +C ++SDCP+ + C  +R +  C    P  C  + +CR    + I    Q     N D   T    +    + C   PCG+ A C  +     C+C  G TGNP  +C       R     P     GC   +D P    C  +   NP A+            PC +   C V+N+   C+C+ GY  S  T   C L  +P         C  ++EC            A       Q C  Q+PC    CG N  C   R  + +C C   Y GDP S   CK A C  + +C    ACI ++C DPC    CG  A C V NH   C C     GDP+ +C     + +   P+          +P  C   A C+  + Q  C C   Y GDP            + EC L  DCP+ KACI  +C++PC     C  NAEC++ +   +        +GY+G    +C+ +  +            P  A        PC + +PC   A C+++    +C+C  G  G P  SC P    EC  +S+C  + +CI+ +C +PC     CG NA+C   NH  +C C +G IG+P S C     K +E  P  K  +       C+   CG +A+ K       C CP GL G PY+ C+  EC  + DCN  + C+  N  CV  C  P  C  NA C+I NH  TC C   + G+ +  CTK +     E K+                                    +P+C +  DC Q ++C+  +C DPC     C V  +C V +  P+    C CP +                                            + S NG  I      + EC + ++C  +  C   +CV+ C    CG N+ECK   H   C C RGY+GDP   CN    +   S  P          H  C          +  PC   A C+ V+    C+C  GYIGSP        +PEC  + ECP NKACIQQ+C +PC   ACG NA C    H A+C+C +GY GDP++     GC    E  ++      E  +PC+   CG NA CS +N  G C CI+ H GDPY  C+P ECLI+++CP +L C+ +KC DPC   C RNA C ++NH   CTC   ++GDP   +C  IP P  +E                                         EC+   DC    AC++ +C++PC     C + A C+V +  P+    C C  G+TG     CV++  ++    +   +      C          N +PCG FS C+  N  + C C   YIG P     P    EC  + EC SN+ACV  +C DPC  A  CG NA+C+ +NH+ IC CP GF+GDP   C                  + + I PC  + CG  A+C        C C  G  G+PY+ C+  EC  ++DC  N  C     KC   C     C  +AIC A RH  ICTC   + GD  + C                                          I  PP+  P C V  +C    AC+ + C++PC     C    +C V +  P     C C      +    C  I  + E  T    P           + C+ + CG Y+ C      + CSC+ GY G P            P+  P C    +CPS  +C N  C +PC     C   A C VI H  VC C  GY G P + C                  Q SP                              +PEC ++ DCP  KAC   KC  PC   +CG+NA C+  NH  TC C  GYVGDP+T C                                                   P C  N +C    ACI++ C DPC    CG NA C  RNH
Sbjct:  457 LYTTGHRCINGACLDSQCHCNDGWGGKGCSMPDD-------------NECKYRPCDVFAHCTNNIGSYACTCFPGYEGDGHN-CQDIDECTIPELA---------------------------AKCVENAECCNLPAEYVCKCKPGFEGDGQV--------ECRDIDECRESNAC--------------GANSLCSNFAGNYTCSCQEGYAGDPYT-----------------GCIDL---NECLSNPCGAGAKCINQYGGYLCECPAGAKGDPYTSCGTLDQCQSKPCGLNAKCYNDGGSYRCECPQGFQGNPKQQCLDVNECLRNPCGQNAACINTEGSYQCACKQGLTGDPF--------------TACSDTDECSAQS--------------NPCGSNAVCR--NTNP--GFVCECPPGFSGNGNVACEATE--VRTLCQSNFDCTNNAVCQKGECLCRSGFTAAGTLCLDVDECRSTPGICGANAVCRNTLGSFTCSCLTSFVGSPPSVPCSEPCKGVTCSQHAYCKAEQKDAYCVCEDGWTYDPKNIAAGCIDVNECGAPGTCGENSLCTNLPGSFICQCKPGYTGNPQVRCIDIDECKSVSTCGF------------------GTTCENLPGSYKCGCPSGSVADPNNPAECISVKTCQKNNDCPGNAFCSPSKMCVCPEPNQGPNCESPC-ENVFCAANSQCTLINGQPRCMCHQGYQPAGQGKQGCIDI---------------------------NECL-GQPCGKGAFCE---NTP-GGYRCKCPSGLSGDPNIACKGEIEAIQCSVSKPCPSGELCSQGKCVCQRGFQRESSGLCRDLDECTRASASEEPACGLNAFCKNLPGSFDCECPAGYNGNPFVKCSSCNGPDCGCQPPYSQDGENCILAGCKNKGDCSEGAECITIAGGVSYCACPSGFNVQPDGTCADIDECLSTSRPCGFGALCENKIGSFSCVCPIGTTGDPYSGVCSANQAQCSRDNDCRPNEKCVEPGQCICPPPFFSDTTDGGKCKSPCERFMCGINADCS-PTNPPQCLCKAGYNGDPIQ----------GCLDVDECA----------------QNPCGPEARCLNEAGSYKCQCPKGTRGDPYLAGCKGTPSRVECTRDEECPGLLSCQASVCINPCS-SIPCGENAVCIPENHAAWCRCKVGYKENSEGKCTSMCDGVICGLNAQCIISPTGPTCACSKGTLGNPFPGGSCVPETCSGANPCPQPLSCISGKCRERCDSFSCGLNAACDGNTNK--CFCREGFVGDGNFLCMPPILPPICTPGCGSHSHCAYGIPNQCICNSEFGGNPYEGCSPSTIDIVQDCK----CGSNAECVTDGTSKVCTCKEGFDGNPFIGCFD-INECTNKICGKNAVCINTIGNYDCRCELDYKGNPFEACFPEQPTIADLCTEKQ-CGPNAVCSVGQCLCL------TGFKGDAEDLRTGCQSSTCSNNLDCGYNEICQSVKGQYRCIDACGNVQCGPNSRCVTDNHHSTCICQDGYSGNPLDLSGGCVREVT---------CKTQNDCPTGSVCSINISGKRSCVDPC-RIMSCGKYEICSVKNNRPFCQCSPTHIRNPVTGQCEIASVPSCSNDGQCSEDQVCRPDSLGIL--RCTPICQLFTCPQNSQCRASNHQGFCQCFEGYNGNPNDRTGCSLISKDQCLSDAQCSEEEVCSLTLKKCIPACNTIVCGPQAVCITQNHSPQCTCPPGKFKGDPNDPVLGCKAVSCLTNTDCPPTKFCDRLSYTCMDVCTADTCGKNAVCLPEQQRPKCSCPPGTKPDPLPEVRCSTLNACSKKPCHSSASCSSTTTGFSCSCPQGQVGDPNKSGCFPEGSCPNGDRDCPDKSICIRGMCKNIC--YDSCGPNTECSINN----RQAQCQCLQGFIPSPLDARTCIRDS----QGCRKDADCIGGSTCQGGQCRYSCRGQNDCLVGEQCSDSMCMISC---ISSQQCPSSQVCSNGVCSIGCRNNENCPSDEVCISFKCVNPCQQEGACGPNALCKVSGKNVQCSCPERFAGVPTPQQGCVRIPARCPNGKCPPQHTCKGGMCHWQCQINANCAKGERCLDGLCTKVCHSDKNCLQGEICIDSTCQPGCNKEEDCRPGEICQGGSCVCAIGFINTPAGCQDINECENSICHPSANCANIPGSFKCTCPRGLVGDPYTKGCKNPNE------CTTNRDCGPQLACAGDGSGYRKCVNPC-DRAKCGTNANCEVQKHKPF----CKC-FDKHVGNPSSPLGCTKVE----CEKNTDCNGDKVCQVANNRCIDACNIVSCG-RGTCSATNHVPSCRCEPGYIFSNNQCVDIDECQNSPCEPTAICINTVGAYQCQCPPGTVPDAFGRCRSSDQCLSDNDCPKTAACNNGKCQNPCEIPGSCGADAICTPANHRPMCSCPPRTNGNPQVRCVPL---ECVSNSDCNSERTCVRNKCVDVCSLPNVCGQNTNCRATNHIARCFCLPGFTGEPTLGCTQLQLCTVEEQCPSGMLCSFGICSPPCQSSRDCLDNQLCNGGSCISKCQDSTQCPPLHSCQNGLCIQESRCSNDVDCDEVDTCVGRENGLFECEDACAGPVICGRNAKCTSLGHKAVCTCPDGFFGDPNNEKIGCQKKQCLVNGDCPGDSVCDKFICTQPPVTGTCTNDRNCQANEVCDKGQCKDPCGIQGSCGINAFCSVQSHRKQCVCPQDFTGNPE-VECVRIPST------CYSSSDCPQPMQCADGICMPPCSSDENCAINERCLQGLCMLTCRVDNDCFLGH--------VCLNKMCIVGCRANSDCPESNTCINNRCTDPCRGDT-CGPNAKCQVVDHRAQCSCPPRFIPNPTPVVGCV-KQPQTCSSNAQCPERQVCDGKFCKDVCFNDKNCLVNEVCDNGICKPLCR--RDDDCNSQEICKGVTCVLGCRSSSNCPNDLACINNQCTDPCSSSTTSCGNNALCSVANHQAVCSCPAGLTGDPTRGCRHPVQVCSSSTQCRQGYKC--VGGVCAASCSSSNENCLLNEVCVKGTCRPLCNSNADCS-DGY-ICKERFCV---AGCSSDSQCKENQACINSQCQDPC-LSSSCGQCAECSVSNHQAF----CSCPASSTGNPSIGCLPLTY--TCGKSSDCGRGQRCEDGVCVKKCGSSS---SCECGKT-------CVSGQC---RQECTSSVPCPQGHLCKGGTCLPGCIGDNDCSDQELCLAGKCQNPCLLESTGCAKSAECRVTNHRPVCLCPQGLQGNPKIECK---RIECRTNSECEHTKSCIEGSCVNLCLLPNACGISAQCKSIRHQKKCSCPQKYVGNPNIECVLDKNECLSSPCGENAICQDLVGGYDCKCKAGCTGDGFSGCICGGPLIDPCRNARCGLDALCTVGGGIALCVCPNNKPNGDPLVECTSEKEGKCRADFDCPSSQSCKKGKCVDPCSLRAACGVNAICTVRIHKPRCECPQCHIGRPH-VRCRPDPSCNTLPTKPQIVEPIGCQGDKDCSLGTACNRQNGKCFDPCGSTS-CDFNKKCIVSNHKP------ICKCKYSLVVNQQGVLTCPDRQVECRTHNECPSNQACDNGRCKSPCDNPRICPAGKECQVLEHKAVCICTTGCNPE---------VSICLKDRGCPRGQACIGYQCKNPCEGTT-CPGNTPCIVEDHKAVCKFCPPGFTTDANYGCIQGVGCRSSSECPSKQACQNKKCVNPCGLGQCGATQDCEVANHLARC-----------IDVPRCECSSRRDC-------LPGFTC----------------------EDCECVKNPDVDA-TVCEPSEGDC-FEQCTINSDCPEDKYC--DRFKRKCISVCPGFCGDNTQCRFVNHNPICSCKQGF-NGNPDVGCT---FNQPPSNPCIPSPCGSDAICELDNGNPICSCPRGKTGNPFVRCIQDGKKCRGNQCGPNS---GCRMIADRP-VCYCLPRFEGNPPAIPCVKPMKQCKPNPCGANTECVVVNNVQRCTCKPGYTESVNTIQGCVLISEPVISLCEPGPCGDNAECLVNDLGEDCRCNAGFGGNPFQGCTPQNPCNPSPCGPNTECNEDRAGQIVCSCRRGYQGDPTSDQGCK-AECLRNSDCSRALACIAQKCIDPCP-GTCGIFAVCEVQNHNPICSCPPGTVGDPFSRCTQQPVVTEPPRPKDPC-------NPSPCGTNAQCRQQSGQAICQCIRDYQGDPL--------IGCKPECLLSFDCPQDKACINSKCKDPCP--GTCGINAECQISNHNAICKCH----EGYTGDPFAQCSLIPGVIN---------PPEPA-------DPC-QPSPCGPNAECRIVESRPVCTCFPGYYGAP-PSCRP----ECVINSECAPALACINLKCSNPCVGV--CGINAKCDVVNHNPICSCPQGYIGDPFSSCRR---KPDEIRPTPKPDI-------CNPNPCGPSAIRKPRNGVCTCACPPGLFGDPYLGCRP-ECILNSDCNRLQACS--NNKCVDPC--PGTCGTNAECKIINHIPTCGCRKGFTGNAFEECTKPKPVQPVEGKEDPCGGNFCGAYSTQRVQGNRCVCSCLPGYFGFPPNCRPECVVSSDCSQNLACLSQKCSDPCPGR--CGVNARCHVISHHPI----CTCPPDYEGDPFTSCQKRPSTVTPPPKPSNPCYPSPCGPYSSCKPLRDRPMCSCNGGYIGSPPNCRPECLLSSECQLTKACVQQHCVDPCPGT-CGANAECKVVNHNPICSCPRGYSGDPFFNCNKDPEVVTPSERP----------HIPC----------VPSPCGPNALCREVNGHEACSCVAGYIGSPPN-----CRPECVLNAECPSNKACIQQKCSDPCVG-ACGYNARCTAVNHNAICTCPTGYTGDPFS-----GCSLVPEVIREPP----EIIDPCNPSPCGANAECSSRNRAGACRCIKDHIGDPYVGCRP-ECLINTECPNHLACSQKKCRDPCPGTCGRNAQCSVRNHNPICTCNPGYSGDPTS-ACQIIPPPQPIEVDTDPCDPNPCGPNSQHREVNGVCVCACAPTYQGTPPNCRPECVVSSDCNQLTACVNQKCVDPCPGT--CGNNARCQVTNHNPI----CQCPPGFTGDPFSNCVRV--VVT---QPPPRPQPVDPC----------NPTPCGQFSQCRNSNEVAACSCLPNYIGIP-----PNCRPECSINAECPSNRACVRERCIDPCPGA--CGPNAVCKVQNHQPICQCPTGFSGDPFRDCRRVV--------IPTTVRTTEVIDPCEPSPCGANAQCRSRQRAGACTCVPGYFGDPYLACRP-ECVMNTDCPTNRACVNN--KCVDPC--PGVCGINAICNANRHQPICTCLNGYTGDAITQCSLIPTGVPVVEELDPCDPNPCGAYSQHKEQNGVCVCSCSRNMIGSPPNCRPECLVSSECSQVTACMQQTCRDPC--PGLCGRNAECRVTNHNPI----CTCQRGYQGDPFTGCTKIP-VTERVTQPPRP----------TNPCQPDPCGRYAQCKNVRGVAACSCLVGYVGVP------------PNCRPECLIHSECPSNLACINEKCRDPCP--GACGAYAECSVIKHNAVCRCQQGYEGDPFSSCRRVTTIPPRVSTERRDPCQPSPCGANALCTERNFAAACTCIQDYFGDPYVACRPECTINADCPSNKACQRYKCVDPCPG-LCGVNAQCKVINHIPTCTCDRGYVGDPFTSCRKEPLTIEPVIADDPCDPNPCGPNSNQPRQIGDRCHCTCLPDMIGSPPNCRPECVINSDCAQELACISRKCQDPCP-GLCGINAYCRVRNH 16473          

HSP 5 Score: 1157.51 bits (2993), Expect = 0.000e+0
Identity = 1590/6000 (26.50%), Postives = 2255/6000 (37.58%), Query Frame = 0
Query: 4177 SDMYIGSSGQCERVEGTSECIVNEDCTSTDVCYEGSCI--------------------NACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDC------------PSYNQCRNRKC--IDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPY-ECLSDPECPNHLKCKNEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCV---------NPCINENPC-------GAYAKCQVTNHRSQCDCGIGFIGDPYSS--CVPASNEECNYDGDCSDNQ-----VCINNQCIDP------------CKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKY-ECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPY--VECKSVQ-CRKDQDCRDNEKCNLQNF-KCSPLCLGKN--------NCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCV----------------DACSLSN------CGVNAECATTLHDSICSCHSGHTGNPRI---ACYLPLPTVEPS--------LTPGCSNHQDCP------------SYTSCRNRLCIDP---------CIEDT-PCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQ-----------------QKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPY-TFCKP----YDCLVDNDCLDHLRCTNTKCVDPCA---CAKYAECDARNHKAYCSCLVDFTGD-----------------------PYGIAC--------DPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVK--IEPITTIGCKSNSECGDNL----ACEIGKCLNPCTTQRP----------CGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIM---CKEVECRRNNDCNFDEKCD--LNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQITIQTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGS--SETSCQLPQKPECTKDSECANHLAC--IQQKCQDPCASPICGINARCRVKRHRAICVC----LENYIGDPYSVCKEAGCRSDYECPSDKAC--INRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCR-----------------------SYECLV----------------------DSDCPRHLACENEKCVDPC--KCAKYADCKVTNHQGYCTCNSYYTGDPYGLAXXXXXXXXXXXXXLDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDXXXXXXXXXXXXKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDP--------------NYSCLP----------------------------ISTGECKHDSDCLNSESCIDNQCEDPCK----------------------VYTPCG-------------QNAECMATNHRSVCKCRKGLIGNPHSQC--YSYECKTNEDCPFDKHCVG-----QKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPY--VTCKEIECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCID-DRCQD-PCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDV-VKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDC-QLPIQPECTRDYECPDNKACIQQQCLNPC-TSIACGRNAECR----------VTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRE-----CQNPCHFEK-CGVNAMCSPKNHRGICSCIEGHKGDPYS---FCKPYECLIDSDCP--------------------------TNLQCNNEKCVDPC----KCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKE-CQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNFECL----SNDDCPFDKKCISEKCISPCLE--TICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKE--------VECTKDSDCL----------NNEECNLR----LAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTXXXXXXXXXXXXGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSI------TPGCQSDQDCPSYNSCRNRLCINPCA-EDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLSPKPECIVDQDCPLTKACIIGKCESPCSA-NICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDC-----------------------------LDPCLFEQCGQNAQCNPRNHRAMCKCKEGH-KGDPYTFC---RPYECLVDRDCPDQLKCDHEKCVDPCQ----CAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIP-------EPVVEE--GCESDADCLSQQAC--IDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICK-CPPGTIGDPHNFC-HSYECLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVC------KCPRGYQGSPYISCKLLXXXXXXXXXXXXXXXRKTYTCYKVCNSNDECAIGAKCTARDHLK-KCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLAC-MNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDP---CVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQT--SCELPSEP--------------ECLVDD---DCPSDLAC---IHQSC--KTPCSTSTCGINAKCNV-KSHRAICVCIAGYDGDPYQICEEPGCKSD----IECPFDKACISRECQNPCLYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPCQ---CAKYAECDARNHRGIFPEPVEVEG---------CQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEYECLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLXXXXXXXXXXXXXCREGFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDACRIRLCGINAICVAENHESTCACRIRFSGNPEVACL----------------------PIS---PLVVEAL----------PPGCRSD----SECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECKPPTPLSIGCSADSDCPVVEACLNTKCVDPCNCGENALCRKINHKAVCFCPSGFSGNPEVLCEKLECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNP------------------------------------------PGCVKDDECPSNEACVNRMCRNPC--NCGGGAKCFLSGHRPICQCPEGFIGNP------------------QIECNPA--------------------------------GCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCINAICRSPCACGLNADCKIIDHQPVCTCKPGFYGDPEIECTDTVCQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNIVSCSDNSDCPTDKECINKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFIGNKGTSCVKVSVTCEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECFPVKTCPANSGLILDNREECVCPTGFGFTENKDECIPC-LKENGFILNNEGKCVCNDARGYEYNPDSGKCECPPGERLNNFGICERVPDCEEDPDCPTQKYCEKTNGTCSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCI--PVIIPPVKTDFP 9489
            SD Y+GS    + ++ ++ C+     T+   C  G+C+                    N C  + C   A C+  +    C CF GY G+  +  +I    + P L   C  N +C            P +      +C  ID C E   C   ++C        C+C +G+ G P T C         ID               N C +  CG  A C  +    +C C     GDPYT C                       + C  + CGLNA+C  +G    C C QG +G+P   C    ECL +P                  C +NA C        C C    TGDP+                C++  +C +Q+               PC  NA C+  +T P     C C  GF+G G+  C   E  V    +   +C+ N   +   C+           C++ + C       GA A C+ T     C C   F+G P S     P     C+    C   Q     VC +    DP            C    TCG++++C       +C+C  G  GNP   C    ECK+                     + CG    C        C CP G   +P    EC SV+ C+K+ DC  N  C+      C     G N         CA+ + C   N +  C C       G                      +G   CI     N C L  PC     C+           C CPSG +   N  C+      +C   + C S  +C++G CV                D C+ ++      CG+NA C        C C +G+ GNP +   +C  P    +P         +  GC N  DC             SY +C +   + P         C+  + PC  GA C        C CP G  G P +      + +C  D +C  +  C++                  KC++PC    CG+NA C   N    C C  GY GDP + C +                     D C  + CG  A+C        C C +G +GDPY   CK      +C  D +C   L C  + C++PC+   C + A C   NH A+C C V +  +                       P G  C        +P P    V   C     CP    C   +C+  C  +  C  NA C         T  C C +G+ G G+  C+   + PI T GC S+S C   +     C      NP     P          CGS A+C        C+C  G+ G+P+  C + +  ECT                      NK CGKNA+C +      C+C     G+P   C+  +                   D C    CG  A C+     G C C++G +G+   +   C+   C  N DC ++E C      ++CI  C     C  N+ C + NH   C C      DGYS                                NP  L+  C          + ++T +TQ +C T + C   ++    +C+D C++  CG Y  C    +   C C   +  NP +    +  +     +  CS D  C R  +    +C   C +   C   + C+  NH+ FC C +GY G+    T C L  K +C  D++C+    C    +KC   C + +CG  A C  + H   C C     +    DP   CK   C ++ +CP  K C  ++  C D C  + CG+NA CL      +C C    K DP  + R                        + C                        D DCP    C    C + C   C    +C + N Q  C C   +   P              +   D DC     C   +C+  C   + C+   +C             +C+        + C+    +   GC+ N +   +  CI  +C +PC+++  C   A C+V      CSCP    G P              N  C P                            + T  C  D +CL  E CID+ C+  C                       + TP G              +A C        C C +GL+G+P+++      EC TN DC     C G     +KCVNPCD   CGTNA C+ + H+  C C     G+P   + C ++EC+ + DCN  + C + N  C+  C    +      C  TNH  +C+C P     GY F   +                    C+D D CQ+ PC+    C+            + +  C+CP   +    G C       +C  D DC ++  C +G C N C++   CG ++ C  + H+  C C     G+P   C   +PL+       C  + DC     C   KC++ C++   C    +C+  +H + C C  G+ G P   C QL +   CT + +CP    C    C  PC +S  C  N  C            T+   L SC++G          E  C +D +C +   C+ RE     C++ C     CG NA C+   H+ +C+C +G  GDP +    C+  +CL++ DCP                           N  C+  +C DPC     C  NA C +++HR  C C  DFTG+P  + C  IP        C    DCP    C D  C+ PC + E CA    C     +    +   C  G+        V ++ +   GC++++ C ++  C+   C +PC  D+ CG  + CQ  +H++ C C   +I +P      V + + C  + +C   Q C    C+D C N   C  N +C+    + +C   +    +    C    C+    S+ +CP D  CI+ +C  PC    T CGN A C+V  H +VC CP+GL G+P   C+          +C +   C+          +NE C L        C  LC     C+   IC+                  + FC+         GC  D  C  + ACI+ QCQ+PC L + C    +C V +        C C  +   N    C  +     C    DC     C+DG CV       CGS S+C         +CV+G        C   VP P+  +       PGC  D DC     C    C NPC  E   C  +A C+V NH PVC CP G  G+P  EC+   + EC  + +C  TK+CI G C + C   N CGI+A C++  H+  C C   YVG+P   C         ECL++    N  C                             +DPC   +CG +A C      A+C C      GDP   C   +  +C  D DCP    C   KCVDPC     C   A C  + H+  C C   + G P+ + C P P       +P + E  GC+ D DC    AC   + +C +PC +   C  N KC V +  P+      C   YS   +++  L      V C +  EC ++ ACDNG C +PC     C +  +C V  HKA C C  G N +  S+C+         D  C R Q+CI  QC   C     C  N  CI+++H+ +CK CPPG   D +  C     C S+ +CP  ++CQNK CVNPC    CG   +C V  H A C      +C       P  +C+  +C  + D         +   C++ C  N +C     C   D  K KC    P      + C     +    C+   + + ++ C  N    NPC I  PC ++  C ++N  PI    C CP G +     +C +        D   CR ++               CG N+ C+       C CLP F G+P            P++                    C+ P   C  +PC  N +C V+ +   CTC  GY  S  T   C L SEP              ECLV+D   DC  +        Q C  + PC+ S CG N +CN  ++ + +C C  GY GDP     + GCK++     +C    ACI+++C +PC    CG+ A C  ++H  +C C  G  G+P+  C     + +P  P           DPC    C   A+C  ++ + I     + +G         C +  DCP  +ACI+ +C++PC     C  NAEC++ N        C C EGY+G    +C LI  P V+                 E  +PC +  PC   A C +   +  CTC PG  G P S        EC  +S+C    AC+  +C +PC+    CG NA C  ++H P+C C  G  GDP S C       D   P  K        D C    CG  A  K       C C  GL G P++ C+  EC    DC   + C  N  KC   C     C   A C   NH   C C+    GN F  C+ P   +  E + D        C    C    ++R   +    C+             C  G++ G   +C     +PEC   SDC  N  C S  C D C  R CG+NA C   +H   C C   + G+P  +C                       P S   PL    +          PP CR +    SEC     C    CVDPC     CG +A CKV  H P+C CP G+ GDP   C    P  +  S     P V          P  CG NALCR++N    C C +G+ G+P     + EC  + +C ++K C +  C++PC+    C  N  C   NH + C CP+   GDP+S C  V   I E           + IDPC   +PC  NA C +   A +C CI   IG+P+V C            EC+++++CP+ LAC    C +PC     C  +A CSV + +P    +CTC  G+      +C  I  P P                                          P CV   +C    ACVN+ C +PC   CG  A+C ++ H PICQCP GF G+P                     CNP                                  CS + EC S  ACV   C++PC     CG +A C    H   C+C  GF GDP+  C  +   +          R  + IDPC + +PC   A C SR     C C  GY GDPY +C     PECV + DC T  AC+N KC +PC  +  C   AIC+     P+    C C +GY    +  C  +P  +   E  D C             P  CG  +  K  +   VC+C     G P        C   +EC +  AC    C   C      CG  AECR   H   C C  G  G+PF  C  +  ++    P          T+ C   +PCG  ++CK       CSC +G++G            C +  +CPS  +CI ++C +PC     CG  A CSV          C C +GYEGD    C  V T P                     TE +D C P     N           C   + Y  +P               +  C   P+C  + DCP+ K C++    C +PC    CG NA     +HI  C C +GY GDP   C   P+ I PV  D P
Sbjct:  397 SDCYLGSDENQKELKCSNNCLY----TTGHRCINGACLDSQCHCNDGWGGKGCSMPDDNECKYRPCDVFAHCTNNIGSYACTCFPGYEGDGHNCQDIDECTI-PELAAKCVENAECCNLPAEYVCKCKPGFEGDGQVECRDIDECRESNACGANSLCSNFAGNYTCSCQEGYAGDPYTGC---------ID--------------LNECLSNPCGAGAKCINQYGGYLCECPAGAKGDPYTSCGT--------------------LDQCQSKPCGLNAKCYNDGGSYRCECPQGFQGNPKQQCLDVNECLRNP------------------CGQNAACINTEGSYQCACKQGLTGDPF--------------TACSDTDECSAQS--------------NPCGSNAVCR--NTNP--GFVCECPPGFSGNGNVACEATE--VRTLCQSNFDCTNNAVCQKGECLCRSGFTAAGTLCLDVDECRSTPGICGANAVCRNTLGSFTCSCLTSFVGSPPSVPCSEPCKGVTCSQHAYCKAEQKDAYCVCEDGWTYDPKNIAAGCIDVNECGAPGTCGENSLCTNLPGSFICQCKPGYTGNPQVRCIDIDECKS--------------------VSTCGFGTTCENLPGSYKCGCPSGSVADPNNPAECISVKTCQKNNDCPGNAFCSPSKMCVCPEPNQGPNCESPCENVFCAANSQCTLINGQPRCMCHQGYQPAG----------------------QGKQGCIDI---NEC-LGQPCGKGAFCENTPG----GYRCKCPSGLSGDPNIACKGEIEAIQCSVSKPCPSGELCSQGKCVCQRGFQRESSGLCRDLDECTRASASEEPACGLNAFCKNLPGSFDCECPAGYNGNPFVKCSSCNGPDCGCQPPYSQDGENCILAGCKNKGDCSEGAECITIAGGVSYCACPSGFNVQPDGTCADIDECLSTSRPCGFGALCENKIGSFSCVCPIGTTGDPYSGVCSANQAQCSRDNDCRPNEKCVEPGQCICPPPFFSDTTDGGKCKSPCERFMCGINADCSPTNP-PQCLCKAGYNGDPIQGCLD--------------------VDECAQNPCGPEARCLNEAGSYKCQCPKGTRGDPYLAGCKGTPSRVECTRDEECPGLLSCQASVCINPCSSIPCGENAVCIPENHAAWCRCKVGYKENSEGKCTSMCDGVICGLNAQCIISPTGPTCACSKGTLGNPFPGGSCVPETCSGANPCPQPLSCISGKCRERCD-SFSCGLNAACDG------NTNKCFCREGFVGDGNFLCMPPILPPICTPGCGSHSHCAYGIPNQCICNSEFGGNPYEGCSPSTIDIVQDCKCGSNAECVTDGTSKVCTCKEGFDGNPFIGCFDIN--ECT----------------------NKICGKNAVCINTIGNYDCRCELDYKGNPFEACFPEQ---------------PTIADLCTEKQCGPNAVCSV----GQCLCLTGFKGDAEDLRTGCQSSTCSNNLDCGYNEICQSVKGQYRCIDACGNVQ-CGPNSRCVTDNHHSTCIC-----QDGYS-------------------------------GNPLDLSGGC----------VREVTCKTQNDCPTGSVCS-INISGKRSCVDPCRIMSCGKYEICSVKNNRPFCQCSPTHIRNPVTGQCEIASVPSCSNDGQCSEDQVC-RPDSLGILRCTPICQLFT-CPQNSQCRASNHQGFCQCFEGYNGNPNDRTGCSLISKDQCLSDAQCSEEEVCSLTLKKCIPACNTIVCGPQAVCITQNHSPQCTCPPGKFKGDPNDPVLGCKAVSCLTNTDCPPTKFCDRLSYTCMDVCTADTCGKNAVCLPEQQRPKCSCPPGTKPDPLPEVRCSTLNACSKKPCHSSASCSSTTTGFSCSCPQGQVGDPNKSGCFPEGSCPNGDRDCPDKSICIRGMCKNICYDSCGPNTECSINNRQAQCQCLQGFIPSPLDARTCIRDSQGCRK---DADCIGGSTCQGGQCRYSCRGQNDCLVGEQCS------DSMCMISCISSQQCPSSQVCS--NGVCSIGCRNNENCPSDEVCISFKCVNPCQQEGACGPNALCKVSGKNVQCSCPERFAGVPTPQQGCVRIPARCPNGKCPPQHTCKGGMCHWQCQINANCAKGERCLDGLCTKVCHSDKNCLQGEICIDSTCQPGCNKEEDCRPGEICQGGSCVCAIGFINTPAGCQDINECENSICHPSANCANIPGSFKCTCPRGLVGDPYTKGCKNPNECTTNRDCGPQLACAGDGSGYRKCVNPCDRAKCGTNANCEVQKHKPFCKCFDKHVGNPSSPLGCTKVECEKNTDCNGDKVCQVANNRCIDACN--IVSCGRGTCSATNHVPSCRCEP-----GYIFSNNQ--------------------CVDIDECQNSPCEPTAICINT----------VGAYQCQCPPGTVPDAFGRCRS---SDQCLSDNDCPKTAACNNGKCQNPCEIPGSCGADAICTPANHRPMCSCPPRTNGNPQVRC---VPLE-------CVSNSDCNSERTCVRNKCVDVCSLPNVCGQNTNCRATNHIARCFCLPGFTGEPTLGCTQLQL---CTVEEQCPSGMLCSFGICSPPCQSSRDCLDNQLCNGGSCISKCQDSTQCPPLHSCQNGLC------IQESRCSNDVDCDEVDTCVGRENGLFECEDACAGPVICGRNAKCTSLGHKAVCTCPDGFFGDPNNEKIGCQKKQCLVNGDCPGDSVCDKFICTQPPVTGTCTNDRNCQANEVCDKGQCKDPCGIQGSCGINAFCSVQSHRKQCVCPQDFTGNPE-VECVRIPS------TCYSSSDCPQPMQCADGICMPPCSSDENCAINERCLQGLCMLTCRVDNDCFLGH--------VCLNKMCIVGCRANSDCPESNTCINNRCTDPCRGDT-CGPNAKCQVVDHRAQCSCPPRFIPNPTPVVGCVKQPQTCSSNAQCPERQVCDGKFCKDVCFNDKNCLVNEVCDNGICKPLCR--RDDDCNSQEICKGVTCVLGCRSSSNCPNDLACINNQCTDPCSSSTTSCGNNALCSVANHQAVCSCPAGLTGDPTRGCRHPVQVCSSSTQCRQGYKCVGGVCAASCSSSNENCLLNEVCVKGTCRPLCNSNADCSDGYICK------------------ERFCVA--------GCSSDSQCKENQACINSQCQDPC-LSSSCGQCAECSVSN----HQAFCSCPASSTGNPSIGCLPL--TYTCGKSSDCGRGQRCEDGVCV-----KKCGSSSSCECGK-----TCVSGQC---RQECTSSVPCPQGHLCKGGTCLPGCIGDNDCSDQELCLAGKCQNPCLLESTGCAKSAECRVTNHRPVCLCPQGLQGNPKIECK---RIECRTNSECEHTKSCIEGSCVNLCLLPNACGISAQCKSIRHQKKCSCPQKYVGNPNIECVL----DKNECLSSPCGENAICQDLVGGYDCKCKAGCTGDGFSGCICGGPLIDPCRNARCGLDALCTVGGGIALCVCPNNKPNGDPLVECTSEKEGKCRADFDCPSSQSCKKGKCVDPCSLRAACGVNAICTVRIHKPRCECPQCHIGRPH-VRCRPDPSCNTLPTKPQIVEPIGCQGDKDCSLGTACNRQNGKCFDPCGSTS-CDFNKKCIVSNHKPI------CKCKYSLVVNQQGVLTCPDRQVECRTHNECPSNQACDNGRCKSPCDNPRICPAGKECQVLEHKAVCICTTGCNPE-VSICL--------KDRGCPRGQACIGYQCKNPCE-GTTCPGNTPCIVEDHKAVCKFCPPGFTTDANYGCIQGVGCRSSSECPSKQACQNKKCVNPCGLGQCGATQDCEVANHLARCIDVPRCECSSRRDCLPGFTCEDCECVKNPDVDATVCEPSEG-DCFEQCTINSDCPEDKYC---DRFKRKCISVCPGFCGDNTQCRFVNHNPICSCKQGFNGNPDVGCTFNQPPSNPC-IPSPCGSDAICELDNGNPI----CSCPRGKTGNPFVRCIQ--------DGKKCRGNQ---------------CGPNSGCRMIADRPVCYCLPRFEGNP------------PAIP-------------------CVKPMKQCKPNPCGANTECVVVNNVQRCTCKPGYTESVNTIQGCVLISEPVISLCEPGPCGDNAECLVNDLGEDCRCNAGFGGNPFQGCTPQNPCNPSPCGPNTECNEDRAGQIVCSCRRGYQGDPT---SDQGCKAECLRNSDCSRALACIAQKCIDPCP-GTCGIFAVCEVQNHNPICSCPPGTVGDPFSRCTQQPVVTEPPRPK----------DPCNPSPCGTNAQCRQQSGQAICQCIRDYQGDPLIGCKPECLLSFDCPQDKACINSKCKDPCPGT--CGINAECQISN----HNAICKCHEGYTGDPFAQCSLI--PGVI--------------NPPEPADPC-QPSPCGPNAECRIVESRPVCTCFPGYYGAPPSC-----RPECVINSECAPALACINLKCSNPCVGV--CGINAKCDVVNHNPICSCPQGYIGDPFSSCRRKP---DEIRPTPKP-------DICNPNPCGPSAIRKPRNGVCTCACPPGLFGDPYLGCRP-ECILNSDCNRLQACSNN--KCVDPC--PGTCGTNAECKIINHIPTCGCRKGFTGNAFEECTKPKPVQPVEGKED-------PCGGNFCGAYSTQR---VQGNRCVCS-----------CLPGYF-GFPPNC-----RPECVVSSDCSQNLACLSQKCSDPCPGR-CGVNARCHVISHHPICTCPPDYEGDPFTSCQKRPSTVTPPPKPSNPCYPSPCGPYSSCKPLRDRPMCSCNGGYIGSPPNCRPECLLSSECQLTKACVQQHCVDPCPGT--CGANAECKVVNHNPICSCPRGYSGDPFFNCNK-DPEVVTPSERPHIPCV----------PSPCGPNALCREVNGHEACSCVAGYIGSPPNC--RPECVLNAECPSNKACIQQKCSDPCV--GACGYNARCTAVNHNAICTCPTGYTGDPFSGCSLVPEVIREP---------PEIIDPCN-PSPCGANAECSSRNRAGACRCIKDHIGDPYVGC----------RPECLINTECPNHLACSQKKCRDPCPGT--CGRNAQCSVRNHNP----ICTCNPGYSGDPTSACQIIPPPQPIEVDTDPCDPNPCGPNSQHREVNGVCVCACAPTYQGTPPNCRPECVVSSDCNQLTACVNQKCVDPCPGTCGNNARCQVTNHNPICQCPPGFTGDPFSNCVRVVVTQPPPRPQPVDPCNPTPCGQFSQCRNSNEVAACSCLPNYIGIPPNCRPECSINAECPSNRACVRERCIDPCP--GACGPNAVCKVQNHQPICQCPTGFSGDPFRDCRRVVIPT--------TVRTTEVIDPC-EPSPCGANAQCRSRQRAGACTCVPGYFGDPYLACR----PECVMNTDCPTNRACVNNKCVDPCPGV--CGINAICNANRHQPI----CTCLNGYTGDAITQCSLIPTGVPVVEELDPCD------------PNPCGAYSQHKEQNGVCVCSCSRNMIGSPPN--CRPECLVSSECSQVTACMQQTCRDPCPGL---CGRNAECRVTNHNPICTCQRGYQGDPFTGCTKIPVTERVTQPPRP-------TNPCQ-PDPCGRYAQCKNVRGVAACSCLVGYVGVP----PNCRPECLIHSECPSNLACINEKCRDPCP--GACGAYAECSVIK----HNAVCRCQQGYEGDPFSSCRRVTTIPPRVS-----------------TERRDPCQPSPCGANALCTERNFAAACTCIQDYFGDP---------------YVACR--PECTINADCPSNKACQRYK--CVDPCP-GLCGVNAQCKVINHIPTCTCDRGYVGDPFTSCRKEPLTIEPVIADDP 16248          

HSP 6 Score: 1137.48 bits (2941), Expect = 0.000e+0
Identity = 1563/5791 (26.99%), Postives = 2169/5791 (37.45%), Query Frame = 0
Query:    1 MACTCIEGYEE-------------PIIASGCQSDDEC-----------------DSNQACRNRVCVNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGDAYSNCSPINEDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEV-ECRHNDDCPDNAKC--NLNNFKC-----------------EELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSL---TQECKVM-----------DSYPTRTVSCICP--------------KDTRTSLNGECS--RIESKTECENNNDCGDQDVCVGGTCLNSCRV-HPCGPNAQCIASSHRSTCSCSRGYTGNPQ------DSCQRIQVTG---------------------ATPLQPG-------CDSNQDCPTYSSCR-NRLCINPCAEDKP----------CSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVC----EEPGCRNDFECPDTQTCINRECQNPCLFEK----------------------CGENAECSPRNHRATCKCNKGHKGNPY---SYCNAYEC-LSDPECPDHLHCISEKCVDPCKCAANAEC-DARNHRGYCACIIDF------------------------------------------TGDPYGXXXXXXXXXXXXXXXXXXDKDCFSQEACISE-ECDNPCTVYSPCVENANCKV----------YDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQ--ISQGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYI--ECKNVECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSD-KPECNVDDDC----PGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLT----------------------------------PGCRNDDDCPTYSLCKNT----MCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPT---------TVCRPHPECPDRLKCE-----NEKCVDPCE---CARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXX-XXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACD--NGKCIXXXXXXXXXXXXAICRTQNHQPTCECSPG-FTGDPYSLCSPTREDECKHDEDCPSNMVC--ADNKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDP--------HSSCFKYECQ-------------------------------------KNEDCPFDKSCSSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYVACKEVQ----CRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGF---EGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINXXXXXXXXXX--------------XXRCKVINHEPECTCPDGFIGSP-TTDCRPRDPYSFCRPYECLSDPECPDHLKCENE-----KCVDPCE---CARNADCDARNHRGICTCIPDFTGDPYG-IACXXXXXXXXXXXXCKEDRDCPSQNAC--INEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKISNSECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSFECKKNEDCPFDKECKSESCVDPC-IDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQ-CRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKC----SCPTPLIGDGYSFCNRPVKPADKPEC-LVDSDXSRSEACI--SDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQ-------------------------NECSIDNDCNQDDMCYEGTCVNACYVE-RCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCP---DGFIGSPSTNCQPPERPECRVDAECPLDRACIHQKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLC----KLSGCESDFECPNHQACINRECQNPCLFEK-CGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECL----RDSDCPNHLHCVNDKCVDPC-----ECARNADCKARNHRGYCTCIPNFTGDPYGXXXXXXXXXXXXXXXXNEDRDCPSQNACINEECDNPCLMY-KPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCK----CPRGFSGDPHSYCYKYECKTDNDCPFDKACAKEKCIDPC--KDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGD------------------GYAYCSEIVRRPDEPECRVDKDCPSD--MACISARCQNPCI---VNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTCRKTCSIN-SCGANAVCTPVIHGFKCNCFDGYTGDPNSACY-QPVLNVEP----LLEP-GCSNDDDCPSYTTC--RNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCR-PINVPECLLDAECPDHLACINRKCQNPCST-LTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANC-ICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRS------FCKCPPNHAGDPHASCYKYE----------------------CRISDDCPFDKTC--LNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKD----TDCASNEKCNLQN----------------FRCLRLCSD--NNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASV------PLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGSC--------------IDACRVNKCGANTRCISS-FHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDC-KKPIVPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPCE---CARNADCDARNHRGICTCILDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTG--------KGDERCVKIEPII-------------------------------HTGCRS----NTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGD-------PNSLHAHQG----------------------------------------ECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCY-------------------------------------------------RYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKE-------------------------------------------------LECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNI--------------------------------------AMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCR----------------------------------------------PPK-KPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPYECLSDPECPNHLKCKNEKCVDPCE--CARNADCDARNHRGICTCIPDFTGD--------PYGI---------------------------ACXXXXXXXXXXXXCNED----RDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLH 4948
             ACTC  GYE              P +A+ C  + EC                 D    CR+   ++ C  SN CG  + CS      TC C  G+ GD Y+ C  +NE              C+ +          PCG  A C  Q    +C CP G  GDP+  C                       D C+S  CG NAKC  +  +  C+CPQG QG+P   C +V EC  N  C  NA C     +++C                 +E    S  C  +A+C        C CPP  +G+G   C    V  L   C  + DC     C   +C      T   +L     EC+             ++  + T SC+                K    S +  C   + ++   CE+      +++  G   +N C     CG N+ C        C C  GYTGNPQ      D C+ +   G                     A P  P        C  N DCP  + C  +++C+ P     P          C+  + C +IN QP C C  GY            +P  +    C D   C+GQ          CG  A C        C C SG  GDP   C    E   C     CP  + C   +C     F++                      CG NA C        C+C  G+ GNP+   S CN  +C    P   D  +CI   C +   C+  AEC        YCAC   F                                          TGDPY             + +C  D DC   E C+   +C  P   +S   +   CK            D  P     C+C  GY G   + C+ ++           EC  N                 CG  ARC  +     C C  G  GD Y    +   S+ EC  D++CP   +C ++ C +PCS+   CG NA+C  +NH A C+C  G+  +S+                       KC + C   +CG  A+C +    P C C KG  G+P+    C    C     C     C  IS KC + C   + C  +A C+ + +  KC C    +GDG   C    +P    P C     C    P    C SE   +P    + CS S    V D        C C ++     DG  ++V T   C+   D      C     I+ C    CG NA+C +   +  C C   Y GNP   C+   PT   L T                                    C N+ DC    +C++      CI+ C  +  C P + C   NH+  C C +GY G+P            C+   +CP    C         CVDPC    C +   C  +N+R  C C P    +P    CE    P    + +C+ED+ C   +  I   C   C ++  C QN++C+  +        C C EG+ G  ++R      +    C S+++C     C     KCI P  N   C   A+C TQNH P C C PG F GDP       +   C  + DCP    C      C + C +++ CG NAVC      P C C      DP         ++C K  C                                       + DCP    C    C + C ++ CG N ECS+   ++ C+C  G   SP  A   ++    CRKD DC     C  Q   C   C   N C    +C  S     CI  S         C   V       C  +E+CPS   CIS  C NPC     C  +  CKV+     + V C CP             V     C  N  CP    C  G C   C+     +NA C          C DG      +    C    + ++   +PGC+  +DC     C+   C+      +  A               SA C  I    +CTCP G +G P T  C+         P EC ++ +C   L C  +     KCV+PC+   C  NA+C+ + H+  C C     G+P   + C         +VEC+++ DC     C   N  C + C +         C   + +P    +C C  G+    + +CV I            EC                +N PC  TA C       +C C  G   D + +C   S+ +C  D DC    AC N +C + C +   CG DA C    HR +C CP    G+P V C   EC  N DC  ++ C    CVD C +   CG    C    H   C C  G+ G P L C ++Q C     C S   C+     C+P C+ + +C ++ +C   +   KC     CP PL       C +  + ++  +C  VD+   R        D C  P I    C  +  C  L    +    C C +G     N + I  Q +                           C+ D +C  +++C +G C + C ++  CGINA C    HR +C C   + G+P+  C + P+         C    DCP    C + +C+ PC+ D  CA+   C  +Q   + TC    D F+G    N        CR +++CP    CI+ +C +PC   TCG NA C+V +HRA C+C   +  +P  +     +   C S+ +CP  Q C  + C++ C  +K C     C     + +C        Q    CK   C+      S+CPN L C+N++C DPC      C  NA C   NH+  C+C    TGDP                 C+    C     C+   C   C    + C+LN  C      PL      C +G+  K        E     GC SDS+C     C +  C +PC+  + C   A+CSV +H+A CSCP    G+P   C   LT+ C   +DC R Q C +  C + C  +  C  G  C +   R  C     CP+G        C    C  DNDC   + C   KC +PC  + T C   AEC    H+  C C QGLQGNP + C+ +ECR +++C   + C      C  LC   N C  +A+C++I HQ++C CP ++ G+                    A C ++V   D   C+    C  D    CI   C  P I    N  C  + +C V     L    C CP+     D       E   +C+ + DC   + C  G C   CS+  +CG NA+CT  IH  +C C   + G P+  C   P  N  P    ++EP GC  D DC   T C  +N +C +PC   S C  +  C   NHK +C C    V         P    EC    ECP + AC N +C++PC     C    +C+V  H+A+C C +G            P V + C  +  C    AC   +C NPC E   C  +  C V+ H+A C  CP G+  D    C  IQ + C+  ++C S +AC N +C++PC + + CG   +C   NH +       C+C       P  +C   E                      C I+ DCP DK C     KC+  C    CG    C+   H   C C  G  GNP + C   +   +    + C S+  C L N                 RC++       N C   + C     R  C C P FEG+        IP    ++                 CK      NPC  N EC    +V      P  T S    QG  + S  +    E    C  N +C  ND+ +D  C               + C  + CG NT C      +  C C +GY G+           ++      C  + DC    AC  ++CI+PC     C   A C+V  H  +C+CP G +G P + C ++P+V E                + ++PC+   CG NAQCR Q+ +AIC C   Y GDP   C +P C   F+CP  +ACIN +C++PC    CGINAEC   NH A+C C +G+ GDP++ C     + +P  P           DPC+   C  NA+C     R +CTC   + G P                EC  + +C    ACIN +C NPC+    C  NA+C V +  P+    C+C +G+ G        K DE     +P I                               + GCR     N++C    AC N  C+ PC     CG  A+C + NH  TC C  GFTG+       P  +   +G                                        EC   +DC  N AC++ +C +PC     CG NA C    H P+C CPP   GDP ++C                                                  R EC  + +C   KAC  + C+DPC  T CG+ A C V  H   C CP G  G+P+ NC +                                                  EC  + +C  N+ C     KC+  C G+  C   A C A NH   C CP+ Y GD +S CSL  E   EP                 +  DPC   +PC    EC   N    +  +C C  D +IG       V    EC++N +C +   C +  C + C    CG NAQCS   H+  C C  GY+G+P S C I                                            P+  P C  + DC     C N+KC+DPC     C   A C+V +H  +C CP GF G P +NC                                               PP  +PEC+I+ +C    AC+R++C +PC    CG NA+C+ +NH+ IC C   FSGDP+  C      +             E  +PC    CG NA+C +      C+C+ G+ GDPY  C+P EC+ + +CP +  C N KCVDPC   C  NA C+A  H+ ICTC+  +TGD        P G+                            C      +     C  +     +C    AC+ + C +PC     C +NAEC+V +  P+    CTC  G+ G     C KI PV +   R      P          NPC   +PCG YA+C+     + C C +G++G P     P    EC    +C  N  CIN +C DPC     CG  A C    H  VC+C QG  G+P + C +            +V T  +  DPC  + CG  ALC      + C C Q   G+PYV C+  +C  + DC  N+ C  Q +KC   C G   C   A C+  NH  TC C     GD ++ C  K PL  +                  I  +PC  N PC P+   +          TC+      IG   NC     RPEC  + DC     C    C D C    CG+NA C    H
Sbjct:  619 YACTCFPGYEGDGHNCQDIDECTIPELAAKCVENAECCNLPAEYVCKCKPGFEGDGQVECRD---IDECRESNACGANSLCSNFAGNYTCSCQEGYAGDPYTGCIDLNE--------------CLSN----------PCGAGAKCINQYGGYLCECPAGAKGDPYTSCGTL--------------------DQCQSKPCGLNAKCYNDGGSYRCECPQGFQGNPKQQCLDVNECLRN-PCGQNAACINTEGSYQCACKQGLTGDPFTACSDTDECSAQSNPCGSNAVCRNTNPGFVCECPPGFSGNGNVACEATEVRTL---CQSNFDCTNNAVCQKGECLCRSGFTAAGTLCLDVDECRSTPGICGANAVCRNTLGSFTCSCLTSFVGSPPSVPCSEPCKGVTCSQHAYCKAEQKDAYCVCEDGWTYDPKNIAAGCIDVNECGAPGTCGENSLCTNLPGSFICQCKPGYTGNPQVRCIDIDECKSVSTCGFGTTCENLPGSYKCGCPSGSVADPNNPAECISVKTCQKNNDCPGNAFCSPSKMCVCPEPNQGPNCESPCENVFCAANSQCTLINGQPRCMCHQGY------------QPAGQGKQGCIDINECLGQ---------PCGKGAFCENTPGGYRCKCPSGLSGDPNIACKGEIEAIQCSVSKPCPSGELCSQGKCVCQRGFQRESSGLCRDLDECTRASASEEPACGLNAFCKNLPGSFDCECPAGYNGNPFVKCSSCNGPDCGCQPPYSQDGENCILAGCKNKGDCSEGAECITIAGGVSYCACPSGFNVQPDGTCADIDECLSTSRPCGFGALCENKIGSFSCVCPIGTTGDPY------SGVCSANQAQCSRDNDCRPNEKCVEPGQCICPPPFFSDTTDGGKCKSPCERFMCGINADCSPTNPPQCLCKAGYNGDPIQGCLDVD-----------ECAQN----------------PCGPEARCLNEAGSYKCQCPKGTRGDPYLAGCKGTPSRVECTRDEECPGLLSCQASVCINPCSS-IPCGENAVCIPENHAAWCRCKVGYKENSEG----------------------KCTSMCDGVICGLNAQCIISPTGPTCACSKGTLGNPFPGGSCVPETCSGANPCPQPLSC--ISGKCRERCDSFS-CGLNAACDGNTN--KCFCREGFVGDGNFLCMPPILPPICTPGCGSHSHCAYGIPNQCICNSEFGGNP---YEGCSPSTIDIVQD--------CKCGSNAECVTDGT-SKVCT---CKEGFDGNPFIGCFD---INECTNKICGKNAVCINTIGNYDCRCELDYKGNPFEACFPEQPTIADLCTEKQCGPNAVCSVGQCLCLTGFKGDAEDLRTGCQSSTCSNNLDCGYNEICQSVKGQYRCIDACG-NVQCGPNSRCVTDNHHSTCICQDGYSGNPLDLSGGCVREVTCKTQNDCPTGSVCSINISGKRSCVDPCRIMSCGKYEICSVKNNRPFCQCSPTHIRNPVTGQCEIASVPSCSNDGQCSEDQVCRPDSLGI-LRCTPICQLFT-CPQNSQCRASN----HQGFCQCFEGYNGNPNDR-TGCSLISKDQCLSDAQCSEEEVCSLTLKKCI-PACNTIVCGPQAVCITQNHSPQCTCPPGKFKGDPNDPVLGCKAVSCLTNTDCPPTKFCDRLSYTCMDVCTADT-CGKNAVCLPEQQRPKCSCPPGTKPDPLPEVRCSTLNACSKKPCHSSASCSSTTTGFSCSCPQGQVGDPNKSGCFPEGSCPNGDRDCPDKSICIRGMCKNICYDS-CGPNTECSINNRQAQCQCLQGFIPSPLDARTCIRDSQGCRKDADCIGGSTC--QGGQCRYSCRGQNDCLVGEQCSDSMCMISCI--SSQQCPSSQVCSNGVCSIG---CRNNENCPSDEVCISFKCVNPCQQEGACGPNALCKVS----GKNVQCSCPERFAGVPTPQQGCVRIPARC-PNGKCPPQHTCKGGMCHWQCQ-----INANCAKGER-----CLDGLCTKVCHSDKNCLQGEICIDSTCQPGCNKEEDCRPGEICQGGSCVCAIGFINTPAGCQDINECENSICHPSANCANIPGSFKCTCPRGLVGDPYTKGCK--------NPNECTTNRDCGPQLACAGDGSGYRKCVNPCDRAKCGTNANCEVQKHKPFCKCFDKHVGNPSSPLGC--------TKVECEKNTDCNGDKVCQVANNRCIDACNIVS--CGRGTCSATNHVP----SCRCEPGYIFS-NNQCVDID-----------EC----------------QNSPCEPTAICINTVGAYQCQCPPGTVPDAFGRCR--SSDQCLSDNDCPKTAACNNGKCQNPCEIPGSCGADAICTPANHRPMCSCPPRTNGNPQVRCVPLECVSNSDCNSERTCVRNKCVDVCSLPNVCGQNTNCRATNHIARCFCLPGFTGEPTLGCTQLQLCTVEEQCPSGMLCSFGI--CSPPCQSSRDCLDNQLCNGGSCISKCQDSTQCP-PLHSCQNGLCIQESRCSNDVDCDEVDTCVGRENGLFECEDACAGPVI----CGRNAKCTSLGHKAV----CTCPDGFFGDPNNEKIGCQKKQCLVNGDCPGDSVCDKFICTQPPVTGTCTNDRNCQANEVCDKGQCKDPCGIQGSCGINAFCSVQSHRKQCVCPQDFTGNPEVECVRIPST--------CYSSSDCPQPMQCADGICMPPCSSDENCAINERC--LQGLCMLTCRVDNDCFLGHVCLNKM--CIVGCRANSDCPESNTCINNRCTDPCRGDTCGPNAKCQVVDHRAQCSCPPRFIPNPTPVVGCVKQPQTCSSNAQCPERQVCDGKFCKDVCFNDKNCLVNEVCDNGICKPLCRRDDDCNSQEI--CKGVTCVLGCRSSSNCPNDLACINNQCTDPCSSSTTSCGNNALCSVANHQAVCSCPAGLTGDP-------TRGCRHPVQVCSSSTQCRQGYKCVGGVCAASCSSSNENCLLNEVCVKGTCRPLCNSNADCSDGYICK--------ERFCVAGCSSDSQCKENQACINSQCQDPCLSSS-CGQCAECSVSNHQAFCSCPASSTGNPSIGCLP-LTYTCGKSSDCGRGQRCEDGVCVKKCGSSSSCECGKTCVSGQCRQECTSSVPCPQGHLCK-GGTCLP-GCIGDNDCSDQELCLAGKCQNPCLLESTGCAKSAECRVTNHRPVCLCPQGLQGNPKIECKRIECRTNSECEHTKSC--IEGSCVNLCLLPNACGISAQCKSIRHQKKCSCPQKYVGNPNIECVLDKNECLSSPCGENAICQDLVGGYD---CKCKAGCTGDGFSGCI---CGGPLIDPCRNARCGLDALCTVGGGIAL----CVCPNNKPNGDPLVECTSEKEGKCRADFDCPSSQSCKKGKCVDPCSLRAACGVNAICTVRIHKPRCECPQCHIGRPHVRCRPDPSCNTLPTKPQIVEPIGCQGDKDCSLGTACNRQNGKCFDPCGSTS-CDFNKKCIVSNHKPICKCKYSLVVNQQGVLTCPDRQVECRTHNECPSNQACDNGRCKSPCDNPRICPAGKECQVLEHKAVCICTTGC----------NPEVSI-CLKDRGCPRGQACIGYQCKNPC-EGTTCPGNTPCIVEDHKAVCKFCPPGFTTDANYGC--IQGVGCRSSSECPSKQACQNKKCVNPCGLGQ-CGATQDCEVANHLARCIDVPRCECSSRRDCLPGFTCEDCECVKNPDVDATVCEPSEGDCFEQCTINSDCPEDKYCDRFKRKCISVCPGF-CGDNTQCRFVNHNPICSCKQGFNGNPDVGCTFNQPPSNPCIPSPCGSDAICELDNGNPICSCPRGKTGNPFVRCIQDGKKCRGNQCGPNSGCRMIADRPVCYCLPRFEGN-----PPAIPCVKPMK----------------QCKP-----NPCGANTECVVVNNVQRCTCKPGYTESVNTIQGCVLISEPVISLCEPG-PCGDNAECLVNDLGEDCRCNAGFGGNPFQGCTPQNPCNPSPCGPNTECNEDRAGQIVCSCRRGYQGDPT---------SDQGCKAECLRNSDCSRALACIAQKCIDPCPGT--CGIFAVCEVQNHNPICSCPPGTVGDPFSRCTQQPVVTE--------------PPRPKDPCNPSPCGTNAQCRQQSGQAICQCIRDYQGDPLIGC-KPECLLSFDCPQDKACINSKCKDPCP-GTCGINAECQISNHNAICKCHEGYTGDPFAQCSLIPGVINPPEP----------ADPCQPSPCGPNAECRIVESRPVCTCFPGYYGAP-----------PSCRPECVINSECAPALACINLKCSNPCVGV--CGINAKCDVVNHNPI----CSCPQGYIGDPFSSCRRKPDEIRPTPKPDICNPNPCGPSAIRKPRNGVCTCACPPGLFGDPYLGCRPECILNSDCNRLQACSNNKCVDPCPGT--CGTNAECKIINHIPTCGCRKGFTGNAFEECTKPKPVQPVEGKEDPCGGNFCGAYSTQRVQGNRCVCSCLPGYFGFPPNCRPECVVSSDCSQNLACLSQKCSDPCPGR--CGVNARCHVISHHPICTCPPDYEGDPFTSCQKRPSTVTPPPKPSNPCYPSPCGPYSSCKPLRDRPMCSCNGGYIGSPPNCRPECLLSSECQLTKACVQQHCVDPCPGT-CGANAECKVVNHNPICSCPRGYSGDPFFNCNKDPEVVTPSERPHIPCVPSPCGPNALCREVNGHEACSCVAGYIGSPPNCRPECVLNAECPSNKAC--IQQKCSDPCVGA--CGYNARCTAVNHNAICTCPTGYTGDPFSGCSLVPEVIREPP----------------EIIDPC-NPSPCGANAECSSRN----RAGACRCIKD-HIGD----PYVGCRPECLINTECPNHLACSQKKCRDPCP-GTCGRNAQCSVRNHNPICTCNPGYSGDPTSACQIIPPPQPIEVDTDPCDPNPCGPNSQHREVNGVCVCACAPTYQGTPPNCRPECVVSSDCNQLTACVNQKCVDPC--PGTCGNNARCQVTNHNPICQCPPGFTGDPFSNCVRVVVTQPPPRPQPVDPCNPTPCGQFSQCRNSNEVAACSCLPNYIGIPPNCRPECSINAECPSNRACVRERCIDPCPG-ACGPNAVCKVQNHQPICQCPTGFSGDPFRDCRRVVIPTTVR--------TTEVIDPCEPSPCGANAQCRSRQRAGACTCVPGYFGDPYLACRP-ECVMNTDCPTNRACVNNKCVDPCPGVCGINAICNANRHQPICTCLNGYTGDAITQCSLIPTGVPVVEELDPCDPNPCGAYSQHKEQNGVCVCSCSRNMIGSPPNCRPECLVSSECSQVTACMQQTCRDPCPGL--CGRNAECRVTNHNPI----CTCQRGYQGDPFTGCTKI-PVTE---RVTQPPRP---------TNPC-QPDPCGRYAQCKNVRGVAACSCLVGYVGVP-----PNCRPECLIHSECPSNLACINEKCRDPC--PGACGAYAECSVIKHNAVCRCQQGYEGDPFSSCRRVTTIP------PRVSTERR--DPCQPSPCGANALCTERNFAAACTCIQDYFGDPYVACRP-ECTINADCPSNKAC--QRYKCVDPCPGL--CGVNAQCKVINHIPTCTCDRGYVGDPFTSC-RKEPLTIEP----------------VIADDPCDPN-PCGPNSN-QPRQIGDRCHCTCL---PDMIGSPPNC-----RPECVINSDCAQELACISRKCQDPCP-GLCGINAYCRVRNH 16473          

HSP 7 Score: 1088.17 bits (2813), Expect = 0.000e+0
Identity = 1514/5649 (26.80%), Postives = 2159/5649 (38.22%), Query Frame = 0
Query: 4222 CGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCS-----------YNDDCPS------YNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCS----------------------TITCGRNAICQARNHRAICSCIKSFSGDPYTFCE----EPGCKSDFECRDNQACINRECQNPCLFEK-----------------CGLNAECNANGHRAICSCLQGHKGDPYSFCKPYECLSDPECPNHLKCKNEKCVDPCE---CARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXX-XXXXXCNEDRDCPSQNACINEECDNPCLMYKP---CVQNAECKVYDTLPLRTM--------TCTCIEGFTGKGDE--RCVKIEP-VVDVGXRXXSECSPNLA------XRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCIN-NQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCY----KYECKTNQDCPLDKVCTSEKCV----------------DPC------DTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKS---------------------VQCRKDQDCRDNEKC----------------NLQ-NFKCSPL--CLGKNN-CASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISK---ICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPEC--EKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPT-VEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRP----------------PIKPEC---------------------RYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCD--------EPGCKSDFEC----PNSQACYNKNCQDP------CLFD-----ECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPCACA------------------------KYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKV---EYECLADKDCPSKEVCYDQECKNPCF---FNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEI---GK--CLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPY-ALCQETSTKECTSDDDCQTSETCIQ-----YQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPH-----SYCYKYECVTKDDCPFDKTC--LAKNCVDPCKNTICGVRASCNAEHHQGICTC----ISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGD--------GYSFCDKK-----------------------IASVDTAEC-------KVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAEL----------------SQITIQTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQLPQKPECTKDSECANHLACIQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQ-CGENAECLVNNHEARCKCLSSFKGDPYVKCRSYECLVDSDCPRHLACENEKCVDPCKCAKYADCKVTNHQGYCTCNSYYTGDPYGLAXXXXXXXXXXXXXLDQDCPRQKACIE-----QECQNPCLIYSPCVTNAECKVYDXXXXXXXXXXXXKGYSGKGDEKCTRVEEIKEYGCKANS----------DXSPNLACIGRQCTS-----PCR------------------EKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQKCVNPCDT-TLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIE-CKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCE----ITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDD-----RCQDPCQLNKPCLVGQKCSVSNSLPLRSITCEC-------PSNEIIS------------------ENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDVV-KCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCP---DGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICN----EPGCKSDFECPQQQACLNRECQNPCHFEK-CGVNAMCSPKNHRGICS--CIEGHKGDPYSFCKPYECLI----DSDCPTNLQCNNEKCVDPC-----KCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTY-EPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICM----CPKGFAGDPHTSCYNFECLSNDDCPFDKKCISEKCISPCL--ETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLD------------NPCSSTQ-KCVVFDTLPTRTISCQCSDNM-YMNARGDCEAIKGLVECQTXXXXXXXXXXXXGTCVDACR-KNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITP---------GCQSDQDCPSYNSC--RNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLSPKP-ECIVDQDCPLTKACIIGKCESPC-SANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPRNHRAMCK-CKEGHKGDP-YTFCRPYECLVDRDCPDQLKCDHEKCVDPC---QCAKYANCDAKNHRGYC------------NCIADYT---------GDPYGIACEPIPEPVVEEGCESDADCLSQQAC--IDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSC--IENQCIQICNVN-------------------NPCSRNALCIMQNHRPICKCPPG------------TIGDPH-NFCHSYECLSNKDCPLDKSCQNKIC--------------VNPCSKTICGQNAECSVEY-HQAVCKCPRGYQGSPYI--SCKLLXXXXXXXXXXXXXXXRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCELPSEPECLVDDDCPSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEEPGCKSDIECPFDKACISRECQNPCLYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPC--QCAKYAECDARNHRGIFPEPVEVEGCQMDKDCPSQEACIDRECQNPCLSFR-PCVENAECRVYNTLPLRTM--TCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGD----------------------------PYSICVIIEDH------------------ECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGD----------------------------PHSFCYEY---------------------ECLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPC------------SRRNPCL---------PSETCLXXXXXXXXXXXXXCREGFYVGKNGDCIEVDG-------------QPECRSH----SDCRYNEQCQSGSCLDACRIRLCGINAICVAENHESTCACRIRFSGNP-------------------------------------EVACLPISPLVVEALPPGCRSD----SECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECK-----------------PPTPLSIG-----------------------------CSADSDCPVVEACLNTKCVDPCN--CGENALCRKINHKAVCFCPSGFSGNPEVLCEKL------------------------------------------------ECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCN---CGGGAKCFLSGHRPICQCPEGFIGNPQIECNPAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQ------CRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHV 9053
            CG N+ CS    +  C C EGY G+P +GC    + +   L   C            Y  +CP+      Y  C     +D C + KPC + A C        C CP GF G+P   C      EC  +P C    ACI  +    C+                      +  CG NA+C+  N   +C C   FSG+    CE       C+S+F+C +N  C   EC     F                   CG NA C        CSCL    G P S                       C +PC+   C+++A C A      C C   +T DP  IA   I          C E+  C +       +C  P     P   C+   ECK   T    T          C C  G     +    C+ ++    +      + CSP+         +  NC +PC N   C A ++C + N + +C C  G+         PA   +          Q CI+ N+C+        CGK A C        CKCP G +G+P+  C       +C  ++ CP  ++C+  KCV                D C      +   CGL A C+       CECP G  GNP+V+C S                       C+   DC +  +C                N+Q +  C+ +  CL  +  C   ALCE +    +C C    +GD YS          +A+C  D DCR +  C+     IC  P       +   +CK+    P     C        G+N +C      P+C  +   + D    C +   VD C+ + CG  A C        C C  G  G+P +A     P+ VE      C+  ++CP   SC+  +CI+PC    PC   A C   NH + C C  GY  + E  C                  P  P C                          CP  L+CI  KC+  C S +CGLNA C    ++  C C  G+VGD    C          PGC S   C    PN   C ++   +P         D     +CG NA+C  +    +C C EG  G+P+  C   +   +  C  +  C NT     C C                         K    +A      C CL  F GD          E L+       C  + DC   E+C   + +  C     N  C  N+ C V D       TC+C  GY+G   +  +    +  + CK+ ++C     C I   GK  C++PC     CG Y  C+V+N++P C CSP +  +P    C+  S   C++D  C   + C        +CT  CQ    C +N+ C +  H+  C+C  G  G+P+     S   K +C++   C  ++ C    K C+  C   +CG +A C  ++H   CTC      G   +P + CK V C  N DC   + CD  S+ C+ +C+ ++ C  NA C     + KC CP     D          + C KK                       +   + + C         D DCP K  CI   C+N C+  + C  + EC I                   ++  I+    C  + DC     C  G C  +C+        DC+     +   C      +   QC    +       IGC  + +CP    C + KC+NPC  +  C   A+CKV      CSC + + G        PQ+      + C N     Q  C+       C INA C  K  R    CL+        +C +  C SD  C   + CI+  CQ  C  E+ C     C        C C   F   P            + C     CEN  C         A+C        CTC     GDPY   C+   E        ++DC  Q AC       ++C NPC   + C TNA C+V    P        +   S      CT+VE  K   C  +           D    ++C    C++      CR                  + +PC  TA C        C CP GT  D    C   S+ +C  D+DC  + +C + +C++PC++   CG +A C   NHR +C C     GNP  +C   EC +N DC  ++ CV  KCV+ C    +CG N  C++  H + C C  G  G P + C +++ C  +  C +   C+    IC P C   + C  N  C     I+  +++ QC P +       C ++       +C  D DC +  +C+        C+D C     C    KC+   SL  +++ C C       P+NE I                   +  IC +  +   C  D +C  +++C  G C + C +   CG N+ C    H+  C C + +TG+P  EC          I   C    DCP    C +  C+ PC+ DE CAI   C  +    + TC    D ++G    +    +   C  + +CP++  CI  +C +PC    CG NA+C+V  HRA CSC   +I +P  +         C S+ +CP++Q C  + C++ C  +K C VN +C      GIC   C      +    CK   C++     S+CP +L C N +C DPC      C  NA C + NH+  C+C +  TGDP          PV V   C     C     C+   C   C +  E C     C      PL      C +GY  K        +     GC SD++C +N AC+   C +PC++ S CG  + C   NH++ C C     G+P   C+P+    C    +C   Q C +  C   C +++ C     C +   R  C     CP+G      T      C+ ++DC   + C++ KC +PCL   T C   AEC V  H  VC CP GLQGNP + CK +EC  +S+C + + C      C  LC   N+C  SA C++ RH + C+CP  ++G+    C+       S  C  +  C         +C+  C  D            +PC + +       T+      C C +N    +   +C + K   +C+ D DCP S  C  G CVD C  + +CG  + C    H  +C C   + G P+  C    P P  +  P         GCQ D+DC    +C  +N  C +PC     C  N  C V NH+P+C C    + +         +  EC    +CP  +AC  G+C+SPC +  IC     C+   H+A C+C +G   +P    E   C  +  C   QACI   C +PC    C  N  C   +H+A+CK C  G   D  Y   +   C    +CP +  C ++KCV+PC   QC    +C+  NH   C            +C+  +T          D     CEP      E+ C  ++DC   + C    R+C + C  +  C +N +C+  +  P+    C+C +G++G  D           VGCT ++  S           NPCI  SPC S A C + N    C+CP G  G+P+  C  ++D +    ++C     C  I ++ +  C                      NPC  N  C++ N+   C C PG             I +P  + C    C  N +C ++   ++  C               NPC+ + CG N EC+ +   Q VC C RGYQG P     CK     N +  +      +K   C   C     C I A C  ++H   C+C    +GD +S C + P   +P    D                PC  + PC  N QC  ++   I    C C   +       CK     P+C  S DC   + C    C   C    CG NA C+  +H+  C+C   + GDP   C   P  I P   A                    DPC   PC  NA+CR++   PVCTC  GY G+P +       PEC+++ +C   LACI+  C  PC    CGINAKC+V +H  IC C  GY GDP+  C     K D   P  K  I       C  + CG +A   P++    C C  G  G+PY+ C+P EC+ + DC     C N KCVDPC   C   AEC   NH       +   GC+      + E C   +   P      PC  N  C  Y+T  ++     CSC  GY G                C    DCS +LAC + +C +PC     C   ARC V  H   CTCPP   GD                            PYS C  + D                   EC   S+C   KACV+  C+DPC     CG NA CK ++H P+C C  G +GD                            P++ C E                      EC+ + +CP NKAC+ QKC+DPC+   CG  A+C    H  IC C  G  G PF  C  V        +  + C+             +PC   A C ++N    C C    +G+ +V C        PEC I+ +CP+  AC  +KC++PC               NP           P+  C ++       V     +    G N    EV+G              P CR      SDC     C +  C+D C    CG NA C   NH   C C   F+G+P                                     EVA     P  +  +PP CR +    +ECP+   C   +C+DPC     CG +A CKV  H P+C+CP GF GDP  +C+                  P+P                                 C  ++DCP   AC+N KCVDPC   CG NA+C    H+ +C C +G++G+    C  +                                                EC    +CS    C + TC +PC  L  C  N EC  +NH   C C     GDP++ C  +         +ER     +  +PC  D PC   A CK V+  ++C C+   +G            P     EC++ S+CPS LAC+N+ C +PC     C   A CSV+        VC C++G+      SC  + T  P               V+   R+PC    CG  A C        C C + + G+P + C P  C+ + +C S +AC    CV+PC     CGV+A+C    H   C CD G+ GDP+T C                 +    I+P + D+PC       + +   Q      C C     G P         PECV + DC   +ACI+ KC +PC  L  C   A C V
Sbjct:  832 CGANSLCSNFAGNYTCSCQEGYAGDPYTGC----IDLNECLSNPCGAGAKCINQYGGYLCECPAGAKGDPYTSCGT---LDQC-QSKPCGLNAKCYNDGGSYRCECPQGFQGNPKQQCL--DVNECLRNP-CGQNAACINTEGSYQCACKQGLTGDPFTACSDTDECSAQSNPCGSNAVCRNTNPGFVCECPPGFSGNGNVACEATEVRTLCQSNFDCTNNAVCQKGECLCRSGFTAAGTLCLDVDECRSTPGICGANAVCRNTLGSFTCSCLTSFVGSPPSV---------------------PCSEPCKGVTCSQHAYCKAEQKDAYCVCEDGWTYDPKNIAAGCIDVNECGAPGTCGENSLCTNLPGSFICQC-KPGYTGNPQVRCIDIDECKSVSTCGFGTTCENLPGSYKCGCPSGSVADPNNPAECISVKTCQKNNDCPGNAFCSPSKMCVCPEPNQGPNCESPCENVF-CAANSQCTLINGQPRCMCHQGY--------QPAGQGK----------QGCIDINECLG-----QPCGKGAFCENTPGGYRCKCPSGLSGDPNIACKGEIEAIQCSVSKPCPSGELCSQGKCVCQRGFQRESSGLCRDLDECTRASASEEPACGLNAFCKNLPGSFDCECPAGYNGNPFVKCSSCNGPDCGCQPPYSQDGENCILAGCKNKGDCSEGAECITIAGGVSYCACPSGFNVQPDGTCADIDECLSTSRPCGFGALCENKIGSFSCVCPIGTTGDPYSGVCSAN----QAQCSRDNDCRPNEKCVEPGQCICPPP--FFSDTTDGGKCKS----PCERFMC--------GINADCSPTNP-PQCLCKAGYNGDPIQGCLD---VDECAQNPCGPEARCLNEAGSYKCQCPKGTRGDPYLAGCKGTPSRVE------CTRDEECPGLLSCQASVCINPC-SSIPCGENAVCIPENHAAWCRCKVGYKENSEGKCTSMCDGVICGLNAQCIISPTGPTCACSKGTLGNPFPGGSCVPETCSGANPCPQPLSCISGKCRERCDSFSCGLNAACDGNTNK--CFCREGFVGDGNFLCMPPILPPICTPGCGSHSHCAYGIPNQCICNSEFGGNPYEGCSPSTIDIVQDCKCGSNAECVTDGTSKVCTCKEGFDGNPFIGCFDINECTNKICGKNAVCINTIGNYDCRCELDYKGNPFEACFPEQPTIADLCTEKQCGPNAVCSVGQCLCLTGFKGDA---------EDLRTGCQSSTCSNNLDCGYNEICQSVKGQYRCIDACGNVQCGPNSRC-VTDN---HHSTCICQDGYSGNPLD--LSGGCVREVTCKTQNDCPTGSVCSINISGKRSCVDPCRIMS-CGKYEICSVKNNRPFCQCSPTHIRNPVTGQCEIASVPSCSNDGQCSEDQVCRPDSLGILRCTPICQLFT-CPQNSQCRASNHQGFCQCFEGYNGNPNDRTGCSLISKDQCLSDAQCSEEEVCSLTLKKCIPACNTIVCGPQAVCITQNHSPQCTCPPGKFKGDPNDPVLGCKAVSCLTNTDCPPTKFCDRLSYTCMDVCT-ADTCGKNAVCLPEQQRPKCSCPPGTKPDPLPEVRCSTLNACSKKPCHSSASCSSTTTGFSCSCPQGQVGDPNKSGCFPEGSCPNGDRDCPDKSICIRGMCKNICY--DSCGPNTECSINNRQAQCQCLQGFIPSPLDARTCIRDSQGCRKDADCIGGSTCQGGQCRYSCR-----GQNDCLVGEQCSDSMCMISCISS--QQCPSSQVCSNGVCSIGCRNNENCPSDEVCISFKCVNPCQQEGACGPNALCKVSGKNVQCSCPERFAGVP-----TPQQGCVRIPARCPNGKCPPQHTCKGGMCHWQCQINANC-AKGER----CLD-------GLCTKV-CHSDKNCLQGEICIDSTCQPGCNKEEDCRPGEIC----QGGSCVCAIGFINTP------------AGCQDINECENSIC------HPSANCANIPGSFKCTCPRGLVGDPYTKGCKNPNECT-----TNRDCGPQLACAGDGSGYRKCVNPC-DRAKCGTNANCEVQKHKPFCKCFDKHVGNPSSP--LGCTKVECEKNTDCNGDKVCQVANNRCIDACNIVSCGRGTCSATNHVPSCRCEPGYIFSNNQCVDIDECQNSPCEPTAICINTVGAYQCQCPPGTVPDAFGRCR--SSDQCLSDNDCPKTAACNNGKCQNPCEIPGSCGADAICTPANHRPMCSCPPRTNGNPQVRCVPLECVSNSDCNSERTCVRNKCVDVCSLPNVCGQNTNCRATNHIARCFCLPGFTGEPTLGCTQLQLCTVEEQCPSGMLCSFG--ICSPPCQSSRDCLDNQLCNGGSCISKCQDSTQCPPLHSCQN-GLCIQES------RCSNDVDCDEVDTCVGRENGLFECEDACAGPVICGRNAKCT---SLGHKAV-CTCPDGFFGDPNNEKIGCQKKQCLVNGDCPGDSVCDKFICTQPPVTGTCTNDRNCQANEVCDKGQCKDPCGIQGSCGINAFCSVQSHRKQCVCPQDFTGNPEVEC--------VRIPSTCYSSSDCPQPMQCADGICMPPCSSDENCAINERC--LQGLCMLTCRVDNDCFLGHVCLNKMCIVG--CRANSDCPESNTCINNRCTDPCRGDTCGPNAKCQVVDHRAQCSCPPRFIPNPTPVVGCVKQPQTCSSNAQCPERQVCDGKFCKDVCFNDKNCLVNEVCD----NGICKPLCRRDDDCNSQEICKGVTCVLGCRSSSNCPNDLACINNQCTDPCSSSTTSCGNNALCSVANHQAVCSCPAGLTGDPT----RGCRHPVQV---CSSSTQCRQGYKCVGGVCAASCSSSNENCLLNEVCVKGTCRPLCNSNADCSDGYICK--------ERFCVAGCSSDSQCKENQACINSQCQDPCLSSS-CGQCAECSVSNHQAFCSCPASSTGNPSIGCLPLTYT-CGKSSDCGRGQRCEDGVCVKKCGSSSSCECGKTCVSGQCRQECTSSVPCPQGHLCKGGTCLPG--CIGDNDCSDQELCLAGKCQNPCLLESTGCAKSAECRVTNHRPVCLCPQGLQGNPKIECKRIECRTNSECEHTKSC--IEGSCVNLCLLPNACGISAQCKSIRHQKKCSCPQKYVGNPNIECVLDKNECLSSPCGENAICQDLVGGYDCKCKAGCTGDGFSGCICGGPLIDPCRNARCGLDALCTVGGGIALCVCPNNKPNGDPLVECTSEK-EGKCRADFDCPSSQSCKKGKCVDPCSLRAACGVNAICTVRIHKPRCECPQCHIGRPHVRCR---PDPSCNTLPTKPQIVEPIGCQGDKDCSLGTACNRQNGKCFDPCGSTS-CDFNKKCIVSNHKPICKCKYSLVVNQQGVLTCPDRQVECRTHNECPSNQACDNGRCKSPCDNPRICPAGKECQVLEHKAVCICTTGC--NP----EVSICLKDRGCPRGQACIGYQCKNPCEGTTCPGNTPCIVEDHKAVCKFCPPGFTTDANYGCIQGVGCRSSSECPSKQACQNKKCVNPCGLGQCGATQDCEVANHLARCIDVPRCECSSRRDCLPGFTCEDCECVKNPDVDATVCEPSEGDCFEQ-CTINSDCPEDKYCDRFKRKCISVCPGF--CGDNTQCRFVNHNPI----CSCKQGFNGNPD-----------VGCTFNQPPS-----------NPCI-PSPCGSDAICELDNGNPICSCPRGKTGNPFVRC--IQDGKKCRGNQCGPNSGCRMIADRPVCYCLPRFEGNPPAIPCVKPMKQCKPNPCGANTECVVVNNVQRCTCKPGYTESVNTIQGCVLISEPVISLCEPGPCGDNAECLVNDLGEDCRCNAGFGGNPFQGCTPQNPCNPSPCGPNTECNEDRAGQIVCSCRRGYQGDPTSDQGCKAECLRNSDCSRALACIAQK---CIDPCPGT--CGIFAVCEVQNHNPICSCPPGTVGDPFSRCTQQPVVTEPPRPKD----------------PCNPS-PCGTNAQCRQQSGQAI----CQCIRDYQGDPLIGCK-----PECLLSFDCPQDKACINSKCKDPC-PGTCGINAECQISNHNAICKCHEGYTGDPFAQCSLIPGVINPPEPA--------------------DPCQPSPCGPNAECRIVESRPVCTCFPGYYGAPPS-----CRPECVINSECAPALACINLKCSNPC-VGVCGINAKCDVVNHNPICSCPQGYIGDPFSSCRR---KPDEIRPTPKPDI-------CNPNPCGPSAIRKPRNGVCTCACPPGLFGDPYLGCRP-ECILNSDCNRLQACSNNKCVDPCPGTCGTNAECKIINH-------IPTCGCRKGFTGNAFEECTKPKPVQPVEGKEDPCGGNF-CGAYSTQRVQGNRCVCSCLPGYFG--------FPPNCRPECVVSSDCSQNLACLSQKCSDPCPGR--CGVNARCHVISHHPICTCPPDYEGDPFTSCQKRPSTVTPPPKPSNPCYPSPCGPYSSCKPLRDRPMCSCNGGYIGSPPNCRPECLLSSECQLTKACVQQHCVDPCPGT--CGANAECKVVNHNPICSCPRGYSGDPFFNCNKDPEVVTPSERPHIPCVPSPCGPNALCREVNGHEACSCVAGYIGSPPNCRPECVLNAECPSNKACIQQKCSDPCVGA-CGYNARCTAVNHNAICTCPTGYTGDPFSGCSLVPEVIREPPEIIDPCN------------PSPCGANAECSSRNRAGACRCIKDHIGDPYVGC-------RPECLINTECPNHLACSQKKCRDPCPGTCGRNAQCSVRNHNPICTCNPGYSGDPTSACQIIPPPQPIEVDTDPCDPNPCGPNSQHREVNGVCVCACAPTYQGTPPNCRPECVVSSDCNQLTACVNQKCVDPCP-GTCGNNARCQVTNHNPICQCPPGFTGDPFSNCVRVVVTQPPPRPQPVDPCNPTPCGQFSQCRNSNEVAACSCLPNYI-GIPPNCRPECSINAECPSNRACVRERCIDPCP--GACGPNAVCKVQNHQPICQCPTGFSGDPFRDCRRVVIPTTVRTTEVIDPCEPSPCGANAQCRSRQRAGACTCVPGYFGDPYLACRPECVMNTDCPTNRACVNNKCVDPCPGVCGINAICNANRHQPICTCLNGYTGDAITQCSLIPTGVPVVEELDPCDPNPCGAYSQHKEQNGVCVCSCSRNMIGSPPNCRPECLVSSECSQVTACMQQTCRDPCPGL--CGRNAECRVTNHNPICTCQRGYQGDPFTGCTKIPV-------TERVTQPPRPTNPCQPD-PCGRYAQCKNVRGVAACSCLVGYVG-----------VPPNCRPECLIHSECPSNLACINEKCRDPCPGA--CGAYAECSVIK----HNAVCRCQQGYEGDPFSSCRRVTTIPPR--------------VSTERRDPCQPSPCGANALCTERNFAAACTCIQDYFGDPYVACRPE-CTINADCPSNKACQRYKCVDPCP--GLCGVNAQCKVINHIPTCTCDRGYVGDPFTSCR----------------KEPLTIEPVIADDPCDPNPCGPNSNQPRQIGDRCHCTCLPDMIGSPPNC-----RPECVINSDCAQELACISRKCQDPCPGL--CGINAYCRV 16464          

HSP 8 Score: 1026.54 bits (2653), Expect = 0.000e+0
Identity = 1445/5418 (26.67%), Postives = 2024/5418 (37.36%), Query Frame = 0
Query: 4929 VDACSLSN-CGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYD-CLVDNDCLDHLRCTNTKCVDPCACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKP---CTQNAECRVYDTL---------PLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNL-----ACEIGKCLNP------------CTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPH--SYCYKYE-CVTKDDCPFDKTC------------LAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQITIQTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRV-----------------VILVPQEVEIGCSGDSDC------PRYTACTNKKCINP----------CAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQLPQKPECTKDSECANHLACIQ-----------------QKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVK-CRS----YECLVDSDCPRHLACENEKCVDPCK---CAKYADCKVTNHQGYCTCNSYYTGDPYGLAXXXXXXXXXXXXXLDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDXXXXXXXXXXXXKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLP-----ISTGECKHDSDCLNSESCIDNQC-------EDPCKVYTP----------CGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQ-------------------------KCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSP---YVTCKEIECKSDIDCNTKEKCN--LENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDD-----RCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISE-NGICEKIQIKTECKVDTDCARSDMCKDGN-----CVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDP--LKECNLIIPLQEASINPGCSHDDDCPGHTACR-NLKCINPCAMDEPCAITADCKVVHHQSLCTCPDG-YIGSPQTDCQLPIQPECTRDYECPDNKAC--IQQQCLNPCTSIACGRNAECRVTKHRALCSCR------------------------------------------SGYIGDPYTICNEPGC-------KSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYS----FCKPYECLIDSDCPTNLQCNNEKCVDPCKCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQ--CVKI----------------DPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPC--GDF---SSCQTQNHK------------SVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHT-SCYN-FECLSNDDCPFDKKCISE-----KCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPY--VVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGK----------------SFCMEIVK------PP-----------SSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTXXXXXXXXXXXXGTCVDACR-KNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTAC----YFPVPQPEPS--------ITPGCQSDQDC---------------------PSYNSCRNRLCI----------------------------NPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLSPKPECIVDQDCP--------------------------LTKACIIGKCESPCSA-NICGINALCRANNHRATCVCVSGYVGDPYTVCEX--PGCKSNLECLTTQACINKDCLDPCLF-EQCGQNAQCNPRNHRAMCKCKEGHKGDPYTFCRPYECLV----DRDCPDQLKCDHEKCVDPCQ---CAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVV-----EEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEES-PCTSTAKCSVRNHKAACTCPIGFNGDPYSLCV-PVEDKECSYDDECSRTQSCIENQCIQICNVNNP-CSRNALCIMQNHRPICK----CPPGTIGDPHNFCHSYECLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLXXXXXXXXXXXXXXXRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHP-----LIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVI-NKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLV-FRCGDNAVCKSFDHSFACECLPNFVGDPH-------DACLHAPI---TIEPSLT--------AGCTIDTDCPSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYI-GSPQTSCELPSEPECLVDDDCPSDLACIHQSCKTPCST-STCGINAKCNVKSHRAICVCIAGYDGDPY----------------QICEEPGCKSDIECPFDKACISR--ECQNPCLYDECGVNAECIPKSHRAMCKCKKG----HKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPCQ----CAKYAECDARNHRGIFPEPV----EVEGCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCT------------CPPGMT-------GDPYSICVIIEDHE------CEQDSDCNGNKACVEYE--CIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEYECLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKE--VECRKERDCKTNEKCDMNTYK--CFPLCDFE-----------------NPCAEGASCLAQNHKEKCVCQPPLLGN-----GFVLCSLPVKT--------EEPECRIDD---DCPSKHACINRKCQNPCSRRNPCLPSE--TCLXXXXXXXXXXXXXCREGFYVGKNGDCIEVDG-QPECRSHSDCRYNEQCQSGSCLDACRIRLCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPG-------------CRSDS---------------------------ECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECK-------PPTPLS----IGCSADSDCPVVE--------------------------------ACLNTKCVDPCN--CGENALCRKINHKAVCFCPSGFSGNPEVLCEKLECTSDEDCSNDK--MCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEP-SPIEVEK--------------------------------------ECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCI--------PIETPNP-----------------------------------PGCVKDDECPSNEACVNRMCRNPC--NCGGGAKCFLSGHRPICQCPEGFIGNPQIECN-------------------PAG------------------------------CSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPI-----------------------ISG--------------------CERNDDCSNSTSCINAICRSPC--ACGLNADCKIIDHQPVCTCKPGFYGDPEIECTDTV--------------------------------------------------CQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNIVSCSDNSDCPTDKECINKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFIGNKGTSCVKVSVTCEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECFPVKTCPANSGLILDNREECVCPTGFGFTENKDECIP--CLKENGFILNNEGKCVCNDARGYEYNPDSGKCECPPGERLNNFGICERVPDCEEDPDCPTQKYCEKTNGTCSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIPPVKTDFPRP 9491
            +D C  SN CG N+ C+    +  CSC  G+ G+P                           YT C +   ++ C+ + PC AGA C       +C CP G  G P TSC                    + Q     C S  CGLNA C        C C  G+ G+P                  Q C + N    CL + CGQNA C        C C +G  GDP+T C   D C   ++                 C   A C   N    C C   F+G+   +AC    E  +V   C ++ DC +  VC   EC     F      C    ECR    +          L + TC C+  + G         EP   + C  ++ C          CE G   +P            C     CG  + C        C C PGYTG+P   C +         D+C++  TC               G    C +      C CP+G   DP+  + C   + C   +DCP +  C               NC  PC+N  C   + C   + Q  C C  G Q  P    K+  C   N+C                      C   AFCE+     +C+CP+ + GD    C  +I ++   +C V   CP  + C   +C                    + Q   Q +    ++  CR  D C   +   A +   CG  A C        C C  GY GNP  +C+                    IL   + +  CS  ++C        Y AC +   + P           +  +PC   A+C+       C C  G  G   +      + +C++D++C  +  C++                  KC+ PC   +CGINA C    +   C+C   Y GDP   C +                     D C    CG  A CL      +C+C    +GDPY+  C+      EC  D +CP  L+C+   C++PC    C + A C   NH  +C C   Y                             K   E +C + C     C  NA+C +         TC C KG  G      + V E     C   +     L+CI  +C   C +   C   A C    +   C C  G  GD N+ C+P     I T  C   S C      I NQC        +P +  +P          CG NAEC+      VC C++G  GNP   C+     TN+ C  +  C+                              + C    CG NAVC        C C  G +G        C+   C +++DC   E C      Y C+  C + + C  N+ C   NH  TC C   Y G+            ++  C+   DCP    C  +      C DPC++   C   + CSV N+ P     C+C    I +   G CE   + + C  D  C+   +C+  +     C   C +  C  NS+C+ S HQ  CQC  GY G+P     C+LI   Q       C  D  C     C   LK   P      C   A C   +H   CTCP G + G P           C  + +CP  K C  +   C++ CT+  CG+NA C   + R  CSC                                            G +GDP    N+ GC         D +CP +  C+   C+N C ++ CG N  CS  N +  C C++G    P            C  D+DC     C   +C   C+     DC +        C           S   +    +    C  +++CPS++ CI  +C+NPC     C   A CKV      + + CSC E + G    Q  CV+I                  + H  C+ +  CA+   C+ G C   C +D  C  G+    S+CQ   +K              C C++G+I  P + C  +NE              C N+ C    N ANI G             C CP+G  GDP+T  C N  EC +N DC     C  +     KC++PC    CG  A C V+ H   CKC     GNP   + C +VEC K++DC  ++ C +   +C   C    SC +   C AT H   C C   +I                    + C+  V       PP           SS  C  D DCP + AC + +CQNPC +   C +   C   +  P     C C      N +  C  +    EC ++ DC     C    CVD C   N CG  + C  + H ++C C+ G+TG+P   C       V +  PS         +P CQS +DC                     P  +SC+N LCI                            + CA   IC  NA C  + H+ VC+CP+G+ G P  E     K +C+V+ DCP                            + C  G+C+ PC     CGINA C   +HR  CVC   + G+P   C      C S+ +C     C +  C+ PC   E C  N +C       M  C+  +       C    C+V    + DCP+   C + +C DPC+   C   A C   +HR  C+C   +          P P PVV      + C S+A C  +Q C  + C++ C   + C+ N  C      PL      C         E C+ +T   V+GC S   C   LAC N  C +PC   +  C + A CSV NH+A C+CP G  GDP   C  PV+   CS   +C +   C+   C   C+ +N  C  N +C+    RP+C     C  G I     FC +  C S+  C  +++C N  C +PC  + CGQ AECSV  HQA C CP    G+P I C  L                +   C K C S+  C  G  C +    ++CT S P     L   G  +         P C  D+DCS    C+   CQNPC++ +  C  + +C V N  P+    C+CP G       +CK++    +C  +S+C  ++ C  G+C+  CL+   CG +A CKS  H   C C   +VG+P+       + CL +P     I   L         AGCT D    S   C   L IDPC N  C  +A C V     +C C +    G P   C    E +C  D DCPS  +C    C  PCS  + CG+NA C V+ H+  C C   + G P+                QI E  GC+ D +C    AC  +  +C +PC    C  N +CI  +H+ +CKCK       +G      +  EC    +CP +  C N +C  PC     C    EC    H+ +         EV  C  D+ CP  +ACI  +C+NPC     C  N  C V +    + +   C  G++   +  C        VGC +  +C +  AC+N +CVNPC   + C  T  CEV  H + C             C PG T        +P     + E  E      C  +SDC  +K C  ++  CI  C     CG N  C+ ++H P+C C+ G  G+P   C                  +Q  ++PC+ + CG  A C+ +    IC C  G  G+PF+ C +   +CR  + C  N  C M   +  C+ L  FE                 NPC     C+  N+ ++C C+P    +     G VL S PV +        +  EC ++D   DC           Q  C+ +NPC PS        +   +  + CSCR G+     GD     G + EC  +SDC     C +  C+D C    CGI A+C  +NH   C+C     G+P   C    P+V E   P              CR  S                           +CP    C N+KC DPC     CG +A C+++ H  +C+C EG+ GDP  +C        PP P        C  +++C +VE                                AC+N KC +PC   CG NA C  +NH  +C CP G+ G+P   C +     DE     K  +C+ N C        P AI     P N V  C CP  + GDPY  C   EC +N DCN  +AC  +KC+DPC     C  NA CK + H  +C C     GN F  C + +P  P+E ++                                      ECVV SDC   LACL+  C +PC     C  +A C V+   P    +CTC   +      SC         P +  NP                                   P C+   EC   +ACV + C +PC   CG  A+C +  H PIC CP G+ G+P   CN                   P G                              C  + EC S +AC++  C +PC+    CG +A+C    HNA C C  G+ GDP++GCS++  +   E P        + IDPC   +PC   A C SR+    CRC   + GDPY  C     PEC+ + +C   +AC  +KC +PC     C   A C V    P+    C C  GY       C+ +PP                        ++G                    C  + DC+  T+C+N  C  PC   CG NA C++ +H P+C C PGF GDP   C   V                                                  C  + EC    AC    C   C      CG  A C+   HQ  C CP G +G+PF  C  V        PT       +  D C  S PCG+ ++C+ +     C+C  G+ G+   +C      C ++ DCP+ ++C+  +C++PC     CGINA C+     P+    C+C+ GY GDA  +C  +                   PTG    E  D C P  C   +     N G CVC+ +R    +P + +                  P+C    +C     C +   TC +PC    CG NA     +H   C C +GY GDP  GC  + +    T  PRP
Sbjct:  805 IDECRESNACGANSLCSNFAGNYTCSCQEGYAGDP---------------------------YTGCID---LNECLSN-PCGAGAKCINQYGGYLCECPAGAKGDPYTSC------------------GTLDQ-----CQSKPCGLNAKCYNDGGSYRCECPQGFQGNP-----------------KQQCLDVN---ECLRNPCGQNAACINTEGSYQCACKQGLTGDPFTACSDTDECSAQSN----------------PCGSNAVCRNTNPGFVCECPPGFSGN-GNVAC----EATEVRTLCQSNFDCTNNAVCQKGECLCRSGFTAAGTLCLDVDECRSTPGICGANAVCRNTLGSFTCSCLTSFVGSPPSVPCS-EPCKGVTCSQHAYCKAEQKDAYCVCEDGWTYDPKNIAAGCIDVNECGAPGTCGENSLCTNLPGSFICQCKPGYTGNPQVRCIDI--------DECKSVSTC---------------GFGTTCENLPGSYKCGCPSGSVADPNNPAECISVKTCQKNNDCPGNAFCSPSKMCVCPEPNQGPNCESPCENVFCAANSQCTLINGQPRCMCHQGYQ--PAGQGKQ-GCIDINEC------------------LGQPCGKGAFCENTPGGYRCKCPSGLSGDPNIACKGEIEAI---QCSVSKPCPSGELCSQGKC--------------------VCQRGFQRE----SSGLCRDLDECTRAS---ASEEPACGLNAFCKNLPGSFDCECPAGYNGNPFVKCSSCNGPDCGCQPPYSQDGENCILAGCKNKGDCSEGAECITIAGGVSYCACPSGFNVQPDGTCADIDECLSTSRPCGFGALCENKIGSFSCVCPIGTTGDPYSGVCSANQAQCSRDNDCRPNEKCVEPGQCICPPPFFSDTTDGGKCKSPCERFMCGINADCS-PTNPPQCLCKAGYNGDPIQGCLDV--------------------DECAQNPCGPEARCLNEAGSYKCQCPKGTRGDPYLAGCKGTPSRVECTRDEECPGLLSCQASVCINPCSSIPCGENAVCIPENHAAWCRCKVGY-----------------------------KENSEGKCTSMCDGVI-CGLNAQCII----SPTGPTCACSKGTLGNPFPGGSCVPET----CSGANPCPQPLSCISGKCRERC-DSFSCGLNAACD--GNTNKCFCREGFVGDGNFLCMPPILPPICTPGCGSHSHCAYG---IPNQCICNSEFGGNPYEGCSPSTIDIVQDCKCGSNAECVTDGTSKVCTCKEGFDGNPFIGCFDINECTNKICGKNAVCINTIGNYDCRCELDYKGNPFEACFPEQPTIADLCTEKQCGPNAVCSVGQ----CLCLTGFKGDAEDLRTGCQSSTCSNNLDCGYNEICQSVKGQYRCIDACGNVQ-CGPNSRCVTDNHHSTCICQDGYSGNPLDL---SGGCVREVTCKTQNDCPTGSVCSINISGKRSCVDPCRIMS-CGKYEICSVKNNRPF----CQCSPTHIRNPVTGQCEIASVPS-CSNDGQCSEDQVCRPDSLGILRCTPICQLFTCPQNSQCRASNHQGFCQCFEGYNGNPNDRTGCSLISKDQ-------CLSDAQCSEEEVCSLTLKKCIPACNTIVCGPQAVCITQNHSPQCTCPPGKFKGDPNDPVLGCKAVSCLTNTDCPPTKFCDRLSYTCMDVCTADTCGKNAVCLPEQQRPKCSCPPGTKPDPLPEVRCSTLNACSKKPCHSSASCSSTTTGFSCSCPQGQVGDP----NKSGCFPEGSCPNGDRDCPDKSICIRGMCKNIC-YDSCGPNTECSINNRQAQCQCLQGFIPSPLDARTCIRDSQGCRKDADCIGGSTCQGGQCRYSCR--GQNDCLVGEQCSDSMCMISCISSQQCPS-SQVCSNGVCSIGCRNNENCPSDEVCISFKCVNPCQQEGACGPNALCKVSG----KNVQCSCPERFAGVPTPQQGCVRIPARCPNGKCPPQHTCKGGMCHWQCQINANCAKGERCLDGLCTKVCHSDKNCLQGEICIDSTCQPGCNKEEDCRPGEICQGGSCVCAIGFINTP-AGCQDINE--------------CENSICHPSANCANIPG----------SFKCTCPRGLVGDPYTKGCKNPNECTTNRDCGPQLACAGDGSGYRKCVNPCDRAKCGTNANCEVQKHKPFCKCFDKHVGNPSSPLGCTKVECEKNTDCNGDKVCQVANNRCIDACNIV-SCGR-GTCSATNHVPSCRCEPGYIFSNNQCVDIDECQNSPCEPTAICINTVGAYQCQCPPGTVPDAFGRCRSSDQCLSDNDCPKTAACNNGKCQNPCEIPGSCGADAICTPANHRPM----CSCPPRTNGNPQVRCVPL----ECVSNSDCNSERTCVRNKCVDVCSLPNVCGQNTNCRATNHIARCFCLPGFTGEPTLGCTQLQLCTVEEQCPSGMLCSFGICSPPCQSSRDCLDNQLCNGGSCISKCQDSTQCPPLHSCQNGLCIQESRCSNDVDCDEVDTCVGRENGLFECEDACAGPVICGRNAKCTSLGHKAVCTCPDGFFGDPNNEKIGCQKKQCLVNGDCPGDSVCDKFICTQPPVTGTCTNDRNCQANEVCDKGQCKDPCGIQGSCGINAFCSVQSHRKQCVCPQDFTGNPEVECVRIPSTCYSSSDCPQPMQCADGICMPPCSSDENCAINERC--LQGLCMLTCRVDNDCFLGHVCLNKMCIVGCRANSDCPESNTCINNRCTDPCRGDTCGPNAKCQVVDHRAQCSCPPRFI---------PNPTPVVGCVKQPQTCSSNAQCPERQVCDGKFCKDVCFNDKNCLVNEVCDNGICKPL------CRRDDDCNSQEICKGVT--CVLGCRSSSNCPNDLACINNQCTDPCSSSTTSCGNNALCSVANHQAVCSCPAGLTGDPTRGCRHPVQ--VCSSSTQCRQGYKCVGGVCAASCSSSNENCLLNEVCVKGTCRPLCNSNADCSDGYICK-ERFCVA-GCSSDSQCKENQACINSQCQDPCLSSSCGQCAECSVSNHQAFCSCPASSTGNPSIGCLPLTYTCGKSSDCGRGQRCEDGVCVKKCGSSSSCECGKTCVSGQCRQECTSSVPCPQGHLCKGGTCL---------PGCIGDNDCSDQELCLAGKCQNPCLLESTGCAKSAECRVTNHRPV----CLCPQGLQGNPKIECKRI----ECRTNSECEHTKSCIEGSCVNLCLLPNACGISAQCKSIRHQKKCSCPQKYVGNPNIECVLDKNECLSSPCGENAICQDLVGGYDCKCKAGCTGDGF--SGCICGGPL-IDPCRNARCGLDALCTVGGGIALCVCPNNKPNGDPLVECTSEKEGKCRADFDCPSSQSCKKGKCVDPCSLRAACGVNAICTVRIHKPRCECPQCHIGRPHVRCRPDPSCNTLPTKPQIVEPIGCQGDKDCSLGTACNRQNGKCFDPCGSTSCDFNKKCIVSNHKPICKCKYSLVVNQQGVLTCPDRQVECRTHNECPSNQACDNGRCKSPCDNPRICPAGKECQVLEHKAVCICTTGCNPEVSICLKDRGCPRGQACIGYQCKNPCEGTT-CPGNTPCIVEDH---KAVCKFCPPGFTTDANYGCIQ-----GVGCRSSSECPSKQACQNKKCVNPCGLGQ-CGATQDCEVANHLARCIDVPRCECSSRRDCLPGFTCEDCECVKNPDVDATVCEPSEGDCFEQCTINSDCPEDKYCDRFKRKCISVCPGF--CGDNTQCRFVNHNPICSCKQGFNGNPDVGCT----------------FNQPPSNPCIPSPCGSDAICELDNGNPICSCPRGKTGNPFVRCIQDGKKCRGNQ-CGPNSGCRMIADRPVCYCLPRFEGNPPAIPCVKPMKQCKPNPCGANTECVVVNNVQRCTCKPGYTESVNTIQGCVLISEPVISLCEPGPCGDNAECLVNDLGEDCRCNAGFGGNPFQG-CTPQNPCNPSPCGPNTECNEDRAGQIVCSCRRGY----QGDPTSDQGCKAECLRNSDCSRALACIAQKCIDPCP-GTCGIFAVCEVQNHNPICSCPPGTVGDPFSRCT-QQPVVTEPPRPKDPCNPSPCGTNAQCRQQSGQAICQCIRDYQGDPLIGCKPECLLSFDCPQDKACINSKCKDPCPGT--CGINAECQISNHNAICKCHEGYTGDPFAQCSLIPGVINPPEPADPCQPSPCGPNAECRIVESRPVCTCFPGYYGAPPSCRPECVINSECAPALACINLKCSNPCVGVCGINAKCDVVNHNPICSCPQGYIGDPFSSCRR---KPDEIRPTPKPDICNPNPCG-------PSAIRK---PRNGVCTCACPPGLFGDPYLGC-RPECILNSDCNRLQACSNNKCVDPC--PGTCGTNAECKIINHIPTCGCRKGFTGNAFEECTKPKPVQPVEGKEDPCGGNFCGAYSTQRVQGNRCVCSCLPGYFGFPPNCRPECVVSSDCSQNLACLSQKCSDPCPGR--CGVNARCHVISHHP----ICTCPPDYEGDPFTSCQKRPSTVTPPPKPSNPCYPSPCGPYSSCKPLRDRPMCSCNGGYIGSPPNCRPECLLSSECQLTKACVQQHCVDPCPGTCGANAECKVVNHNPICSCPRGYSGDPFFNCNKDPEVVTPSERPHIPCVPSPCGPNALCREVNGHEACSCVAGYIGSPPNCRPECVLNAECPSNKACIQQKCSDPCV--GACGYNARCTAVNHNAICTCPTGYTGDPFSGCSLVP-EVIREPP--------EIIDPC-NPSPCGANAECSSRNRAGACRCIKDHIGDPYVGCR----PECLINTECPNHLACSQKKCRDPCPGT--CGRNAQCSVRNHNPI----CTCNPGYSGDPTSACQIIPPPQPIEVDTDPCDPNPCGPNSQHREVNGVCVCACAPTYQGTPPNCRPECVVSSDCNQLTACVNQKCVDPCPGTCGNNARCQVTNHNPICQCPPGFTGDPFSNCVRVVVTQPPPRPQPVDPCNPTPCGQFSQCRNSNEVAACSCLPNYIGIPPNCRPECSINAECPSNRACVRERCIDPCPGA---CGPNAVCKVQNHQPICQCPTGFSGDPFRDCRRVVI------PTTVRTTEVI--DPCEPS-PCGANAQCRSRQRAGACTCVPGYFGDPYLACRP---ECVMNTDCPTNRACVNNKCVDPCPGV--CGINAICNANRHQPI----CTCLNGYTGDAITQCSLI-------------------PTGVPVVEELDPCDPNPCGAYSQHKEQN-GVCVCSCSRNMIGSPPNCR------------------PECLVSSECSQVTACMQQ--TCRDPCP-GLCGRNAECRVTNHNPICTCQRGYQGDPFTGCTKIPVTERVTQPPRP 15588          

HSP 9 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 1145/4513 (25.37%), Postives = 1621/4513 (35.92%), Query Frame = 0
Query: 5705 STAICKVINHKPFCSCR-DGYIGSSETSCQLPQKPEC--TKDSECANHLACIQQKCQ---------------DPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCRSYECLVDSDCPRHLACENEKCVDPCKCAKYADCKVTNHQGYCTCNSYYTGDPYGLAXXXXXXXXXXXXXLDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDXXXXXXXXXXXXKGYSGKGDEKCTRVEEIKEYG-----CKANSDXSPNLAC-IGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPIS---TGECKHDSDCLNSESCIDNQCE--------------DPCKVYT-PCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYE----CKTNEDCPFDKHCVGQKC---------------VNPCDTT--LCGTNAVCKSEYHQSICHCPRGLQGSPYVT-----CKEIECKSDIDCNTKEK---CNLENY------------ICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQ-----QMSCIDDRCQDP-----------CQLNKPCLVGQKCSVSNSL----PLRSITCECP-SNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNC-VNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCP-------------GHTACRNL-KCINPCAMDEP-CAITADCKVVHHQSLCTCPDGYIGSPQT----------DCQLPI--------------QPECTRDYEC-------------------PDNKACIQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYT-IC--NEPGCKSDFECPQQQACL-----------------NRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPCKCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKI-DPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPY--STCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCY--------NFECLSNDDCPFD--KKCI---------SEKCISPCLETI----CGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVE------CTKDSDCLNN-----------------EECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCR---LDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQT-----XXXXXXXXXXXXGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDCPSYNSCR----NRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPT--TECQLSPKPECIVDQDCPLTKAC--IIGKCESPCSANICGINALCRANNHRATCVCVSGYV----GDPYTVCEXPGCKSNLECLTTQAC--INKDCLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGDPYTFCR-----------------------PYECLV----------------------DRDCPDQLKCDHEKCVDPC--QCAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVV-------EEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNG--DPYSLCVPVE----------------------------------------DKECSYDDECSRTQSCIENQCIQICN----------------------VNNP-------------CSRNALCIMQNHRPICKCPPGTIGDPHNFC--HSYECLSNKDCPLDKSCQN-----KICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPY--ISCKLLXXXXXXXXXXXXXXXRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLV-FRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPC-VNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCELPSEPECLVDDDCPSDLACIHQSCKTPCSTST-CGINAKCNVKSHRAICVCIAGYDGDPYQICE------EPGCKSDIECPFDKACISRE-----CQNPCLYDE-CGVNAECIPKSHRAMCKCKKGHKGNP---YVHCKPYECLYDPDCPDHL--------------TCKNEK------------CVDPC----QCAKYAECDARNHRGIFPEPVEVEG------------CQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCEL----ITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIED-HECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEYECL----RDNDCPLNKACVSQKCTDPCL--TTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKE--------VECRKERDC----------KTNEKCDMNTY----KCFPLCDFENPCAEG-----------------------------------------ASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLXXXXXXXXXXXXXCREGFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDACRIRL--CGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECKPPTP--LSIGCSADSDCPVVEACLNTKC------------------VDPCN---CGENALCRKINHKAVCFCPSGF-SGNPEVLC---EKLECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVD----------------VECAINEDCNSERACYQD--KCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNP--FVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPC---NCGGGAKCFLSGHRPICQ-CPEGFIGNPQIEC-NPAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQC------------ECDEGF---------------------EGDPYTGCSIIGCKSDSECPNKKACRN--RDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDG-----YVK-------------GELKGCKTLP--PIISGCERNDDCSNSTSCINAICR-SPCACGLNADCKIIDHQPVCTCKPGF------------YGDPEIE-CTDTVCQSDNECQETHACRNGECTQVCGADNL------------PCGGEAEC-RGVAHQATCYCPAGLTGNPFVTCN-IVSCSDNSDCPTDKECINKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFIGNKGTSCVKVSVT-----------------------------------------------CEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECF----------PVKTC------PANSGLILDNREECVC-PTGFGFTEN-------KDECIPCLKENGFILNNEGKCVCNDARGYEYNPDSGKCECPPGERLNNFGICERVPDCEEDPDCPTQKYCEKTNGTCSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVII 9481
            +T + ++   +  C  + D Y+GS E   +L     C  T    C N  AC+  +C                + C    C + A C        C C   Y GD ++ C++                  EC  P L  +C ENAEC     E  CKC   F+GD  V+CR  +                +C +   C   + C        C+C   Y GDPY                          CI+    N CL  +PC   A+C                                I +YG     C A +   P  +C    QC S      PC   A+C        C CP G  G+P   CL ++      C  ++ C+N+E      C+              D C   + PCG NA C  TN   VC+C  G  GN +  C + E    C++N DC  +  C   +C               V+ C +T  +CG NAVC++      C C     GSP        CK + C     C  ++K   C  E+             I V  C  P  C  N+ C        CQC P Y G+    C   +E K    C     C       +  C      DP           CQ N  C     CS S       P +   CE P  N   + N  C  I  +  C        +   K G   +N C    CG  + C+ +     C+C  G +GDP   C   I   + S++  C   + C                  CR+L +C    A +EP C + A CK +     C CP GY G+P             CQ P               + +C+   EC                   PD       +CL+  TS  CG  A C        C C  G  GDPY+ +C  N+  C  D +C   + C+                   +C++PC    CG+NA CSP N    C C  G+ GDP   C   +    + C    +C NE     C+C +                    GDPY   C   P  V    EC  D++CP   +C  + CINPC +  PC + A C   +        C C  GY    + +C  + D +I                              CG  + C        C CS G +G+P+   +CVP   + C   + C    +C++ +C + C++ + CG NA C+   ++  C C +GF GD +  C            C S+  C +    +CI          E C    ++ +    CG+ AEC  +  + VC C  G  GNP++ C ++       C K++ C+N                  E C         LC  E  C  +A+C   +    C C T F GD +    ++     S  C  + DC  +  C S + Q  C     +  C    +CV  +   T    C C D    N           V C+T            ++    +CVD CR  SCG Y  C    +   C C   +  +P T       Q E +  P C +D  C     CR      L   P  +   C  N+ C+  NH+  C C  GY G+P   T C L  K +C+ D  C   + C   + KC   C+  +CG  A+C   NH   C C  G       DP   C+   C +N +C  T+ C  ++  C+D C  + CG+NA C P   R  C C  G K DP    R                        + C                        DRDCPD+  C    C + C   C     C   N +  C C+  +           IP P+         +GC  DADC+    C   +C+  C     C+   +C   D++ + +    C         + C        +GC +++ C +   C +  CVNPC +E  C   A C V      C+CP  F G   P   CV +                                          K C  D  C + + CI++ C   CN                      +N P             C  +A C        C CP G +GDP+     +  EC +N+DC    +C       + CVNPC +  CG NA C V+ H+  CKC   + G+P   + C  ++C  + DC  D+ C      C   CN    C  G  C+A +H+  C C    I    + C++       ECQ                      N PCE    CI  NT+   +  C CP G      G+C+      QC   +DC  +  C+ G C   C +   CG +A+C   +H   C C P   G+P   C+  P+         C  ++DC S   C    C+D C + + C +N  CR   H   C C  G+ G P   C       C V++ CPS + C    C  PC +S  C  N  CN  S   I  C       P   C+      E  C +D++C     C+ RE     C++ C     CG NA+C    H+A+C C  G  G+P    + C+  +CL + DCP                 TC N++            C DPC     C   A C  ++HR     P +  G            C    DCP    C D  C  PC S   C  N  C       L  +TC        + D  C L    + +  +VGC  + DC  S  C N  C +PC  D  C   A+C+V  H++ C+CPP    +P  +   ++    C  ++ C   + C    C D C  DK C  N +C     +P+C+       +    C    C+      ++CP + AC++ +CTDPC   TT CG  A C    H+ +C C  GL G P   C+          +CR+   C           +NE C +N       C PLC+    C++G                                         A C   NH+  C C     GN  + C LP+      C    DC     C +  C   C   + C   +TC+        + S  C +G ++ K G C+     P C   +DC   E C +G C + C +    C  +A C   NH   C C     GNP++ C  I           CR++SEC     C    CV+ C++ + CG  A CK   H   C CP+ + G+P+IEC       LS  C  ++ C  +    + KC                  +DPC    CG +ALC      A+C CP+   +G+P V C   ++ +C +D DC + + C +  C +PC L   C +N  C    H  +C CP    G P+  C                  + C  ++DC+   AC +   KC DPC   + C  N  C    H   C C   L+ N    ++C +++        EC   ++CPS  AC N  C++PC +   C     C V++       VC C  G  P+               C+KD  CP  +AC+   C+NPC    C G   C +  H+ +C+ CP GF  +    C    GC S  EC S +AC    CVNPC +   CG    C    H A+C            +C  GF                     EGD +  C+I     +S+CP  K C    R CI  C     C     C   +H   C CK G+ G+P   CT   PP                    NPC +  PC   AIC +    P+    C CP G     +V+             G   GC+ +   P+     R +    +  C+  + +  P  CG N +C ++++   CTCKPG+              +P I  C    C  + EC       +  C    G +              PCG   EC    A Q  C C  G  G+P         C  NSDC     CI + C D C  +  CG  + C+V+NH   CSC  G +G+  + C +  V                                                C +  DCP  ++CI  +C +PC     CGINA C + +        C C EGY GD   +C           P   C      P     I+++R  C C P  +G   +         EC P L       +N    VC      +    +  C CP G   + F  C R PD       PT K          + C  NPCGP+A   P + +C C C  G  GDP LGC P  I
Sbjct:  346 TTEVLQIFKVEKLCDGKSDCYLGSDENQKELKCSNNCLYTTGHRCING-ACLDSQCHCNDGWGGKGCSMPDDNECKYRPCDVFAHCTNNIGSYACTCFPGYEGDGHN-CQDI----------------DECTIPELAAKCVENAECCNLPAEYVCKCKPGFEGDGQVECRDID----------------ECRESNACGANSLCSNFAGNYTCSCQEGYAGDPY------------------------TGCIDL---NECL-SNPCGAGAKC--------------------------------INQYGGYLCECPAGAKGDPYTSCGTLDQCQS-----KPCGLNAKCYNDGGSYRCECPQGFQGNPKQQCLDVNECLRNPCGQNAACINTEGSYQCACKQGLTGDPFTACSDTDECSAQSNPCGSNAVCRNTNPGFVCECPPGFSGNGNVACEATEVRTLCQSNFDCTNNAVCQKGECLCRSGFTAAGTLCLDVDECRSTPGICGANAVCRNTLGSFTCSCLTSFVGSPPSVPCSEPCKGVTCSQHAYCKAEQKDAYCVCEDGWTYDPKNIAAGCIDVNECGAPGTCGENSLCTNLPGSFICQCKPGYTGNPQVRCIDIDECKSVSTCGFGTTCENLPGSYKCGCPSGSVADPNNPAECISVKTCQKNNDCPGNAFCSPSKMCVCPEPNQGPNCESPCENVFCAANSQCTLINGQPRCMCHQGYQPAGQGKQGCIDINECLGQPCGKGAFCENTPGGYRCKCPSGLSGDPNIACKGEIEAIQCSVSKPCPSGELCSQGKCVCQRGFQRESSGLCRDLDECTRASASEEPACGLNAFCKNLPGSFDCECPAGYNGNPFVKCSSCNGPDCGCQPPYSQDGENCILAGCKNKGDCSEGAECITIAGGVSYCACPSGFNVQPDGTCADIDECLS--TSRPCGFGALCENKIGSFSCVCPIGTTGDPYSGVCSANQAQCSRDNDCRPNEKCVEPGQCICPPPFFSDTTDGGKCKSPCERFMCGINADCSPTNPP-QCLCKAGYNGDPIQGCLDVDECAQNPCGPEARCLNEAGSYKCQCPKGT-----------------RGDPYLAGCKGTPSRV----ECTRDEECPGLLSCQASVCINPCSSI-PCGENAVCIPEN----HAAWCRCKVGYKENSEGKCTSMCDGVI------------------------------CGLNAQCIISPTGPTCACSKGTLGNPFPGGSCVP---ETCSGANPCPQPLSCISGKCRERCDSFS-CGLNAACDGNTNK--CFCREGFVGDGNFLCMPPILPPICTPGCGSHSHCAYGIPNQCICNSEFGGNPYEGCSPSTIDIVQDCKCGSNAECVTDGTSKVCTCKEGFDGNPFIGCFDINECTNKICGKNAVCINTIGNYDCRCELDYKGNPFEACFPEQPTIADLCT-EKQCGPNAVCSVGQ----CLCLTGFKGDAE----DLRTGCQSSTCSNNLDCGYNEICQSVKGQYRCIDACGNVQCGPNSRCVTDNHHST----CICQDGYSGNPLDLSGGCVREVTCKTQNDCPTGSVCSINISGKRSCVDPCRIMSCGKYEICSVKNNRPFCQCSPTHIRNPVTG------QCEIASVPSCSNDGQCSEDQVCRPDSLGILRCTPICQLFTCPQNSQCRASNHQGFCQCFEGYNGNPNDRTGCSLISKDQCLSDAQCSEEEVCSLTLKKCIPACNTIVCGPQAVCITQNHSPQCTCPPGKFKGDPNDPVLGCKAVSCLTNTDCPPTKFCDRLSYTCMDVCTADTCGKNAVCLPEQQRPKCSCPPGTKPDPLPEVRCSTLNACSKKPCHSSASCSSTTTGFSCSCPQGQVGDPNKSGCFPEGSCPNGDRDCPDKSICIRGMCKNICYDSCGPNTECSINNRQAQCQCLQGF-----------IPSPLDARTCIRDSQGCRKDADCIGGSTCQGGQCRYSCRGQNDCLVGEQCS--DSMCMIS----CISSQQCPSSQVCS--NGVCSIGCRNNENCPSDEVCISFKCVNPCQQEGACGPNALCKVSGKNVQCSCPERFAGVPTPQQGCVRIPARCPNGKCPPQHTCKGGMCHWQCQINANCAKGERCLDGLCTKVCHSDKNCLQGEICIDSTCQPGCNKEEDCRPGEICQGGSCVCAIGFINTPAGCQDINECENSICHPSANCANIPGSFKCTCPRGLVGDPYTKGCKNPNECTTNRDCGPQLACAGDGSGYRKCVNPCDRAKCGTNANCEVQKHKPFCKCFDKHVGNPSSPLGCTKVECEKNTDCNGDKVCQVANNRCIDACNI-VSCGRGT-CSATNHVPSCRCEPGYIFSN-NQCVD-----IDECQ----------------------NSPCEPTAICI--NTV--GAYQCQCPPGTVPDAFGRCRSSD---QCLSDNDCPKTAACNNGKCQNPCEIPGSCGADAICTPANHRPMCSCPPRTNGNPQVRCV--PLE--------CVSNSDCNSERTCVRNKCVDVCSLPNVCGQNTNCRATNHIARCFCLPGFTGEPTLGCT--QLQLCTVEEQCPSGMLCSFGICSPPCQSSRDCLDNQLCNGGS--CISKCQDSTQCPPLHSCQNGLCIQESRCSNDVDCDEVDTCVGRENGLFECEDACAGPVICGRNAKCTSLGHKAVCTCPDGFFGDPNNEKIGCQKKQCLVNGDCPGDSVCDKFICTQPPVTGTCTNDRNCQANEVCDKGQCKDPCGIQGSCGINAFCSVQSHRKQCVCPQDFTGNPEVECVRIPSTCYSSSDCPQPMQCADGICMPPCSSDENCAINERC----LQGLCMLTC--------RVDNDCFLGHVCLNKMCIVGCRANSDCPESNTCINNRCTDPCRGDT-CGPNAKCQVVDHRAQCSCPPRFIPNPTPVVGCVKQPQTCSSNAQCPERQVCDGKFCKDVCFNDKNCLVNEVCDNGICKPLCR--RDDDCNSQEICKGVTCVLGCRSSSNCPNDLACINNQCTDPCSSSTTSCGNNALCSVANHQAVCSCPAGLTGDPTRGCRHPVQVCSSSTQCRQGYKCVGGVCAASCSSSNENCLLNEVCVKGTCRPLCNSNADCSDGYICKERFCVAGCSSDSQCKENQACINSQCQDPCLSSSCGQCAECSVSNHQAFCSCPASSTGNPSIGC-LPLTYT---CGKSSDCGRGQRCEDGVCVKKCGSSSSCECGKTCVSGQCRQECTSSVPCPQG-HLCKGGTCL-----PGCIGDNDCSDQELCLAGKCQNPCLLESTGCAKSAECRVTNHRPVCLCPQGLQGNPKIECKRIE----------CRTNSECEHTKSCIEGSCVNLCLLPNACGISAQCKSIRHQKKCSCPQKYVGNPNIECVLDKNECLSSPCGENAICQDLVGGYDCKCKAGCTGDGFSGCICGGPLIDPCRNARCGLDALCTVGGGIALCVCPNNKPNGDPLVECTSEKEGKCRADFDCPSSQSCKKGKCVDPCSLRAACGVNAICTVRIHKPRCECPQCHIGRPHVRCRPDPSCNTLPTKPQIVEPIGCQGDKDCSLGTACNRQNGKCFDPCGSTS-CDFNKKCIVSNHKPICKCKYSLVVNQQGVLTCPDRQ-------VECRTHNECPSNQACDNGRCKSPCDNPRICPAGKECQVLE----HKAVCICTTGCNPEVSI------------CLKDRGCPRGQACIGYQCKNPCEGTTCPGNTPCIVEDHKAVCKFCPPGFTTDANYGCIQGVGCRSSSECPSKQACQNKKCVNPCGLGQ-CGATQDCEVANHLARCIDVPRCECSSRRDCLPGFTCEDCECVKNPDVDATVCEPSEGDCFEQCTI-----NSDCPEDKYCDRFKRKCISVCPGF--CGDNTQCRFVNHNPICSCKQGFNGNPDVGCTFNQPPS-------------------NPC-IPSPCGSDAICELDNGNPI----CSCPRGKTGNPFVRCIQDGKKCRGNQCGPNSGCRMIADRPVCYCLPRFEGNPPAIPCVKPMKQCKPNPCGANTECVVVNNVQRCTCKPGYTESVNTIQGCVLISEPVISLCEPGPCGDNAECLVNDLGEDCRCNAGFGGNPFQGCTPQNPCNPSPCGPNTECNEDRAGQIVCSCRRGYQGDPTSDQGCKAECLRNSDCSRALACIAQKCIDPCPGT--CGIFAVCEVQNHNPICSCPPGTVGDPFSRCTQQPVVTEPPRPKDPCNPSPCGTNAQCRQQSGQAICQCIRDYQGDPLIGCKPECLLSFDCPQDKACINSKCKDPCPGT--CGINAECQISN----HNAICKCHEGYTGDPFAQCSLIPGVINPPEPADPCQPSPCGPNAECRIVESRPVCTCFPGYYGAPPSCRPECVINSECAPALACINLKCSNPCVGVCGINAKCDVVNHNPICSCPQGYIGDPFSSCRRKPDEIR----PTPK---------PDICNPNPCGPSAIRKPRNGVCTCACPPGLFGDPYLGCRPECI 12789          

HSP 10 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 1028/4102 (25.06%), Postives = 1486/4102 (36.23%), Query Frame = 0
Query: 6078 DPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEI-ECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQ----IDGDCPQQMSCIDDRCQDPCQL----------NKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNC---------------VNACDVVK--CGYNSECKQSFHQATCQCTRGYTGDP-----LKECNLIIPLQEA----------------------SINPGCSHDDDC------------------------PGHTACRNLKC--INPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQ------------CLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMC--SPKNHRGICSCIEGHKGDPYSFCK----PYECLIDSDCPTNLQCNNEKCV----------------DPC---------KCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECI-NPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACV-----------------NNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNFECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVV-CK----EVECTKDSDCLNNEECNLR--LAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTXXXXXXXXXXXXGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDC----PSYNSCRNRLCINP----------CAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLSPKPECIVDQDCPLTKACI--IG----KCE-------------------SPCSANICGINALCRANNHRATCVCVSGYVGDP---YTVCEXPGCKSNLECLTTQACINKD----CLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGDPYTF----CRPYECLVDRDCPDQLKCD-----HEKCVDPCQ---CAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQ----NPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEK--CELITEPVVVGCTSDKECSTSLACD--NGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIG-FNGDPYSLCVPVEDKECSYDDECSRTQSC--IENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDP--------HNFCHSYECL-------------------------------------SNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPY--ISCKLLXXXXXXXXXXXXXXXRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENT------------IPIKSVACV-----CPDGH----------------------STGK---DGKCKKV----------------TPQPQCYDSSDCRSSEVCHTGTCITACLVFR---------------CGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHN-----RLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCELPSEPECLVDDDCPSDLAC--IHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDG----------------DPYQICEE----------PG--------------CKSDIECPFDKACISRECQNPC-LYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPCQ----CAKYAECDARNH-------RGIFPEP----VEVEGCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNT-----ECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHECEQDSDCNGNKACVEY--------------------------ECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEY--ECLRDNDCPLNKACVSQKCTDPCLTTD-CGIKAKCKTEYHRGICVCEEGLQGSPFI------ECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPE-CRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLXXXXXXXXXXXXXCREGFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDAC--RIRLCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPC-IVNDPCGKDAFCKVNYHVPLCR----CPEGFEGDPSIECKPPTPLSIGCSADSDCPVVEACLNTKCVDPC---NCGENALCRKINHKAVCFCPSGFSGNPEVLCEKL--------------------------------------------ECTSDEDCSNDKMCHENTCANPCILLNPC----------------------AINGECIPSNHVSKCRCPSDMNGDPYSLCVDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCV----EKEPSPI---EVEKECVVDSDCPSQLACLND-----YCENPCYSLTPCHTS-----AMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCN----CGGGAKCFLSGHRPICQCPEGFIGNPQIECN----------------PAGCSSDKECRSTEAC--VEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGF----EGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCINAICRSPCA---CGLNADCKIIDHQPVCT------------CKPGF-------YGDPEIECT---------DTVCQSDNECQETHACR--NGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNIVSCSDNSDCPTDKECINKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFIGNKGTSCVKVSVTCEVDEDCPSKQ----------SCIEKECLN----PCV------YNEPCGINAYCSVYDTVPVRTMTCSCIEGY-------EGDASIECFPVKTC-PANSG-----LILDNREECVCPTGFGFT-------ENKDECIPCLKENGFILNNEGKCVCNDARGYEYNPDSGK---------------------------------------------CECPPGERLNNFGICERVPDCEEDPDCPTQKYCEKTNGTCSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIPPVKTDFPRPEMVVN 9496
            D C+    CG N+ C        C C++G  G+P++ C                      +N C +  CG  A C ++Y   +C CP G +G PY +C  + +C+S                        K C +NA C        C+C   + G+    C    E  + P  Q    I+ +   Q +C      DP             + PC     C  +N        CECP     + N  CE  +++T C+ + DC  + +C+ G C               V+ C      CG N+ C+ +    TC C   + G P      + C  +   Q A                      +I  GC   ++C                        PG+T    ++C  I+ C     C     C+ +     C CP G +  P    +      C ++ +CP N  C   +            C +PC ++ C  N++C +   +  C C  GY         +P  +       +Q C++    N C  + CG  A C  +P  +R  C C  G  GDP   CK      +C +   CP+   C+  KCV                D C          C  NA C+       C C + + G+P+ + C     P         D  C    +     CI   C     C++ A C    T+      C+C  G+  + D  C  ID  + T                           PCG  + C+ +     C C +G  GDPYS     N+ +C  D++C  N+ CV                   +C+ PC    +CG NA C   N    C+C  G+ GDP   C +                    +  C +  CG +A C  E  +  C+CP G +G+PY+  CK     VECT+D +C     C     +  C+ +      C ++A+C    H   C C   +  + +  C  +                  +  I             C    +C++  T PT    C CS     N       +     C     CP    C  G C + C   SCG  + C    + +KC C  G+ GD    C  P+    P  TPGC S   C    P+   C +    NP            +D  C  NA C       VC+C  G+ G+P   C      EC  ++ C     CI  IG    +CE                     C+   CG NA+C        C+C++G+ GD     T C+   C +NL+C   + C +      C+D C   QCG N++C   NH + C C++G+ G+P        R   C    DCP    C         CVDPC+   C KY  C  KN+R +C C   +  +P    CE    P     C +D  C   Q C           P      C +N++C+  +        C CFEGY+G  +++  C LI++     C SD +CS    C      C+ P      C   A C  +NH   CTCP G F GDP    +  +   C  + +C  T+ C  +   C+ +C  +  C +NA+C+ +  RP C CPPGT  DP         N C    C                                       ++DCP    C   +C N C  + CG N ECS+   QA C+C +G+  SP    +C         D         +   C   C   ++C +G +C+  D +   +C          VC     SI   C+ + +C ++  C++  C NPC     C  N  C V               +P     CV     CP+G                       + G+   DG C KV                T QP C    DCR  E+C  G+C+ A                    C  +A C +   SF C C    VGDP+      P          CT + DC    AC       R C++PC    C  NA C V  H+P C C D ++G+P +     ++ EC  + DC  D  C   +  C   C+  +CG    C+  +H   C C  GY                  +P  IC            PG              C SD +CP   AC + +CQNPC +   CG +A C P +HR MC C     GNP V C P EC+ + DC    TC   KCVD C     C +   C A NH        G   EP     +++ C +++ CPS   C    C  PC S R C++N  C   + +        C++         C+         CSND DC     C        EC + CA    C + A+C    HK+ CTCP G  GDP +  +  +  +C  + DC G+  C ++                          +C DPC     CG NA C    HR  C C     G+P   C      C   +DCP    C    C  PC + + C I  +C     +G+C+    +    F+      +   V CR   DC  +  C  N  +C   C  +  C   A C   +H+ +C C P  + N   +       ++P+ C  +  CP +  C  + C++ C     CL +E C       +      CR          C  V     CRS S+C  +  C +  C D C      CG NA+C   NH++ C+C    +G+P   C    P+ V      C S ++C    +C    C   C   N+ C  +  C      PLC     C +G+       CK    ++ GCS+DS C   +AC+N++C DPC   +CG+ A C   NH+A C CP+  +GNP + C  L                                            ECTS   C    +C   TC   CI  N C                      A + EC  +NH   C CP  + G+P   C  +EC  N +C   ++C +  C++ C+L N C  +A CK+++H   C C    +GNP + CV    E   SP     + ++ V   DC  +  C  D      C  P   + PC  +     A+C+V         +C C     P  D   +   +     C  D +CPS+++C    C +PC+    CG  A C +  H+P C+CP+  IG P + C                 P GC  DK+C    AC      C +PC     C  + KC  + H   C+C        +G        + C++ +ECP+ +AC N  C  PC     C     C   +H A C C  G   +P  S        C++D  C  G ACI  +C NPCE    C     C V +   V      CP G+      GC        GC  + +C +  +C N  C +PC    CG   DC++ +H   C             C PGF         +P+++ T            C  +++C E   C     +C  VC      CG   +CR V H   C C  G  GNP V C                  N+  ++ C I +PCGS + C++ N    CSC  G  GN    C++    C  ++  P+             C+ +   N    PCV         PCG N  C V + V      C+C  GY       +G   I    +  C P   G     L+ D  E+C C  GFG         +N     PC        +  G+ VC+  RGY+ +P S +                                             C CPPG   + F  C + P   E P                +PC  +PCG NA          CQCI+ Y GDP +GC P  +  +  D P+ +  +N
Sbjct:  808 DECRESNACGANSLCSNFAGNYTCSCQEGYAGDPYTGCID--------------------LNECLSNPCGAGAKCINQYGGYLCECPAGAKGDPYTSCGTLDQCQS------------------------KPCGLNAKCYNDGGSYRCECPQGFQGNPKQQCLDVNECLRNPCGQNAACINTEGSYQCACKQGLTGDPFTACSDTDECSAQSNPCGSNAVCRNTNP----GFVCECPPGFSGNGNVACEATEVRTLCQSNFDCTNNAVCQKGECLCRSGFTAAGTLCLDVDECRSTPGICGANAVCRNTLGSFTCSCLTSFVGSPPSVPCSEPCKGVTCSQHAYCKAEQKDAYCVCEDGWTYDPKNIAAGCIDVNECGAPGTCGENSLCTNLPGSFICQCKPGYTGNPQVRCIDIDECKSVSTCGFGTTCENLPGSYKCGCPSGSVADPNNPAECISVKTCQKNNDCPGNAFCSPSKMCVCPEPNQGPNCESPCENVFCAANSQCTLINGQPRCMCHQGY---------QPAGQG------KQGCIDI---NECLGQPCGKGAFCENTPGGYR--CKCPSGLSGDPNIACKGEIEAIQCSVSKPCPSGELCSQGKCVCQRGFQRESSGLCRDLDECTRASASEEPACGLNAFCKNLPGSFDCECPAGYNGNPF-VKCSSCNGP---------DCGCQPPYSQDGENCILAGCKNKGDCSEGAECI---TIAGGVSYCACPSGFNVQPDGTCADIDECLST-------------------------SRPCGFGALCENKIGSFSCVCPIGTTGDPYSGVCSANQAQCSRDNDCRPNEKCVEPGQCICPPPFFSDTTDGGKCKSPCERF-MCGINADCSPTNPPQ-CLCKAGYNGDPIQGCLD--------------------VDECAQNPCGPEARCLNEAGSYKCQCPKGTRGDPYLAGCKGTPSRVECTRDEECPGLLSCQASVCINPCSSI-----PCGENAVCIPENHAAWCRCKVGYKENSEGKCTSMC-----------------DGVI-------------CGLNAQCIISPTGPT----CACSKGTLGNPFPGGSCVP--ETCSGANPCPQPLSCISGKCRERCDSFSCGLNAAC--DGNTNKCFCREGFVGDGNFLCMPPI--LPPICTPGCGSHSHCAYGIPNQCICNSEFGGNPYEGCSPSTIDIVQDCKCGSNAECVTDGTSKVCTCKEGFDGNPFIGC--FDINEC-TNKICGKNAVCINTIGNYDCRCELDYKGNPFEACFPEQPTIADLCTEKQCGPNAVCSV----GQCLCLTGFKGDAEDLRTGCQSSTCSNNLDCGYNEICQSVKGQYRCIDACGNVQCGPNSRCVTDNHHSTCICQDGYSGNPLDLSGGCVREVTCKTQNDCPTGSVCSINISGKRSCVDPCRIMSCGKYEICSVKNNRPFCQCSPTHIRNPVTGQCEIASVP----SCSNDGQCSEDQVCRPDSLGILRCTPICQLFTCPQNSQCRASN----HQGFCQCFEGYNGNPNDRTGCSLISKDQ---CLSDAQCSEEEVCSLTLKKCI-PACNTIVCGPQAVCITQNHSPQCTCPPGKFKGDPNDPVLGCKAVSCLTNTDCPPTKFCDRLSYTCMDVCTADT-CGKNAVCLPEQQRPKCSCPPGTKPDPLPEVRCSTLNACSKKPCHSSASCSSTTTGFSCSCPQGQVGDPNKSGCFPEGSCPNGDRDCPDKSICIRGMCKNICYDS-CGPNTECSINNRQAQCQCLQGFIPSPLDARTCIRDSQGCRKDADCIGGSTCQGGQCRYSCRGQNDCLVGEQCS--DSMCMISCISSQQCPSSQVCSNGVCSIG--CRNNENCPSDEVCISFKCVNPCQQEGACGPNALCKVSGKNVQCSCPERFAGVPTPQQGCVRIPARCPNGKCPPQHTCKGGMCHWQCQINANCAKGERCLDGLCTKVCHSDKNCLQGEICIDSTCQPGCNKEEDCRPGEICQGGSCVCAIGFINTPAGCQDINECENSICHPSANCANIPGSFKCTCPRGLVGDPYTKGCKNPNE--------CTTNRDCGPQLACAGDGSGYRKCVNPCDRAKCGTNANCEVQKHKPFCKCFDKHVGNPSSPLGC-TKVECEKNTDCNGDKVCQVANNRCIDACNIVSCG-RGTCSATNHVPSCRCEPGYIFSNNQCVDIDECQNSPCEPTAICINTVGAYQCQCPPGTVPDAFGRCRSSDQCLSDNDCPKTAACNNGKCQNPCEIPGSCGADAICTPANHRPMCSCPPRTNGNPQVRCVPLECVSNSDCNSERTCVRNKCVDVCSLPNVCGQNTNCRATNHIARCFCLPGFTGEPTLGCTQLQLCTVEEQCPSGMLCSFGICSPPCQSSRDCLDNQLCNGGSCIS------KCQDSTQCPPLHSCQNGLCIQESRCSNDVDCDEVDTCVGRENGLFECEDACAGPVICGRNAKCTSLGHKAVCTCPDGFFGDPNNEKIGCQKKQCLVNGDCPGDSVCDKFICTQPPVTGTCTNDRNCQANEVCDKGQCKDPCGIQGSCGINAFCSVQSHRKQCVCPQDFTGNPEVECVRIPSTCYSSSDCPQPMQCADGICMPPCSSDENCAINERC----LQGLCMLTCRVDNDCFLGHVCLNKMCIVGCRANSDCPESNTCINN--RCTDPCRGDT-CGPNAKCQVVDHRAQCSCPPRFIPNPTPVVGC---VKQPQTCSSNAQCPERQVCDGKFCKDVCFNDKNCLVNEVC------DNGICKPLCRRDDDCNSQEICKGVTCVLGCRSSSNCPNDLACINNQCTDPCSSSTTSCGNNALCSVANHQAVCSCPAGLTGDPTRGCR--HPVQV------CSSSTQCRQGYKCVGGVCAASCSSSNENCLLNEVCVKGTCRPLCNSNADCSDGY------ICKERFCVA-GCSSDSQCKENQACINSQCQDPCLSSSCGQCAECSVSNHQAFCSCPASSTGNPSIGCLPLTYTCGKSSDCGRGQRCEDGVCVKKCGSSSSCECGKTCVSGQCRQECTSSVPCPQGHLCKGGTCLPGCIGDNDCSDQELCLAGKCQNPCLLESTGCAKSAECRVTNHRPVCLCPQGLQGNPKIECKRIECRTNSECEHTKSCIEGSCVNLCLLPNACGISAQCKSIRHQKKCSCPQKYVGNPNIECVLDKNECLSSPCGENAICQDLVGGYDCKCKAGCTGDGFSGCICGGP--LIDPCRNARCGLDALCTVGGG----IALCVCPNNK-PNGD-PLVECTSEKEGKCRADFDCPSSQSCKKGKCVDPCSLRAACGVNAICTVRIHKPRCECPQCHIGRPHVRCRPDPSCNTLPTKPQIVEPIGCQGDKDCSLGTACNRQNGKCFDPCGSTS-CDFNKKCIVSNHKPICKCKYSLVVNQQGVLTCPDRQVECRTHNECPSNQACDNGRCKSPCDNPRICPAGKECQVLEHKAVCICTTGC--NPEVS-------ICLKDRGCPRGQACIGYQCKNPCEGTT-CPGNTPCIVEDHKAVCKF---CPPGFTTDANYGCIQG----VGCRSSSECPSKQACQNKKCVNPCGLGQCGATQDCEVANHLARCIDVPRCECSSRRDCLPGFTCEDCECVKNPDVDATVCEPSEGDCFEQCTINSDCPEDKYCDRFKRKCISVCPGF---CGDNTQCRFVNHNPICSCKQGFNGNPDVGCT----------------FNQPPSNPC-IPSPCGSDAICELDNGNPICSCPRGKTGNPFVRCIQDGKKCRGNQCGPNSGCRMIADRPVCYCLPRFEGNPPAIPCVKPMKQCKPNPCGANTECVVVNNV----QRCTCKPGYTESVNTIQGCVLISEPVISLCEPGPCGDNAECLVNDLGEDCRCNAGFGGNPFQGCTPQNPCNPSPCGPNTECNEDRAGQIVCSCRRGYQGDPTSDQGCKAECLRNSDCSRALACIAQKCIDPCPGTCGIFAVCEVQNHNPICSCPPGTVGDPFSRCTQQPVVTEPP-------------RPKDPCNPSPCGTNAQCRQQSGQAICQCIRDYQGDPLIGCKPECL--LSFDCPQDKACIN 12183          

HSP 11 Score: 97.0561 bits (240), Expect = 4.375e-18
Identity = 204/871 (23.42%), Postives = 302/871 (34.67%), Query Frame = 0
Query: 8721 PCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDC---PSQLAC-----LNDYCENPCYSLTPCHTSAMCSVVDT-SPFR-TMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCNCGGGAKCFLSGHRPICQCPEGFIGNPQIECNPAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCINA--ICRS------------------PCACGLNADCKIIDHQPVCTCKPGFYGDP-----EIECTDTVCQSDNECQETH-----ACRNGE----------CTQV--CGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNIVSCSDNSDCPTDKECINKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFIG--NKGTSCVKVSVTCEVDEDCPSKQSCIEKE------------CLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYE--GDASIECFPVKTC---PANSGLILDNRE---ECVCPTGFGFTENKDECIPCLKENGFILNNEGKCVCNDARGYEYNPDSGKCECPPGERLNNFGICERVPDC-----EEDPDCPTQKYCEKTNGTCSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIPPVKTDFPRPEMVVNCLSDGVLVNVDLKDGG 9512
            PC   A C     + +C C P   G+        E +  E+  +CV +++C   P++  C          +  C  +  C  S  C      S F     C+C+EG+                 GC+  +EC SN             CG GAKC       +C+CP G  G+P   C      +  +C+S                 PCG++AKC  +  + +CEC +GF+G+P                 K+ C +   ++ CL+ NPC   A C++ +   QC CK G  GDP+ +C+         D D  +  +              PC   A+C            CECP G+       C+    + + C+ N DC+N+  C     +CRS                  P  CG NA C+       C+C   F G P        C    C     C+         C +G           C  V  CGA    CG  + C  +     C C  G TGNP V C  +                    D C   + CG  + C+       C C  G +   N    C+ V  TC+ + DCP    C   +            C +PC  N  C  N+ C++ +  P     C C +GY+  G     C  +  C   P   G   +N      C CP+G     N    I C  E   I     +C  +           GKC C  G +  + G+C  + +C      E+P C    +C+   G+                  +D    C+C  GY+G+P + C     P      P  +   NC+  G     D  +G 
Sbjct:  577 PCDVFAHCTNNIGSYACTCFPGYEGDGHNCQDIDECTIPELAAKCVENAECCNLPAEYVCKCKPGFEGDGQVECRDIDECRESNACGANSLCSNFAGNYTCSCQEGYAGDPYT-----------GCIDLNECLSNP------------CGAGAKCINQYGGYLCECPAGAKGDPYTSC-----GTLDQCQS----------------KPCGLNAKCYNDGGSYRCECPQGFQGNP-----------------KQQCLD---VNECLR-NPCGQNAACINTEGSYQCACKQGLTGDPFTACS---------DTDECSAQS-------------NPCGSNAVCRNTNPG----FVCECPPGFSGNGNVACEATE-VRTLCQSNFDCTNNAVCQKGECLCRSGFTAAGTLCLDVDECRSTPGICGANAVCRNTLGSFTCSCLTSFVGSPPSVPCSEPCKGVTCSQHAYCKAEQKDAYCVCEDGWTYDPKNIAAGCIDVNECGAPGT-CGENSLCTNLPGSFICQCKPGYTGNPQVRCIDI--------------------DECKSVSTCGFGTTCENLPGSYKCGCPSGSVADPNNPAECISVK-TCQKNNDCPGNAFCSPSKMCVCPEPNQGPNCESPC-ENVFCAANSQCTLINGQP----RCMCHQGYQPAGQGKQGCIDINECLGQPCGKGAFCENTPGGYRCKCPSGLSGDPN----IACKGEIEAI-----QCSVSKPCPSGELCSQGKCVCQRGFQRESSGLCRDLDECTRASASEEPACGLNAFCKNLPGS------------------FD----CECPAGYNGNPFVKCSSCNGPDCGCQPPYSQDGENCILAGCKNKGDCSEGA 2739          
BLAST of EMLSAG00000008211 vs. C. finmarchicus
Match: gi|592923373|gb|GAXK01035042.1| (TSA: Calanus finmarchicus comp111832_c2_seq1 transcribed RNA sequence)

HSP 1 Score: 1242.25 bits (3213), Expect = 0.000e+0
Identity = 644/1164 (55.33%), Postives = 824/1164 (70.79%), Query Frame = 0
Query: 8711 KCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPI--EVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCNCGGGAKCFLSGHRPICQCPEGFIGNPQIECNPAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCINAICRSPCACGLNADCKIIDHQPVCTCKPGFYGDPEIECTDTVCQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNIVSCSDNSDCPTDKECINKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFIGNKGTSCVKVSVTCEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECFPVKTCPANSGLILDNREECVCPTGFGFTENKDECIPCLKENGFILNNEGKCVCNDARGYEYNPDSGKCECPPGERLNNFGICERVPDCEEDPDCPTQKYCEKTNGTCSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGC-IPVIIPPVKTDFPRPEMVVNCLSDGVLVNVDLKDGGNFRGVMYVKGHSKDSNCIKHIDSGGSLKPI-DFQVSFGKCGLFHSQGEANFVLVVQKHPKLETYKAQAYRIKCLYDVGETNINVNFNVSMITTAGTVRNDGPPPNCTMKICNENGEDISSANVGEKLMLKVIVSPREIYGGLARSCIARSLDDSKFEEEYAVTDANGCATDPEIFQEWKLDRNTGYLTALFDAFKFPDSINLKFKCIVRICFGQCQPQNCGGRNAFGRRRKRESSHIIDGKVYTGQLREETDVYSNAIETLESSPQNEPFNSATXXXXXXXXXXXXVCVSKIGFXXXXXXXXXXXXXXXXXXXXCWLMAYRKRPKSSGPLPHPREFPNPLFSSPEPPIHHLDEPDPDYL 9870
            +C++PC+ +NPCAP+A C    H + C+C P  +GNP VSC  KE SP+  + E EC  D DCP   ACLN+ CENPC +L+PC  +A+C+VV++ PFRTM+C+CREGW+P  D  C P+E PN PGC +DD+CP+  AC+NR C +PC+CG GA+CF+  HRP+C CP G++GNPQI C P GC SD +CR  + C++  CVNPCL+ DPCG  A+C P  H A C C  G+EGDP+  C +IGC+ D+ECP  KACR++DCI+PCL +NPCA  A C+  +H   CRC VGY G+P  +C  IP PECVED DC +  AC++  C   C+ L PC + AIC VI+SLPV+ M C CPDGYV  E   C+TLPPI+SGC  +D+C  S SCIN IC+ PCACG +A C++I+H+PVCTC+ G+ G+P++ C    C+ D++C +THACRN +C  VCG  N PCGGEA C  ++H+ATC CP GL G+P+VTC  + C  + DCP+DK C N  C   C+I NPC   SEC V +H+V+C C  GF G+KGTSC +  + C  D +CPS+ +CI ++C++PC   +PCG NA C V DT+PVRTM C CI GY+G+A+IEC PV TCP   GLILD  E+CVCP G+ +++N+  C+ C  E GF+L    +C+C+ ARG   + D  +C CPP   L   G C  + +CE D DC   KYCE  N TC +PC + PCGPNA+G    H C C+CI+GY G+P  GC      PPV  DF RP++ VNCL+DGVLV ++L+D  NF+GVMYVKGHS D  C + +++      I DF+V FG CGLFHS GEANFVLV+QKHPKL T+K+QAYRI+C+Y+ G   I+V FNVSM+TTAGT+ N GPPP C+M+ICN NGEDI  A +G++LMLKV V P  IYGG AR C+A ++DD   E EY VTD NGCATDP IF EW+ +R+ G LTA+F+AFKFP S N++F+C +R+CFGQCQPQNC G NA+G R+KRE+    +  VYTGQLREE  V SNAI T+E   ++       +     S GDEEVCVSKIGFII+LVITALLALVAVAIAVSCWLMAYR+RPK+ GPLPHP EFPNPLF++P PP   L EP PDYL
Sbjct:  408 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKE-SPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGY-YSDNEGYCVRCQTELGFVLIGN-QCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGCSPIPTPPPVPADFNRPDLQVNCLADGVLVQINLRD-DNFKGVMYVKGHSNDERCRQSVNAKELESGIVDFKVLFGVCGLFHSDGEANFVLVIQKHPKLVTFKSQAYRIRCVYNTGIQTIDVGFNVSMLTTAGTIANTGPPPTCSMRICNSNGEDIGRAEIGDELMLKVDVQPNAIYGGFARRCVAHTMDDDG-ENEYLVTDDNGCATDPSIFGEWQYERSLGVLTAVFNAFKFPASNNIRFQCNIRVCFGQCQPQNCAGSNAYG-RKKREAGE--EATVYTGQLREEIMVQSNAILTIERRTESR------IDPRTGSRGDEEVCVSKIGFIIALVITALLALVAVAIAVSCWLMAYRRRPKAVGPLPHPAEFPNPLFTTPTPP---LAEPAPDYL 3848          

HSP 2 Score: 451.055 bits (1159), Expect = 1.655e-129
Identity = 298/806 (36.97%), Postives = 399/806 (49.50%), Query Frame = 0
Query: 8467 CGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVP----LCRCPEGFEGDPSIECKP-PTPLSIGCSADSDCPVVEACLNTKCVDPCNCGENALCRKINHKAVCFCPSGFSGNPEVLCEKLECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCNCGGGAKCFLSGHRPICQCPEGFIGNPQIECNPAGCSSDKECRSTEACVEASCVNPCLI-NDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCINAICRSPCACGLNADCKIIDHQPVCTCKPGFYGDPEIECTDTVCQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTC-NIVSCSDNSDCPTDKEC--INKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFIGNKGTSC 9263
            C  +A C  +NH + C C   + GNP V+C P    VV    P C +D +CP    C N +C +PCI   PC   A C V   +P    +C C EG+  D   +CKP   P   GC+ D DCP   AC+N +C+DPC+CG  A C   +H+ VC CP G+ GNP++ CE + C SD DC +  MC +  C NPC++ +PC    EC P++H + CRC     GDP+  C  + C  + +C   +AC    CI+PC+ +NPCA NA C   +H  +C C     GNP V+CV   P+P     ECV D DCPS+ ACL+  C+  C +L PC+  A+C+V+D+ P RTM+CTC +G++  ED SC  +  P   GC  DDEC  +++C+N++C++PC CG  A C +  H+P+C C +G+ GNP + C    C  D +C  T AC    C   C   N PCG  A C    H A C C  G EGDPY  C  I C+SD +CP+ KAC N  CI PC   NPC   + CV  DH   C C  G++G    SC       C  D +C +  ACIN++C +PC V  PC   A C V+++LPV+ M C C  GY       C  +P                         P   GL     I+D    C C PG+Y D E  C    CQ+             E   V   +   C              C CP  +   P   C  I+ C  + DC   K C   N  C D C +  PCG  +      H+  C C  G++GN  T C
Sbjct: 1554 CAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPI-PAP-----ECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTL-PPILSGCSTDDECGESDSCINKICKDPCACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRA-EIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVP-----------------------TCPPGRGL-----ILDENEQCVCPPGYYSDNEGYCVR--CQT-------------ELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPC-VKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3815          

HSP 3 Score: 398.282 bits (1022), Expect = 4.519e-112
Identity = 281/802 (35.04%), Postives = 402/802 (50.12%), Query Frame = 0
Query: 3507 NKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQ----HKALCTCPDGFIGSPTNDCKK---PIVPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFEN-CGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPC----ECARNADCDARNHRGICTCILDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPC-IVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCYRYECKTNEDCPFDKACASEKCIDPCQT-TLCGSKAICNVEYHQSSCKCPAGLQGNPYINCK--ELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEA--------------TNHQ------------------------EKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVC--YEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCN 4252
            N C  +  C    H ++C+C  G+ GN  V+C    +P  P   P C +D DCP  TAC N +C NPC    PC  TA C VV        +C+C +G++      CK    P  P C  D +CP+  ACI ++C +PC    CG  AQC V++HR +C C  GYVG+P  +CE  GC+SD +C ++  CI+ +C NPCL ++ CG  AEC P +H+A+C C+ G++GDP+  C+   C  D ECP +  C ++ C++PC     CA+NA+C    H+  C C + +TG+P  +AC       I   EC ED+DCPS++AC++  C   C    PC   A C V D+LP+RTM CTC +G+    D  C  + PI+ +GC ++ EC  S +C N  C  PC     CG+ A C V NH+  CTC  G+ G+P+ +   + EC  D DC D  AC N +C+  C   N PCG  A C    H+  C CPPGL GDP+ TC+  EC++++DCP DKAC +  CI PC     C   + C V  H+ +C+CP G +G+   +C+  E+ CR   +C     C     +C   C+ ++ C   A C+               T +Q                        E+C CP  Y  D   +C           C+ +      F  I ++C   C +    +P Q+             C+CP DM +G  G C  +    EC +++DC     C     +C + C+   CG NA  +   H   CKC EGY GNP +GC+
Sbjct: 1551 NPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPR-VAC-----VPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPIL-SGCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPVCTCEDGYEGNPD-VACIKIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTAC--INQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCV---------RCQTELG----FVLIGNQCI--CDSARGLVPSQD----------GTRCVCPPDMELGPDGYCIPI---LECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGCS 3821          

HSP 4 Score: 387.497 bits (994), Expect = 1.381e-108
Identity = 293/791 (37.04%), Postives = 394/791 (49.81%), Query Frame = 0
Query:  359 CLNSCRV-HPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQP----VCTCPNGYIGSPTTDCRPQP---EPECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEK-CGENAECSPRNHRATCKCNKGHKGNPYSYCNAYECLSDPECPDHLHCISEKCVDPC----KCAANAECDARNHRGYCACIIDFTGDPYGXXXXXXXXXXXXXXXXXXDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSNGQL-CGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPCK-NTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVE--CKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASN----HREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDD------CPGLLACMSE----KCQDPCTF----NKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECEIANDCKISDIC--VSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHEC 1112
            C+N C   +PC P+A C   +H + C C  G+ GNP  SC   +       +P C ++ DCP  ++C N  C NPC    PC + A C V+N  P    +C+C  G++    T C+P     EP C  D DC +  ACI +QCL PC    CG  AQC V++HR +C C  GYVG+P   CE  GC++D +C D   CI+ +C NPCL +  CG  AEC P +H+A C+C  G++G+P+  C    C  D ECP +  C S+ C++PC     CA NAEC    H+  C C + +TG+P       +    I   ECVEDKDC S+ AC+   C   C   +PC + A C V D+LP+RTM C C +GY    D  C  + PI+  GC +D EC  + +C N+ C +PC     CG  A C V NHK  C CE G+ G+    CI+I   EC+ DDDC    AC + +C   C  G   CG  A CTA +H+A C CPPG   D    C+  EC  + DCP DKAC +  CI+PC     C   +EC V  H+  C+CP G +GS    C+  E  C+   +C  Q  C  I+ +C   CS  + C  +A C+  +        CVC     G+    C    VP+  P   +  D      CP      +E    +CQ    F    N+   DS    V     T+   C+CP D  +G DG C  +    ECE+ +DC     C   + +C D C   PCG NA   +  H   C C  GY GNP   C
Sbjct: 1554 CVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPR------VACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILS-GCSTDDECGESDSCINKICKDPC----ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKI---ECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTAC--INQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIEC--TPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTR---CVCPPDMELGPDGYCIPIL---ECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3845          

HSP 5 Score: 369.007 bits (946), Expect = 1.335e-102
Identity = 275/797 (34.50%), Postives = 382/797 (47.93%), Query Frame = 0
Query: 4928 CVDACSLSN-CGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVIN----HKSVCTCPDGYIGSPETSCRP---PIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLF-DECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPCA----CAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQ-YNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTKDDCPFDKTCLAKNCVDPCK-NTICGVRASCNAEHHQGICTCISGLQGNPYIMCK--EVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVN----HKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACI---NERCE-NPCFLNNPCSSSQECRIAELSQITIQTQ-----------------------------------AECTTNNDCRXTDVC--LSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCT 5662
            CV+ C   N C  +A C+   H++ C C  G  GNP ++C      V P   P C    DCP  T+C N  C +PCI  +PC   A C V+N       +C+C +G++   +T C+P   P +P C  D +CP+  ACI ++C +PC    CG  A C V++HR VC C  GYVG+P   C+  GC+SD +C +   C + +C +PCL  D CG+ A+C+  +H++MC C  G++GDP+  C+   C  D +C  +  C +  C++PC     CAK AEC    HK  C C V +TG+P  +AC PIP P     EC+ DKDCPSK  C D  CK  C    PC   A C V D+LP+RTM C C  GY    D  C  + PI + GC ++ ECG++ +C    C +PC     CG +A C V NH+P C+C  GY G+P   C +    EC  DDDC  +  C   +C   C   N PCG  A C++  H+  C CP GL GDP+  C+  EC +  DCP DK C   +C+ PC     C   + C    H+  C C  G +G+    C+  E+ CR + +C     C +N  +CI  CS ++ C  NA C+ ++        C C T   G+               EC     CP  +  I   NE+C   P + ++       C+  EL  + I  Q                                    EC  ++DC     C   + TC D C  +PCG  A      H   C C  GY GNP + C+
Sbjct: 1551 CVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPR-VACVPIPAP-----ECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILS-GCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKI---ECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTAC-INQ-QCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNA------------AIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQ-TELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGCS 3845          

HSP 6 Score: 368.237 bits (944), Expect = 2.304e-102
Identity = 280/804 (34.83%), Postives = 395/804 (49.13%), Query Frame = 0
Query: 3569 QCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDC---KKPIVP----ECLSDPECPDHLACIQQKCQNPCSSIT-CGKNAQCRVQN----HRAICSCFGGYVGDPYTACE------EPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPC----ECARNADCDARNHRGICTCILDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRN----HRATCTCPVGFTGDPNS----LHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCYRYECKTNEDCPFDKACASEKCIDPCQ--TTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVE----GTSECI-VNEDCTSTDVCY---EGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPG--------CSYNDDC--PSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNC 4322
            +C+NPC  + PCAP+A C V  H A C CP G++G+P   C   + P+VP    EC +D +CPD  AC+ ++C+NPC +++ C   A C V N       ICSC  G+V D  T C+      EPGC  D +CPN  ACINR+C +PC   +CG  A+C  E+HR VC C  G+ G+P   C+P  C SD +C +   C +  CV+PC     C R A+C   +H+ +C CI  + GDP+ IACE I         C +D +CP   AC +++C NPCL   PC +NAEC V +  P    TC C  G+TG     CV   PI    C  + +C    AC ++ C   C   NPC + A C+V +        CTCP G+    +S    L      C+ D +C ++ +CIN  CK+PC     CG +A C    H+PVC C  G  G+P   C + EC+ ++DC    AC +EKC   C      CG +A C    H+++C CP GL+G+PY+ C  +ECR  +DC  ++ C      C   C   N C   + C  T+H+  C CP  + G   + C        E  CR D +C S  ACI  +C DPC   +PC    +C+VL++ P++T+ C+C +     ++ +C  V     G    +  NE C      Y   EG C+            +   +L   QC C       P       +   +  L P         C  +DDC  P Y +  N  C DPC++  PC   A      H  +C C +G+VG+P T C
Sbjct: 1554 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPC---DCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPF-IACEVIG--------CRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKP----TCRCPVGYTGNPRVACV---PIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKAC--FNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCR-----RAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRC--------QTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVK-WPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3848          

HSP 7 Score: 366.696 bits (940), Expect = 7.501e-102
Identity = 277/806 (34.37%), Postives = 386/806 (47.89%), Query Frame = 0
Query: 6405 KCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDC---QLPI----QPECTRDYECPDNKACIQQQCLNPCTSIA-CGRNAECRVTK----HRALCSCRSGYIGD------PYTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPC----KCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQN----HKSVCKCSLGYIGDPYSTC--VPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNFECLSNDDCPFDKKCISEKCISPCL--ETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAI------KGLV--ECQTXXXXXXXXXXXXGTCVDACRKNS---------CGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDC--PSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQ 7161
            +C+NPC  + PCA +A C V +H + C CP G++G+P   C   + P+    +PEC  D +CPD+ AC+ ++C NPC +++ C   A C V         +CSCR G++ D      P  + NEPGC  D +CP   AC+NR+C +PC    CG  A C  ++HR +C C  G+ G+P   C+P  C  D+DC     C +  CV+PC     C R A+C   +H+  C C   + GDP+ I+C+ I         C +D +CP N+AC   +CINPCL   PCA  A C V +  P    TC C  GYTG   V CV   PI    C  D  C    AC+   C   C   +PC D + C   +       +C C  GY+    S+C  +P     C  DDEC  + +C+N  C+DPC     CG +A C   NH+ +C C  G+ G+P  +C   EC  +DDC     C +EKC   C      CG +A CT   H + C CP GL+G+PYV C  +EC  D DC +++ C      C   C  +N C + + C  T H   C CP  F G   + C       +  GC+ D +CPS  ACI++QC +PC + +PC    KC V DTLP RT+ C C      NA  +C  +      +GL+  E +     P     ++G CV    +           C S    + S   ++C C       P   C  P+ +        C+ D DC  P Y    N  C +PC +   C  NA      H  +C C  GY+G+P T C 
Sbjct: 1551 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPC---DCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPF-IACEVI--------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKP----TCRCPVGYTGNPRVACV---PIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPC----ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNN--HCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRR-----AEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYC-IPILE--------CELDDDCLDPKYCELANNTCGDPCVKWP-CGPNAYGTATGHRCICKCIEGYVGNPLTGCS 3848          

HSP 8 Score: 355.91 bits (912), Expect = 2.217e-98
Identity = 277/802 (34.54%), Postives = 390/802 (48.63%), Query Frame = 0
Query:  936 KCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKRE---VPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQT--SPECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVC-----RPHPECPDRLKCENEKCVDPC----ECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCIXXXXXXXXXXXXAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADNKCSNPCR-SNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNNCIDPCQ-NTVCGRNAECSVEYHKSICKCPSGLQGSPYVACK--EVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEA----SRHRERCICSSPYTGDGYSFCQKIVV--PASKSECNVDEDC---PSKLS-----CIS-QTCQNPCSLNNPCSTSQECKVADTL-PSR-TVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRG--TCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICN 1700
            +C   C   N CA SA C   NH  KC+CPP  +G+   SC  +E   VP  +PEC  D DCP   AC++E+C++PC    PC  +  C V ++ P +T+ C C    V   D +C  V+    P C   +DC     C++  C+D C    CG  A C    H   C CP GY GNP   C       EP+   GC++D+DC    +C +  C+NPC    PC   A C   +H  +C C  GY G P   C     R   ECP    C ++ C++PC     CA+NA+C    H+  C C   +TG+P  +AC PIP P      C ED+DCPS++AC++  C   C    PC   A C V D+LP+RTM CTC +G+    D  C  + P++  GC ++ EC  + +C N  C    ++   C   A CR  NH+P C C  G+ G+P   C    + EC+ D+DC     C + KC   C   N+ CG  A C  ++H   C C     GDP+ +CF  EC+ ++DCP DK+C +N+CI PC     C   +EC V  H+  C+CP G +GS   +C+  E+ CR D +C     C  Q+  C   CS ++ C  NA+C+           C+C + Y G+    C  +    P      + +E C   P   S     C+  QT      + N C     C  A  L PS+    C+CPP+  +   G C  +    EC+ ++DC D   C+    TC + C   PCG NA  TA  H  +C C +G+ GNP + C+
Sbjct: 1551 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISC-------EPV---GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPR-VACVPIPAPE-----CVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILS-GCSTDDECGESDSCINKIC----KDPCACGDHAFCRVINHKPVCTCEDGYEGNPDVACI---KIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQ--CIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCI----CDSARGLVPSQDGTRCVCPPDMELGPDGYCIPI---LECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGCS 3848          

HSP 9 Score: 353.599 bits (906), Expect = 1.319e-97
Identity = 293/864 (33.91%), Postives = 385/864 (44.56%), Query Frame = 0
Query: 2907 RCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELST------ECQVNNDCQQFEICVDGTCRKTC-SINSCGANAVCTPV----IHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLACINRKCQNPCSTLT-CGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTN----HRSFCKCPPNHAGDPHASCYKYE-----CRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNN-CAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGI-CQEVETKVECEYNDDCSTNDICQDGSCIDACRV-NKCGANTRC----ISSFHRSECVCLQGYTGNAQVACY-LPITPNEPSLV----------PGCTSDQDCPSY-TACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLAC--IQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINR-ECQNPCLFENCGINAECSPENHRAVCACLKGHKGD 3727
            RC NPC+   PC  +  C VQN++      C CP G   +    C   E         EC  + DC     C++  C   C +++ C   A+CT V         C+C +G+  D ++ C      VE   EPGC+ DDDCP+   C NRQC++PC  GS     A C   +H+ VC C  G+VG P   C P+    C  D +C D   CI+  C NPC     CG  A+C    H+A+C C+ GY G P   CE      +GCR ++EC    AC++ +CINPC+  NPC  +A+C V  H+  C CP GY G+P   C PI   EC  D DC S  AC+++ C   C    PC   A C   +        C CP  +     +SC         C   D+C    +C+N+ C DPC    CG  A C+   HK  C C +G +GNP + C ++ECR D DC     C  +N +C  +C   N  C G A C A +H+  C CPP  EGD Y  C         +EC+ D+DC   KAC  + C  PC   NPC E  EC     V    V+C CP G F GS G  C+  E  + C  + +C +   C +  CID C V + CG N +C            CVC+ GY GNA + C  +P  P    L+          PG  SD +   Y   C+             C         Q    C CP      P   C  PI+ EC  D +C D   C      C +PC    CG NA      HR IC C  GYVG+P T     GC      P   A  NR + Q  CL +   +      +N + V   +KGH  D
Sbjct: 1404 RCVNPCLYENPCAPSATCSVQNHN----AKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKP----VELPNEPGCARDDDCPNGAACINRQCLDPCDCGS----GAQCFVEDHRPVCVCPPGYVGNPQISCEPVG---CQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEV-----IGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPC---ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTC-------FAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSEC----VVTDHEVNCECPPG-FEGSKGTSCRRAE--IGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNE--GYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYC-IPIL-ECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLT-----GCSPIPTPPPVPADFNRPDLQVNCLADGVLVQINLRDDNFKGVMY-VKGHSND 3848          

HSP 10 Score: 346.28 bits (887), Expect = 2.900e-95
Identity = 271/805 (33.66%), Postives = 366/805 (45.47%), Query Frame = 0
Query: 4346 KCQNPCSTIT-CGRNAICQARNHRAICSCIKSFSGDPYTFCE----------EPGCKSDFECRDNQACINRECQNPCL-FEKCGLNAECNANG----HRAICSCLQGHKGDPYSFCKPYE------CLSDPECPNHLKCKNEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPV----CKCPQGQAGNPHAYCYKYE-----CKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCL-GKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSN-CGVNAECATT----LHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDC---PSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSV--------CTCPDGYIGSPETSCRPPIKPECRYDTECPDHLAC--IQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFC 5100
            +C NPC     C  +A C  +NH A C C   + G+P   C           EP C +D +C D+ AC+N  C+NPC+    C + A C           ICSC +G   D  + CKP E      C  D +CPN   C N +C+DPC+C   A C   +HR +C C P + G+P  I+CEP+         C  D DC  ++ CI+ +C NPCL+  PC + AEC            C CI G+ G     C  I      G R  +EC  N A R ++C+NPC+ ENPC   A+C V+ H+  C C +G+ G+P  +CVP    EC  D DC     C+++ C   CK  + C   AIC   +  PV    C CP G      + C         C T+ +C     C ++ C DPC    CG  A CR   H+ +C C  G +GNP V C  ++CR D DC D   C  +N KC P+C  G   C  +A C A +HK TC C   L GD Y  CF         EC++D DC    AC +  C +PC + +PC    EC   D      V C CP G       +C+R E    C  D +C S + C    C+D CS+++ CG NA+C       +   +C C +G+ GN  I C  P+PT  P        ++ C   P Y S     C+    E      G  C   + + +        C CP      P+  C P +  EC  D +C D   C      C +PC    CG NA      HR +C C+ GYVG+P   C
Sbjct: 1554 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQ-ISCEPVG--------CQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACEVI------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPC---ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCF-------AIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCRRAEI--GCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIEC-TPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPIL--ECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3848          

HSP 11 Score: 345.125 bits (884), Expect = 6.699e-95
Identity = 277/804 (34.45%), Postives = 371/804 (46.14%), Query Frame = 0
Query:  429 CINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQ-------PEPECRLDSDCSDHLACIGQQCLTPC-SRNTCGVNAQCRVKN----HRAICSCLSGYVGD------PYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPYSYCNAYECLSDPECPDHLHCISEKCVDPC----KCAANAECDARNHRGYCACIIDFTGDPYGXXXXXXXXXXXXXXXXXXDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKN----HKMYCNCEVGFTGDAYSKCIQIS--QGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPCK--NTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECE-IANDCKISDICVSG----------SCIDACKVNPCGVNAICKSA-----SHD-SRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDC--PTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVC 1183
            C+NPC  + PC+  ATC V NH   C CP G++G+P   C P+       PEPEC  D DC D  AC+ ++C  PC + + C V A C V N       ICSC  G+V D      P  +  EPGC  D +CP+   CINR+C +PC    CG  A+C   +HR  C C  G+ GNP   C    C SD +C D   CI   CV+PC     C   AEC   +H+  C CI  + GDP+            E + C +D +C   +AC S++C NPC   +PC +NA C V +  P    TC C  GYTG     CV   PI    C  D++C    AC +  C   C T   C   A C+V +      M C C  G+     S C  +      C  DD+C  + +CI+  C DPC+    CG++A C   NH+ +C C  G+  +    C + EC  + DC    AC +EKC   C   N  CG  A C+   HK  C CP GL+G PY+ C  +EC+  +DC   + C   +  C   C+ +N C   + C  ++H   C CPP   G   +SC + E+      C  D +CP   AC++++C DPC+   PC  + +C+V DT P +T+ C+C T         C  V T P    +  D     +C  G           C         G   IC SA     S D +RC CP      P   C        P+L   C  DDDC  P Y    N  C +PC +  PC P A      H  +C C  GY+G+P T C
Sbjct: 1554 CVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPC---DCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPF---------IACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKP----TCRCPVGYTGNPRVACV---PIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKAC--FNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEI-----GCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCI-------PILE--CELDDDCLDPKYCELANNTCGDPCVK-WPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3845          

HSP 12 Score: 338.191 bits (866), Expect = 1.174e-92
Identity = 276/807 (34.20%), Postives = 356/807 (44.11%), Query Frame = 0
Query: 2395 KCQNPCSRLT-CGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSG----------CESDFECPNHQACINRECQNPCL-FEKCGXXXECKXEN----HRAICHCLSGHKGQAYVNCKRYE------CLRDSDCPNHLHCVNDKCVDPCECARNADCKARNHRGYCTCIPNFTGDPYGXXXXXXXXXXXXXXXXNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRN----HRSVCKCPRGFSGDPHSYCYKYE-----CKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNL-CANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTCRKTCSI-NSCGANAVC----TPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDC---PSYTTCRNRQCI------NPCSIGSPC----AKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLAC--INRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVC 3149
            +C NPC     C  +A C V NH A C C  G+ G+P   C              C +D +CP+  AC+N  C+NPC+    C     C   N       IC C  G        CK  E      C RD DCPN   C+N +C+DPC+C   A C   +HR  C C P + G+P         +   E V C  D DC  ++ CI+ +C NPCL+  PC   AEC            C CI G+ G     C  I      GCR D+EC     CR  DCINPC+ +NPC  +A+C V  HK  C CPVGY G+P   C  I   EC  D DC    AC+++ C   C     C   AIC   +       +C CP G+     S C         C TD++C    +C  + C DPC    CG  A C    H+  C C  G +GNP V+C ++ECR D+DC     C  R  KC  +C   N  C   A C AI+H+  C CP    GD Y  C  I       ECR DKDCPSD AC +  C +PC +  PC +   C V +++    V+CECP G   S G  C+  E+   C+ + +C     C++  C   CS+ + CG NA C    T  +    C C  GY G+    C  PV    P        ++ C   P Y +     C+          IG+ C    A+  +  P      C C       P   C PI   EC LD +C D   C   N  C +PC    CG NA      HR IC C+ GY+G+P T C
Sbjct: 1554 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNP---------QISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACEVI------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAI-------ECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHE----VNCECPPGFEGSKGTSCRRAEIG--CRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIEC-TPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLV--PSQDGTRCVCPPDMELGPDGYCIPIL--ECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3848          

HSP 13 Score: 335.495 bits (859), Expect = 7.569e-92
Identity = 271/830 (32.65%), Postives = 373/830 (44.94%), Query Frame = 0
Query: 4667 QCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCY----------KYECKTNQDCPLDKVCTSEKCVDPC-DTTQCGLKALCRT----EYHQSICECPQGLQGNPYVECKSVQ------CRKDQDCRDNEKC-NLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSN-CGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVIN----HKSVCTCPDGYIGSPETSCR--PPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDE--CGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPCA----CAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIE---PITTIGCKSNSEC-------GDN----LACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETC--IQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTKDDCPFDKTCLAKNCV 5445
            +C++PC  ++ C   A C  +NH   C CP G  GNP   C           + EC T+ DCP D  C +E+C +PC   + C + A+C       +   IC C +G   +   +CK V+      C +D DC +   C N Q       CL   +C S A C   +H+  C C     G+    C           CQ+D DCR    CI   C NPC + DPC    EC            C C  G        C+ +     C +D +C  +  C    C++ C   N C  NAEC  + H   C C  G+TGNPR+AC +P+P       P C   +DCPS  +C +  C   C    PC   A C VI+       +CTCPDGY+ + ++SCR  PPI   C  D EC +  +CI + C++PC    CG +A CRV NH+ VC+C  GY G+P   C +  C+ D +C ++ AC N+ C+  C      CG  A C A +H++ C C  G +GDPY  C   +C  D DC     C N  C+ PCA    C + +EC   +H+  C C   F G   G +C       + E  C +D +CPS+  C +Q+C +PC    PC +NA+C+V DTLP+RTM CVC+ GY G    +C  +    P   +    N +C        DN    + C+          Q  C S            C C P     P   C      EC  DDDC   + C      C DPC    PCG NA  ++  HR +CKC  G  G+P + C            F++  L  NC+
Sbjct: 1485 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQ-------CLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQISC-------EPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACEVIG----CRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVAC-VPIPA------PECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGS-KGTSC------RRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYC--IPILECELDDDCLDPKYCELANNTCGDPC-VKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGCSPIPTPPPVPADFNRPDLQVNCL 3848          

HSP 14 Score: 335.109 bits (858), Expect = 1.046e-91
Identity = 267/825 (32.36%), Postives = 370/825 (44.85%), Query Frame = 0
Query:  678 ECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCV-KIEPII---DVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKN----HKMYCNCEVGFTGDAYSKCIQI---SQGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPCK-NTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQ-TSPECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAE-DSPCAPTANCQVINHNPVCTCPNGYIGSPTTVC-----RPHPECPDRLKCENEKCVDPCE----CARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIE---PVVDVGCRSNSEC--DRNLACDN-GKCIXXXXXXXXXXXXAIC---RTQNHQPT-----CECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVC--ADNKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNNCI 1463
             C NPC   +PC  +A C V +        C+C  G+ G     C  K  P++   +  C +D +C  + AC N++C NPC   + C  +A C+V N      M C+C  G+  D  +KC  +   ++  C  DDDCP   ACI+ QC DPC     CG+ A C  ++HR +C CPPG+  + Q +C    C  ++DC     C+   C+NPC     CG  AEC    HK +C+C  G +G P+I C+ + C++  +C   + C   S  C   C   N CA +A C  S H+  C CP    G+   +C    VP   PEC  D DCP   AC+   C+  C    PC+D   C V D+ P +T+ C CP   V   D  C  +      C   ++C  SD C++  C D C    CG +A C+  +H   C+C +GY GNP   C  +           CR DDDC     C+N  C   C   ++PC   A C  I+H   C CP G  G P   C     R   +CP    C N  C+ PC     C   ++C   +H   C C P F G   G +C            C  D +CPSQ ACIN++C +PC +  PC +NA+C+V DTLP+RTM C CI G+ G     C  +    P   +    N +C        DN G C+              C     +   P+     C C P     P   C P  E  C+ D+DC     C  A+N C +PC     CG NA      H  +CKC+E + G+P + C            F++     NC+
Sbjct: 1485 RCVNPCLYENPCAPSATCSVQN----HNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD----CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACR--SKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVAC----VPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIE----------CRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGS-KGTSCRRAEIG------CRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILE--CELDDDCLDPKYCELANNTCGDPCVKWP-CGPNAYGTATGHRCICKCIEGYVGNPLTGCSPIPTPPPVPADFNRPDLQVNCL 3848          

HSP 15 Score: 333.183 bits (853), Expect = 4.455e-91
Identity = 269/805 (33.42%), Postives = 357/805 (44.35%), Query Frame = 0
Query: 6469 QCLNPCT-SIACGRNAECRVTKHRALCSCRSGYIGDPYTICN----------EPGCKSDFECPQQQACLNRECQNPC-HFEKCGVNAMCSPKN----HRGICSCIEGHKGDPYSFCKPYE------CLIDSDCPTNLQCNNEKCVDPCKCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKN----HRAICMCPKGFAGDPHTSCYNFE-----CLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENS-CTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTXXXXXXXXXXXXGTCVDACR-KNSCGSYSTC----LTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDC---PSYNSCRNRLCINPCAEDDICVINANCKVINHEPV--------CSCPNGYIGSPTTECQLSPKPECIVDQDCPLTKACIIGK--CESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVC 7223
            +C+NPC     C  +A C V  H A C C  G++G+P   C           EP C +D +CP   ACLN  C+NPC     C V A+C+  N       ICSC EG   D  + CKP E      C  D DCP    C N +C+DPC C   A C +++HR  C C   + G+P  ISC+P+         C  D DC     CID +C+NPCL  +PC   A C            C CI GY G   + C  I      GC+ D +C  N AC   +C+NPC+ ++PC   + C    HK  C+C +GY G+P   CVP+   EC  D +C S  AC+++ C+  C   N C   AIC   +       IC CP G+     +SC         C ++D+C     CI++ C  PC    CG+ A C V  H  VC C  G +GNP V C ++EC  D DCL+   C  R  KC  +C   N+ C   A C A  H   C CP    GD    C  I        C+ D+DCPS  AC +  C +PC + NPC    +CVV D      ++C+C      +    C   +  + C++D +CP    C +  C+D C   + CG  + C            C C+ GY G+    C  PVP   P        ++ C   P Y S     C+    E    +I   C   +   +        C CP      P   C   P  EC +D DC   K C +    C  PC    CG NA   A  HR  C C+ GYVG+P T C
Sbjct: 1554 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQ-ISCEPV--------GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACEVI------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAI-------ECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCR--RAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECT-PVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYC--IPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3848          

HSP 16 Score: 322.398 bits (825), Expect = 1.011e-87
Identity = 278/817 (34.03%), Postives = 373/817 (45.65%), Query Frame = 0
Query:   98 QCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCY----------EFECKINNDCPFEKACVEEKCVDPCKS-TKCGTNAKCSV----EYHNAICKCPQGLQGSPYLSCKEVE------CRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYP-TRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVGGTCLNSCRV-HPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPV----CTCPNGYIGSPTTDCRPQPE--PECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPC--LFEKCGENAECSPRNHRATCKCNKGHKGNPYSYCNAYECLSDPECPDHLHCISEKCVDPCK----CAANAECDARNHRGYCACIIDFTGDPYGXXXXXXXXXXXXXXXXXXDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINP-----------CTTRTTCGF----------SARCSVKNH---KMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKAC--ISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNC 853
            +C++PC    PC   A C  Q+H   CMCP G  G+P   C           E EC  + DCP + AC+ E+C +PC + + C   A C+V     +   IC C +G        CK VE      C  +DDCP+ A C   N +C + C     C   A C    HR  CVCPP   G+    C           C  D+DC  +  CI   C NPC+V  PC    EC     YP +    C C           C  I     C  + +C     C    C+N C   +PC  NA+C+ S H+ TC C  GYTGNP+ +C  I         P C  ++DCP+  +C +  C   C    PC+  A C VI+  PV    CTCP+GY+ +  + CR  P     C  D +C +  +CI + C  PC+   CG +A CRV NH+ +C+C  GY G+P   C +  CR D +C DT  C N +C+  C      CG  A C+  +H+ATC C  G +G+PY  C A EC SD +CP    C +  C+ PC     C   +EC   +H   C C       P G E +        E+ C  D +C SQ ACI+++C +PC+V  PC  NA C+V DTLP+RTM C+CI GY G     C  +       C   R     +  EN++C+ P              +T  GF          SAR  V +    +  C  ++    D Y  CI I   EC+ DDDC   K C   +N C DPC     CG NA  TA  HR +CKC  G+  +  + C
Sbjct: 1554 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAAC--INRQCLDPCD----CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPV-------GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAEC-----YPASHKAMCRCIPGYEGDPFIACEVI----GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPA-------PECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCEC-------PPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVP-----TCPPGRGL---ILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGY--CIPIL--ECELDDDCLDPKYCELANNTCGDPCVKWP-CGPNAYGTATGHRCICKCIEGYVGNPLTGC 3848          

HSP 17 Score: 320.472 bits (820), Expect = 3.476e-87
Identity = 258/799 (32.29%), Postives = 369/799 (46.18%), Query Frame = 0
Query: 2984 NSCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPIN----HKAVCTCLDGFVGTPSTDCRPI---NVPECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKY---ECRISDDCPFDKTCLNEKCVDPCDTTR-CGSKAICKA----EYHKGSCECPNGLQGNPYIFCKEVECRKD----TDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYIN-PCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGSCIDACRV-NKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQ----HKALCTCPDGFIGSPTNDCKKPIVPEC-------LSDPE---CPDHLACIQQ----KCQNPCSSITCGKNAQCRVQNHRAICSCFGGY--VGDPYTACEEPG-------CKSDFECPNKQAC--INRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFC 3732
            N C  +A C+   H  KC C  G+ G+P  +C      V P  EP C  D DCP  T C N +C NPC   SPC  +AIC  +N       +C+C +G+V    T C+P+   N P C  D +CP+  ACINR+C +PC    CG  AQC V+ HR +C C  GY+G+P   CE      VGC+S+++C     C +G+C+NPC+  +PCG  A+C    H+A C C  GY GDP+  C   + + C+ D +C  N+AC +  CI+PC    PC  NAECL + H+  C+CP  + G+P  +C      EC    DCP    CL+  C   C T   C   AIC            C CP+G     Y+  ++  CR      + C+++++C   +    ++C D   C   A C   NH+  C C   +EG+    C        K+EC++D DC  T AC    C+  C   N PC     C A +       +C CP G        C      +EC  + DC ++  C +  CI  C + N C   + C+ + H   C C  G+ G+   +C             GC SD +CPS TAC N+QCI+PC+   PC   A C+V+        +C C  G+ G+   +C    VP C       L + E   CP       +    +CQ     +  G   QC   + R +     G   V  P       G       C+ D +C + + C   N  C +PC+   CG NA  +   HR +C C++G+ G+P + C
Sbjct: 1554 NPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEP-----VGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIAC---EVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDG-----YVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCACGDHAFCRVINHKPVCTCEDGYEGNPDVACI-------KIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAIS----HKATCACPPGLEGDPYVTC----FAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEI--------GCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTP--VPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGN--QCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3821          

HSP 18 Score: 318.931 bits (816), Expect = 1.057e-86
Identity = 272/799 (34.04%), Postives = 356/799 (44.56%), Query Frame = 0
Query: 3753 KCVDPC----ECARNADCDARNHRGICTCILDFTGDPYGIACXXXXXXXXX--XXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCYRYECKTNEDCPFDKACASEKCIDPC-QTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKEL---ECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATN----HQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVCYEGSCINACLIKK--CGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTIT-CGRNAICQARN----HRAICSCIKSFSGDPYTFCE-----EPG------------CKSDFECRDNQACINRECQNPCLFEKCGLNAECNA--------NGHRAICSCLQGHKGDPYSFCKP-YECLSDPEC--PNHLKCKNEKCVDPC---ECARNADCDARNHRGICTCIPDFTGDPY 4499
            +CV+PC     CA +A C  +NH   C C   + G+P  ++C P   PV+   E EC  D DCP   AC+NE C+NPC+   PC   A C V ++LP RTM C+C EG+    D +C  +E     GC  + +C    AC N  C+ PC     CG+ AQC V +HR  C CP G+ G+P  +      C  D DC D   CI+  C NPC+V  PCG  A C    H+ +C+C PG  GDP   C    C+ + +CP +KAC S+ CI+PC     C   A C V  H+ +C+CP G  GNP + C  +   EC + +DC     C  +T  C PLC   N C   A C   +        C CP  Y+    S C     P I   C  D +C    +CI   C DPC   +       C+V+N  P+    C C           C ++    EC V++DC  T  C    C   C      CG  A C+ I H A C C  G  G+P   C      +E      C  + DCPS   C N  CI PC    PC   + C V  HE  C CP GF GS  T+CR   +  C  D +C    ACI Q+C +PCS    CGRNA CQ  +       +C CI  + G+    C       PG            C   +   +   C+   CQ    F   G    C++        +G R  C C    +  P  +C P  EC  D +C  P + +  N  C DPC    C  NA   A  HR IC CI  + G+P 
Sbjct: 1563 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPL-VSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPC----DCGSGAQCFVEDHRPVCVCPPGYVGNPQ-ISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDST--CKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCR--TLPPILSGCSTDDECGESDSCINKICKDPCACGDHAF----CRVINHKPV----CTCEDGYEGNPDVACIKI----ECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTC----FAIE------CRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCR-RAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCV--RCQTELGFVLIGNQCICDSARGLVPSQDGTR--CVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPL 3848          

HSP 19 Score: 318.546 bits (815), Expect = 1.381e-86
Identity = 264/804 (32.84%), Postives = 355/804 (44.15%), Query Frame = 0
Query: 5061 KCQNPCTSVT-CGLNAVCRVQNHRAVCSCLGGYVGDPYKFCD----------EPGCKSDFECPNSQACYNKNCQDPCL-FDECGQNAKCFANN---HRSM-CVCNEGHKGDPYTFCKPYD------CLVDNDCLDHLRCTNTKCVDPCACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPV----CKCPNGLAGDPHSYCYKYE-----CVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNI-CAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIA------------ELSQITIQTQAE--CTTNNDCRXTDVCLSGTCIDACKVF-PCGAYADC-VPNFHEAR---CACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDC---PRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSE-TSCQLPQKPECTKDSECANHLAC--------------IQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVC 5795
            +C NPC     C  +A C VQNH A C C  G+VG+P   C           EP C +D +CP+  AC N+ C++PC+    C   A C   N    R+M C C EG   D  T CKP +      C  D+DC +   C N +C+DPC C   A+C   +H+  C C   + G+P  I+C+P+         C +D DC  +++C D +C NPC    PC + AEC            C C+ GY G     C        IGC+ ++EC  N AC    C+NPC  + PC   A+C V  H+P C C  GYTG+P   C      EC  D DC +   C+   C   C+   PC   A+C+     PV    C CP+G      S C         C T D+C    +C+ K C DPC    CG  A C   +H+ +CTC  G +GNP + C ++ECR ++DC     C   + KC  +C   N  C   A C +++HK  C CP  + GD Y  C          EC+ D DCP  +AC N  C +PC + NPC    EC +             E S+ T   +AE  C ++ +C     C++  CID C V  PCG  A C V +    R   C C TGY GN   +CT V    P    I    +  C   P Y +     C+        C +     +I ++  C    G + S + T C  P   E   D  C   L C                  C DPC    CG NA      HR IC C+E Y+G+P + C
Sbjct: 1554 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQ-ISCEPV--------GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIAC------EVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTC-------FAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLI-LDENEQCVCPPGYYSDNEGYCVR-------CQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3848          

HSP 20 Score: 317.39 bits (812), Expect = 3.750e-86
Identity = 273/800 (34.12%), Postives = 371/800 (46.38%), Query Frame = 0
Query: 1081 NPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNP----VCTCPNGYIGSPTTVCRP-----------HPECPDRLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCIXXXXXXXXXXXXAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPV----CKCLENFAGDPHSSC-----FKYECQKNEDCPFDKSCSSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYVACKEVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNV-CAANARCEASRHRERCICSSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINACK-SRPCGVNAKC----TARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDC---PSHAACKDRKCINXXXXXXXXXXXXRCKVINHEPECTCPDGFIGSPTTD-----CRP---RDPYSFCRP-YECLSDPECPDHLKCE--NEKCVDPC---ECARNADCDARNHRGICTCIPDFTGDPY 1833
            NPC  +A C   +H+++C CP G+ GNP   C        P   P C  D DCP  + C N  C NPC   SPC  TA C V+N  P    +C+C  G++    T C+P             +CP+   C N +C+DPC+C   A C   +HR +C C P + G+P  I+CEP+         C  D DC  ++ CI+ +C NPCL+  PC + AEC            C CI G+ G     C  I      GCR ++EC  N AC +  CINPC   NPC+ +A C    H+PTC C  G+TG+P   C P    EC  D+DCPS   C D+ C   C++ + C + A+C V++  PV    C C + +     SSC         C  +++C    SC +  C DPC    CG +A C V  HK +C C  G +G+P VAC +++CR D+DC     C  ++  C  +C   N  C   A C A  H+  C C     GD Y  C  I       EC  D+DCPS  +C +  C +PC++ NPC    EC V D      V C CPP    +   +C+R E    C+S+ +CP    C    CI+ C  + PCG NAKC    T    + VC C  G++GN    C   P    P +    D N+ C   P + +  +  C+    E           +I ++  C    G +  P+ D     C P     P  +C P  EC  D +C D   CE  N  C DPC    C  NA   A  HR IC CI  + G+P 
Sbjct: 1563 NPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQ-ISCEPVG--------CQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACEVI------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPC---ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEK--CRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAI-------ECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCRRAEIG--CRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVP-TCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFV-------LIGNQCICDSARGLV--PSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPL 3821          

HSP 21 Score: 317.005 bits (811), Expect = 4.897e-86
Identity = 268/813 (32.96%), Postives = 362/813 (44.53%), Query Frame = 0
Query: 6136 KCVNPCD-TTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCK----------EIECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITN----HKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDVVK-CGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPCTSI-ACGRNAECRVTK----HRALCSCRSGYIGDPYTICNE-----PGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPCK-----CARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQN----HKSVCKCSLGYIGD------PYSTCVPVNEKECQFDDEC-------SSNQA-CVNNQCEDPCNNANICGYNAICETKNHRA------ICMCPKGFAGDPHTSCYN-FECLSNDDCPFDKKC--ISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVC 6890
            +CVNPC     C  +A C  + H + C CP G  G+P V+C           E EC +D DC     C   N  C   C     C V A C + N        C C   +  D  + C K  E   +P C  D DCP   +CI+ +C DPC     C  G +C V +  P+    C CP   + +    CE +     C+ D DC   DMC DG+CVN C V   CG  +EC  + H+A C+C  GY GDP   C +I          GC  D +CP + ACR+  CINPC  + PCA  A+C V  H+  C CP GY G+P+  C     PEC  D +CP   AC+   C   C ++  C   A C V         +C+C  GY+    + C        GC +D EC +  +C+N+ C++PC    CG +A C   NH+ +C+C +G++G+P   C   EC +D DC     C NEKC   C      C   A C   +H+  C C     GDPY ++C  I        EC  DKDCPS++AC +  CI+PC    PC + + C V D      + C C  G+ G     C + +     GC+SD +C    AC+   C++PC    PCG  + CQ  +       VC C  GY G+      P  TC P        +++C       S N+  CV  Q E       + G   IC++            C+CP      P   C    EC  +DDC   K C   +  C  PC++  CG  A  T   H  +CKC  G  GNP   C
Sbjct: 1554 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTAC--LNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKC-KPVELPNEPGCARDDDCPNGAACINRQCLDPCD----CGSGAQCFVEDHRPV----CVCPPGYVGNPQISCEPVG----CQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVI----------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPC---ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPY-VTCFAI--------ECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCRRAE----IGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTE---LGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3848          

HSP 22 Score: 313.923 bits (803), Expect = 3.627e-85
Identity = 272/818 (33.25%), Postives = 359/818 (43.89%), Query Frame = 0
Query: 4728 KCVDPCDTTQ-CGLKALCRTEYHQSICECPQGLQGNPYVECK----------SVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARN----HKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSN-CGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVT-CGLNAVCRVQN----HRAVCSCLGGYVGDPYKFCDE-----PGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPCA-----CAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPE----CSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCI---QYQCTDPCQYNKP----------------CGKNALCSSEKHR------PVCKCPNGLAGDPHSYCYK-YECVTKDDCPFDKTC-LAKN-CVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIMC 5482
            +CV+PC     C   A C  + H + C CP G  GNP V C             +C  D DC D+  C   N +C   C+  + C   A+C   N        C C      D  + C +   L  +  C  D DC    ACI++ C +PC     C    +C   D  P     CVCP G       +C+ V     C+ D DC    +C +G CV+ C + + CG  AEC    H ++C C  G+ G+P IAC +           GC    +CP   +CR++ CI+PC+ + PCA  A C V  HK  C CP GY G+P  +C P   PEC  D +CP   AC+   C+  C ++  C   A+C V +       +C+C  GYV      C        GC +D EC  S +C NK C+DPC    CG +A C   NH+ +C C +G++G+P   C   +C VD+DCLD   C N KC   C      C   A C A +HKA C+C     GDPY + C  I        EC +DKDCPS + C++  C +PC    PC + +EC V D      + C C  G+ G     C + E    IGC+S++EC    AC   +C++PC+   PCG  AKC V +  P     C C  GY G+        +  ECT    C      I     QC  P  Y                    G   +C S +          C CP  +   P  YC    EC   DDC   K C LA N C DPC    CG  A   A  H+ IC CI G  GNP   C
Sbjct: 1554 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTAC--LNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKC-KPVELPNEPGCARDDDCPNGAACINRQCLDPCD----CGSGAQCFVEDHRP----VCVCPPGYVGNPQISCEPVG----CQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVI----------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPC---ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPY-VTCFAI--------ECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCRRAE----IGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGN--------AAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3848          

HSP 23 Score: 313.153 bits (801), Expect = 6.559e-85
Identity = 280/859 (32.60%), Postives = 384/859 (44.70%), Query Frame = 0
Query: 8321 KCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLC----SLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLXXXXXXXXXXXXXCREGFYVGKNGDC--IEVDGQPECRSHSDCRYNEQCQSGSCLDACRIRLCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECKPPTPLSIGCSADSDCPVVEACLNTKCVDPC----NCGENALCRKINHKAVCFCPSGFSGNPEVLCEKL---ECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHV----SKCRCPSDMNGDPYSLC-----VDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPCY-SLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCN----CGGGAKCFLSGHRPICQCPEGFIGNPQIECNPA--GCSSDKECRSTEACVEASCVNPCLINDPCGVHAKC----APNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSC--INAICRSPCA---CGLNADCKIIDHQPVCTCKPGFYGDPEIECT 9141
            +C   C +ENPCA  A+C  QNH  KC+C P  +GN  V C    S  V   EPEC  D DCP   AC+N +C+NPC   +PC  +  C VV+S P +++ CSCREG+    +  C  +E+  +P C    DC     C +  CLD C    CG  A C  E+H   C C   + GNP+++C P+          GC+SD++C   + C +  CV+PC+V DPCG+ A C    H  +CRC  G+EGDP I C+      IGC  D++CP+ +AC +  C++PC     C +NA C    HK  C CP G++GNP V C  +   EC  D+DC +   C ++TC   C  LNPC     C   + +      C CP        S C     +   C+ +++C    +C    C DPC     C  +A C+ + H   C C     GNP V+C         ++ EC VD DC    AC N+ C   C     PC   A C+ +         C C  G       +C  IE      C  D +CPS++AC N  C +PC     C   ++C ++ H   C+CP GF G+    C  A  GC SD EC S  AC+   C++PC + DPCG +AKC       +    C C  G++G+     + I C     CP  +                       +  D   QC C  GY  D    C         E G    G  CI   CD+    L P  +   C     + +       PDGY            PI+  CE +DDC +   C   N  C  PC    CG NA      H+ +C C  G+ G+P   C+
Sbjct: 1551 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPV----------GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACE-----VIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPVCTCEDGYEGNPDVAC---------IKIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAIS----HKATCACPPGLEGDPYVTCFAIE------CRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGN-----AAIECTPVPTCPPGRG----------------------LILDENEQCVCPPGYYSDNEGYCVRCQ----TELGFVLIGNQCI---CDS-ARGLVPSQDGTRCVCPPDMELG------PDGYCI----------PILE-CELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGCS 3848          

HSP 24 Score: 312.768 bits (800), Expect = 9.732e-85
Identity = 251/806 (31.14%), Postives = 370/806 (45.91%), Query Frame = 0
Query: 6199 CVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEES---KKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTE--CKVDTDCARSDMCKDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPCT-SIACGRNAECRVTKHRALCSCRSGYIGDPYTICN---EPGCKSDFECPQQQACLNRECQNPCH-FEKCGVNAMCSPKN----HRGICSCIEGHKGDPYSFCKPYE-----CLIDSDCPTNLQCNNEKCVDPCKCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCL-TYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKN----HRAICMCPKGFAGDPHTSCYNFECLSNDDCPFDKKCI---SEKCISP----------CL-------------ETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEV-ECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFC 6953
            CV  C     CA +A C + NH   C C P + G+    CT KE       +P+C  DGDCP   +C+++RC++PC    PC V   C+V NSLP R++ C C    +   +  C+ +++  E  C  D DC     C +  C++ CD   CG  ++C    H+  C C  GY G+P   C  +          GC  D+DC     C +  C+NPC + +PC   A+C    H+++C C  GY G P   C++     C +D ECP NKAC  + C+NPC     C +NAEC V++H+  C C  GY G+P   C     P C  D +CP + ACL+  C+  C     C   A+C+  +       IC+C +G+     S C+        C  D +C  +  C N+ C DPC C  +A C + NH+  CTC+  + G+P  ++C        ++ EC  D DC    AC + +C   C     PC  +ATC           TC+C  G  G   V C  I+      C+SD  C  + AC   +C++PC   +PC + S C   +H+  C+C  G+ G   ++C    E  C+ D EC S  AC+N QC DPC+ A+ CG NA C+  +       +C+C  G+ G+        EC     CP  +  I   +E+C+ P          C+             + IC +          + C CP  ++  P   C  + EC  D DCL+ + C L    C   C +   C  +A   AT H  IC C   ++G+  + C
Sbjct: 1554 CVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPV----------GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVI---GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCACGDHAFCRVINHKPVCTCEDGYEGNP-DVAC--------IKIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAIS----HKATCACPPGLEGDPYVTCFAIE------CRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRA-EIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAA-----IECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKW-PCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3845          

HSP 25 Score: 311.997 bits (798), Expect = 1.507e-84
Identity = 269/814 (33.05%), Postives = 364/814 (44.72%), Query Frame = 0
Query: 2001 QCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSF----------ECKKNEDCPFDKECKSESCVDPCID-TQCGTLATCTV----EYHKGICKCSSGYQGNPYLSCREVQ------CRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESY-LLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVER-CGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPV----CTCPDGFIGSPSTNCQ--PPERPECRVDAECPLDRACIHQKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPC--LFEKCGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPCE----CARNADCKARNHRGYCTCIPNFTGDPYGXXXXXXXXXXXXXXXXNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEP---------------IIETGCRSDSE-----CDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKAL-CSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQAC--IENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYC 2756
            +CV+ C+   PC   A C    H + C CP G  G+P VSC             EC  + DCP D  C +E C +PCI  + C   A CTV     +   IC C  G+  +    C+ V+      C R+ DC +   C  +       C    +C   A C  E+HR  C CP   +G+    C  PV       C  D+D    + CI   C NPC+V+ PC      R  E Y       C C+ G +      C  +     C  D +C  +  C    C+N C  E  C  NAEC+ + H+  C C  GY G+P+ AC        P+ +P C  D+DCPS   C +  C   C   +PC   AIC VI   PV    CTCPDG++ +  ++C+  PP    C  D EC    +CI++ C++PC+   CG +A C+V NH+ +CTC  GY G+P   C    C  D +C +  AC N +C+  C      CG    C   +H+A C C  G +G  YV C   EC  D DCP+   C N+ C+ PC     C   ++C   +H   C C P F G                E+ C  D +CPSQ ACIN++C +PC +  PC  NA+C+V DTLP+RTM C CI G+ G     C  +                 +   G  SD+E     C  +LG       N CI D     SA+  V S     C CP      P  +C  IL  EC  D+DC   + C    N C +PC +   CG  A      HR +CKC  G+ G+P + C
Sbjct: 1554 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQ------CLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQISC-EPVG------CQSDNDCRDRDMCIDGDCVNPCLVQDPCG-----RFAECYPASHKAMCRCIPGYEGDPFIACEVIG----CRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACV-------PIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEG-------SKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIG--NQCICD-----SARGLVPSQDGTRCVCPPDMELGPDGYCIPIL--ECELDDDCLDPKYCELANNTCGDPC-VKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3848          

HSP 26 Score: 310.842 bits (795), Expect = 3.803e-84
Identity = 264/807 (32.71%), Postives = 367/807 (45.48%), Query Frame = 0
Query: 7184 KCESPC-SANICGINALCRANNHRATCVCVSGYVGDPYTVCE----------XPGCKSNLECLTTQACINKDCLDPCL-FEQCGQNAQCNPRN----HRAMCKCKEGHKGDPYTFCRPYE------CLVDRDCPDQLKCDHEKCVDPCQCAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRP----ICKCPPGTIGDPHNFCHSYE-----CLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLXXXXXXXXXXXXXXXRKTYTCYKVCN-SNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLVFR-CGDNAVCKSFD----HSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDC---PSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQ-TSCELPSEP------------ECLVDDDC--PSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQIC 7935
            +C +PC   N C  +A C   NH A C+C  G+VG+P   C            P C ++ +C    AC+N+ C +PC+    C   A C   N       +C C+EG   D  T C+P E      C  D DCP+   C + +C+DPC C   A C  ++HR  C C   Y G+P  I+CEP+       GC+SD DC  +  CID +C NPCL   PC   A+C            C C  GY G     CE      V+GC  D EC  + AC + +C+NPC+ E+PC   A+C V  HK  C CP+G+ G+P   CVP+   EC  D +C    +C+++ C  +C   NPC+  A+C + +  P    IC CP G +    + C +       C ++ +C    SC NKIC +PC+   CG +A C V  H+ VC C  GY+G+P ++C  ++C  D+DC D   C  +   C  VC   N  C   A CTA  H   C C   L GD Y  C         EC+ D DC ++ AC N+ C +PC I  PC+   +C+V +      V C CP G    K   C++   +  C   ++C S   C    CI  C V   CG NA C+  D     +  C C+  + G+    C   P T  P        +  C   P Y + +   C+       C       +I ++ +C  + G + S   T C  P +             EC +DDDC  P      + +C  PC    CG NA      HR IC CI GY G+P   C
Sbjct: 1554 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQ-ISCEPV-------GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACE------VIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTC------FAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCRRA--EIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVP-TCPPGRGLILDENEQCVCPPGYYSDNEGYCVR------CQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3848          

HSP 27 Score: 309.686 bits (792), Expect = 8.956e-84
Identity = 222/637 (34.85%), Postives = 312/637 (48.98%), Query Frame = 0
Query:    1 MACTCIEGYEEPIIASGCQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRN----HRTTCVCTIGFTGDAYSNCSPI---NEDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCKSTK-CGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIES-KTECENNNDCGDQDVCVGGTCLNSCRVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAE-DKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPCS-RNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCE--EPGCRNDFECPDTQTCINRECQNPC-LFEKCGENAECSPRN----HRATCKCNKGHKGNPYSYCNAYECLSDPECPDHLHCI---SEKCVDP 616
            ++CT  E    P     C +D +C  + AC N  C NPC   +PC V A C+V N        C C  G+  D  + C P+   NE  C  D DCP   AC+  QC+DPC+    CG+ A C  + H+PVC+CP G  G+P   C    C+ +NDC     C++  CV+PC     CG  A+C    H A+C+C  G +G P+++C+ + CR + +CP N  C   +  C   C+    CA +A C   +H+ TC CP   TG+    C    V I  PEC  D DCP K+AC+   C+  C    PC+    C V+DS P RT+ C CP    ++ +  C  +    + C  +++CG+ D C+   C + C    CG +A C   +H+  C+C  GY GNP  +C +I+          C  + DC    +CRN  C   C   + PC   ATC  I+H+  C CP G  G P   C      ECR D DC    AC    C++PC+ +N C   ++C V +H   C C  G+ G   + C   E GCR+D ECP    CIN++C +PC + + CG NA+C   +        C C  G++GN      A EC   P CP     I   +E+CV P
Sbjct: 1917 VSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD----CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKD--CINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVAC----VPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIE----------CRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAI---ECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGN-----AAIECTPVPTCPPGRGLILDENEQCVCP 3734          

HSP 28 Score: 306.605 bits (784), Expect = 7.412e-83
Identity = 278/878 (31.66%), Postives = 389/878 (44.31%), Query Frame = 0
Query: 1661 CINAC-KSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINXXXXXXXXXXXXRCKVINHEPE----CTCPDGFIGSPTTDCRPRDPYSFCRPYE--CLSDPECPDHLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKISNSECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIR----HRSVCKCPKGLAGDPHVSCYSFE-----CKKNEDCPFDKECKSESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNN-CAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYV-ERCGINAEC----IANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPGCDVDRDC---PSY--------TMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNCQPPERPECRVDAECPLDRAC--IHQKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINR-ECQNPCLFEKCGXXXECKXENHRAICHCLSGHKG----QAYVNCKRYE 2498
            C+N C    PC  +A C+ + H++ C C  G+ GNP   C      V P  EP C ++ DCP   AC + +C NPC   SPC  +A C V+N  P     C+C +G++    T C+P +      P E  C  D +CP+   C N +C+DPC+C   A C   +HR +C C P + G+P  I+CEP+         C+ D DC  ++ CI+ +C NPCL+  PC + AEC            C CI G+ G     C  I      GCR ++EC    ACR+ +C+NPC+  +PC+  A+C V  H   C C +GYTG+P   CV I   EC  D DC S  AC++  C   C    PC   A C  I        +C CP G       SC +       C  +++C     C ++ C DPC    CG  A C V  HK +C C  GY+GNP ++C +++CR + DC     C  +  KC P+C   N  C   A C A +H+  C+CP  L GD Y  C          EC  D D    +AC ++ C +PC +++PC     C V +      V+CEC  G +      C   +++  C  D +C     C    C++ C V + CG NA+C            C C  GY G+    C   PT   P      D +  C   P Y          C+  L          C         Q    C CP      P   C P    EC +D +C   + C   +  C +PC +  CG NA      HR IC C++GY G+P     L+GC      P   A  NR + Q  CL +        + +N + + + + GH      +  VN K  E
Sbjct: 1365 CVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVE-----LPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQ-ISCEPVG--------CQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACEVI------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPC---ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCF-------AIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSC--RRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPT-CPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPIL--ECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNP-----LTGCSPIPTPPPVPADFNRPDLQVNCLADGVLVQINLRDDNFKGVMY-VKGHSNDERCRQSVNAKELE 3845          

HSP 29 Score: 303.908 bits (777), Expect = 4.538e-82
Identity = 225/644 (34.94%), Postives = 311/644 (48.29%), Query Frame = 0
Query:   35 CVNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGDAYSNCSPIN-------EDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKP----VCMCPEGLAGDPHAFCYEFE------CKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVGGTCLNSCR-VHPCGPNAQCIASS----HRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPCSRNT--CGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEK-CGENAECSPRNHRATCKCNKGHKGNPYSYCNAYE--CLSDPECPDHLHCISEKCVDPCK----CAANAECDARN----HRGYCACIIDFTGD 643
            CVNPC   NPC   A CSV+NH   C+C  G+ G+   +C+P         E EC  D DCP + AC+  +C +PC    PC   AIC   +  P    +C C EG   D    C   E      C  ++DCP   AC+  +C+DPC    CG+ A+C VE H  +C CP G  G+P +SC+ V C+ ++DC D   C   +  C   C+    C   A C    H+  C C P   GD +  C  +V+      C  D++CP   AC S+ C NPC+   PC+   EC V +  PT    C CP     +    C  I +  EC  + DC  +  C+  TC   C+ ++PC   A C            C+C  GY      SC+ +      P+  GC ++ +C    SC N++C +PCA    C  +A CRVINH+PVCTC +GY G+P   C    + ECR+D DC D  AC  ++C   C      CG  A C   +H+A C+C  G  GDPY  C    CR+D +CP  + C N  C +PC  +  C E +EC   +H   C+C  G +G+  + C   E  C SD ECP    CI+++C+DPC     C  NA+C   +        C CI  + G+
Sbjct: 2001 CVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPC---DCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMC--IDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIAC--EVIG-----CRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPT----CRCPVGYTGNPRVACVPIPAP-ECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTL-----PPILSGCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPVCTCEDGYEGNPDVACI---KIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGN 3845          

HSP 30 Score: 302.753 bits (774), Expect = 1.005e-81
Identity = 264/789 (33.46%), Postives = 358/789 (45.37%), Query Frame = 0
Query: 7906 CGINAKCNVKSHRAICVCIAGYDGDPYQICE----------EPGCKSDIECPFDKACISRECQNPCL-YDECGVNAECIPKS----HRAMCKCKKGHKGNPYVHCKPYE------CLYDPDCPDHLTCKNEKCVDPCQCAKYAECDARNHR-------GIFPEPV---EVEGCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPV----CKCQSGTAGDPHSFCYEYE-----CLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFEN-PCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLXXXXXXXXXXXXXCREGFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDACRIR-LCGINAICVAEN----HESTCACRIRFSGNPEVACLPI------SPLVVE-----ALPPGCRSDSECPTY-NQCQNNKCVDPCIVNDPCGKDAFCKV--NYHVPLCRCPEGFEGDPSIECKPPTPLSIGCSADSDCPVVEAC--LNTKCVDPCN---CGENALCRKINHKAVCFCPSGFSGNPEVLC 8629
            C  +A C+V++H A C+C  G+ G+P   C           EP C +D +CP D AC++  C+NPC+    C V A C   +       +C C++G   +    CKP E      C  D DCP+   C N +C+DPC C   A+C   +HR       G    P    E  GCQ D DC  ++ CID +C NPCL   PC   AEC   +        C C  GY G     CE      V+GC  D +C  + ACR+ +C+NPC  + PCA+ A C V+ HK  C CP G TG+P   CV I   EC +D DC    AC++  C   C    PC   AIC  ID  PV    C C  G      S C         C  D++C  + +C+++ C DPC    CG  A C+   H+ +C CE+G +G+P + C ++ECR + DC     C     KC P+C   N PC   A+C A +HK  C C P L G+ +V C         ECR D DCPS  AC N  C +PC+ +NPC     C+         V+C C  GF   K   C     +  CRS ++C     C +  C+D C +   CG NA C   +        C C   + GN  + C P+        L+++       PPG  SD+E   Y  +CQ    +   ++ + C  D+   +  +     C CP   E  P   C P     + C  D DC   + C   N  C DPC    CG NA      H+ +C C  G+ GNP   C
Sbjct: 1554 CAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACE------VIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCF------AIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECV----VTDHEVNCECPPGFEGSKGTSCRR--AEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNE--GYCVRCQTE--LGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIP----ILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3815          

HSP 31 Score: 297.36 bits (760), Expect = 4.944e-80
Identity = 260/804 (32.34%), Postives = 340/804 (42.29%), Query Frame = 0
Query:  492 QCLTPC-SRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCE----------EPGCRNDFECPDTQTCINRECQNPCL-FEKCGENAECSPRN----HRATCKCNKGH------KGNPYSYCNAYECLSDPECPDHLHCISEKCVDPCKCAANAECDARNHRGYCACIIDFTGDPYGXXXXXXXXXXXXXXXXXXDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIID---VGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQN----HRALCKCPPGFATDSQSNCYEYE-----CLRNSDCPFDKACVSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVECKRHEDCGDQEKCNLISLKCEKLCS-GRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECEIANDCKISDICVSGSCIDACKV-NPCGVNAICKSAS----HDSRCSCPNGYTGNPSHECYFVS--PTSEPLLT---------PGCRNDDDCPTYSL-CKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRPHPEC--------PDRLKCENEKCVDPC---ECARNADCDARNHRGICTCIPDFTGDPY 1232
            +C+ PC   N C  +A C V+NH A C C  G+VG+P   C           EP C  D +CPD   C+N  C+NPC+    C   A C+  N        C C +G       K  P    N   C  D +CP+   CI+ +C+DPC C + A+C   +HR  C C   + G+P         +   E V C  D DC  ++ CI  +C NPC V  PC   A C            C CI GY G         +P I    +GCR D EC  N AC ++ CINPC     C  +A C V  HK  C C VG+TG+    C+ I   EC  D DCP   AC+ + C   C     C + AICT  +       +C CP G+ +   S+C         C  + +C    +C+++ C +PC    CG  A C V  HKP+C C  G +G+P + C  +EC+  +DC D   C   + KC  +C  G   C   A C A +H+  C CPP L GD Y +CF  E  SDK       DCP   AC +  C  PC    PC +  EC V D      V C CP          C R +    C    +C     C++  CID C V +PCG NA C+           C C  GY GN + EC  V   P    L+          PG  +D++   Y + C+  +          C              C CP      P   C P  EC        P   +  N  C DPC    C  NA   A  HR IC CI  + G+P 
Sbjct: 1563 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNP---------QISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEG---------DPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACR--NEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDK-------DCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCRRAEIG--CRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNE--GYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPL 3848          

HSP 32 Score: 295.434 bits (755), Expect = 2.171e-79
Identity = 254/820 (30.98%), Postives = 355/820 (43.29%), Query Frame = 0
Query:  221 KCEELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREK---VVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTE--CENNNDCGDQDVCVGGTCLNSCRVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPC-SRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVC---EEPGCRNDFECPDTQTCINRECQNPC-LFEKCGENAECSPRN----HRATCKCNKGHKGNPYSYCNAYE-----CLSDPECPDHLHCISEKCVDPCKCAANAECDARNHRGYCACIIDFTGDPYGXXXXXXXXXXXXXXXXXXDKDCFSQEACISEECDNPCT-VYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTA-----------------QNHRAL---------------------CKCPPGFATDSQSNCYEYE-----CLRNSDCPFDKACVSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNV-ECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSC 976
            +C   C+    CAPSA C    H   C+CPP   G+    C  K   VV   +PECY D DCP   AC++E+C+NPC+   PC +T  C V++S P RT+ C C +      + +C  +E   E  C  ++DC +   C+   CL+ C    CG  AQC    HR  C C  GY GNPQ SC+ +          GC S+ DC     C +  C+NPC    PC  +A C   +H+ +C C  GY G P   C       CR D++C  + AC  + C+ PC   N C  NA+C V  H+  C C  GY G+P   C     P C  D +CP    C++  C+  C     C + A C+  +        C C  G+     S C         C +D EC +   CI++ C DPC C  +A C   NH+  C C   + G+P         +    ++EC  D DC    AC +E+C   C    +PC   A C           TC C  G  G     C  IE      CRSD++C  + AC N  CI+PC  +  C   + C V +H++ C C  GF G   + C +   G C+ D +CP   ACI+ QC DPCS    CG NA C                   Q + A+                     C CPPG+ +D++  C   +      L  + C     C S + + P ++   GTR           C CP  ++  P   C  + EC+  +DC D + C L +  C   C  +  C  +A   A+ HR  C C    +G+  + C
Sbjct: 1554 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPV----------GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVI---GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCACGDHAFCRVINHKPVCTCEDGYEGNP---------DVACIKIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAIS----HKATCACPPGLEGDPYVTCFAIE------CRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIG-CRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQC----ICDSARGLVPSQD---GTR-----------CVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCV-KWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3848          

HSP 33 Score: 295.049 bits (754), Expect = 2.782e-79
Identity = 252/794 (31.74%), Postives = 335/794 (42.19%), Query Frame = 0
Query: 3362 RCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEK---IPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVE--CEYNDDCSTNDICQDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACY------------------------------------------------LPITPNEPSL---VPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCSSIT-CGKNAQCRVQN----HRAICSCFGGYVGDPYTACEE-----PGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPC-----ECARNADCDARNHRGICTCILDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRN----HRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACI---NNQCK-NPCIVNKPCGSNAICITEIHRPV---------------------CKCPPGLAGDPHSTCY-RYECKTNEDCPFDKAC--ASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINC 4052
            RC+  C   N CA  A C   NH  +C+CPP + G+    C  K   +    + EC  D DC    AC+   C++PC  ++PC     C    S+P RT+ C C +G    ++  C+ VE   E  C  +DDC     C +  C+D C    CG+  +C    HR  CVC  GY GN Q++C                                                 +P    +P +   V GC  D +CP   ACR++ CINPC  + PCA  A C V +HK  C CP G+ G+P   C     PEC+ D +CP   AC+   C+  C ++  C   A C V +       IC+C  GYV    ++C        GC +D EC    +CIN+ C++PC    CG +A C   NH+ VC C  G++G+P   C   EC  D +C +   C NEKC   C      C   A C A +H+  C C     GDPY + C  I         C  D+DCPS  AC N  C +PC +  PC + +EC V D      + C C  GF G     C + E     GCRS+ EC    AC N  CI PC   +PCG  A+C V +        C C  G+ G+         EC     CP  +  I   N QC   P   +   G    C TE+   +                     C CPP +   P   C    EC+ ++DC   K C  A+  C DPC    CG  A      H+  CKC  G  GNP   C
Sbjct: 1554 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPC---DCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPY-VTCFAIE--------CRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCRRAE----IGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGN------AAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3848          

HSP 34 Score: 293.893 bits (751), Expect = 6.955e-79
Identity = 265/863 (30.71%), Postives = 370/863 (42.87%), Query Frame = 0
Query: 5756 KCQDPCASP-ICGINARCRVKRHRAICVCLENYIGDPYSVCK----------EAGCRSDYECPSDKACINRECQDPCL-LEQCGENAECLVNN----HEARCKCLSSFKGDPYVKCRSYE------CLVDSDCPRHLACENEKCVDPCKCAKYADCKVTNHQGYCTCNSYYTGDPYGLAXXXXXXXXXXXXXLDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDXXXXXXXXXXXXKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATN----HRSVCKCRKGLIGNPHSQCYSYE-----CKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIECKSDIDCNTKEKCNLENYICVPLCTDPKL-CAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDVVK-CGYNSECK----QSFHQATCQCTRGYTGDPLKEC----------NLIIPLQEASINPGCSHDDDCPGH-----TACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKAC--IQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNR-ECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGD 6563
            +C +PC     C  +A C V+ H A C+C   ++G+P   C           E  C +D +CP D AC+N  C++PC+ L  C   A C V N        C C   +  D   KC+  E      C  D DCP   AC N +C+DPC C   A C V +H+  C C   Y G+P             V C+ D DC  +  CI+ +C NPCL+  PC   AEC            C C+ GY G     C  +      GC+ +++   N AC  + C +PC  +NPC+  A C V  H   C CPVG TG+P  +C+PI   EC  D DC +  +C+D+ C+  CK   PC   A C   +       +C C  G +    S C +       C T+++C     C+ + C +PC    CG +A C+   H+ +C C  G +G+P V C +IEC+ D DC     C   N  C P+C      C   A C   +HK TC C P   GD Y  C   E       C+ D DCP   +C ++ C  PC +  PC    +C V++      + CECP     S+   C + +I   C+ D +C     C +  C++ C V   CG N++C+           C C  GY G+   EC           LI+   E  + P   + D+  G+     T    +   N C  D    +          + C CP      P   C +PI  EC  D +C D K C      C +PC    CG NA    T HR +C C  GY+G+P T     GC      P   A  NR + Q  C  +   V       N +G+   ++GH  D
Sbjct: 1404 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNP-------QISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECY----PASHKAMCRCIPGYEGDPFIACEVI------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPC---ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIE-------CRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCRRAEIG--CRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDN-EGYCVRCQTELGFVLIGNQCICDSARGLVPS----QDGTRCVCPPDMELGPDGYC-IPIL-ECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLT-----GCSPIPTPPPVPADFNRPDLQVNCLADGVLVQINLRDDNFKGVMY-VKGHSND 3848          

HSP 35 Score: 290.812 bits (743), Expect = 6.141e-78
Identity = 253/800 (31.62%), Postives = 359/800 (44.88%), Query Frame = 0
Query: 1937 ECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQC-------VKISNSECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIR----HRSVCKCPKGLAGDPHVSCYSFE------CKKNEDCPFDKECKSESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNAC-YVERCGINAECIA----NFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNCQPPERPECRVDAECPLDRACIHQKCQNPCS--RLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLFEK-CGXXXECKXENHRAICHCLSGHKGQAYVNCKRYE--CLRDSDCPNHLHCVNDKCVDPCE----CARNADCKARN----HRGYCTCIPNFTGDPYGXXXXXXXXXXXXXXXXNEDRDC--PSQNACINEECDNPCLMYKPCVLNAECKVYDT----LPLRTMT-CTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCR--DGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFC 2692
             C+NPC+  +PC+ +A C V NHNAKC+C  G+ G+P   C       V     EC  D DC  + AC+N++C + C+   PC   A C  +        +C C +G   D    C   E      C +++DCP    C +  C+DPC    CG+ A C VE H+ +C C  GY GNP +SC  V C+ ++DC  ++ C      C   C   + C   A C   +H+  C C     GD +  C       +   C  D++   ++AC S  C NPC+ E+PC  +  C V E       +C C  G        C+ + +  EC  D DC     C + TC   C  +  C   A C            C+C  GY+    ++C   P    P+LS GC  D +C     C N++C +PCA    C   A C+VI HKPVCTC DG+ G+P   C    + ECRVD +C    AC ++KC+  C      CG  A C   +H+A C C  G  GDPY  C    C SD +CP+ +AC N  C +PC  +  C    EC   +H   C C  G +G    +C+R E  C  D++CP+   C+N +C+DPC     C RNA C+  +        C CI  + G+           P    +  +E+  C  P      NE     C      VL     + D+    +P +  T C C        D  C+   PI+E  C  D +C     C   +  C +PC+K  PC  +A  +   H+ +C C  GY G+P + C
Sbjct: 1554 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPC---DCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMC--IDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIAC-------EVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSE----HKPTCRCPVGYTGNPRVACVPIPAP-ECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLP----PILS-GCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPVCTCEDGYEGNPDVACI---KIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCI---PILE--CELDDDCLDPKYCELANNTCGDPCVK-WPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3848          

HSP 36 Score: 286.574 bits (732), Expect = 1.165e-76
Identity = 272/842 (32.30%), Postives = 371/842 (44.06%), Query Frame = 0
Query: 7956 ECQNPCLYDE-CGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYE----------CLYDPDCPDHLTCKNEKCVDPC----QCAKYAECDARN-----------HRGIFPE------PVEVE---GCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEY---ECLRDNDCPLNKACVSQKCTDPCLTTD-CGIKAKCKT----EYHRGICVCEEGLQGSPFIECKEVECRKE----RDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRN-PCLPSETCLXXXXXXXXXXXXXCREGFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDACRIR-LCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPL----CRCPEGFEGDPSIECKP-PT-PLSIGCSADSD----CP-----------------VVEACLNTKCVDPCNCGENALCRKINHKAVCFCPSGFSGNPEVLC-EKLECTSDEDCSNDKMCH--ENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDVECAINEDCNSERACYQDKCIDPCVL 8718
             C NPCLY+  C  +A C  ++H A C C  G  GNP V C P E          C  D DCPD   C NE+C +PC     C   A C   N             G  P+      PVE+    GC  D DCP+  ACI+R+C +PC     C   A+C V +  P+    C C  GY G     CE       VGC +D DC     C + +CVNPC    PC + A C    HK+ C C PG  GDP+  C +I    C QD++C  NKAC   +CI+PC+ + PC +NA C   +H+P C+C  G  G+P   C      EC+ D DCP   AC+   C   C T + C   A C           IC C +G     ++  ++  CR        C T+++C  +      +C     C + A C   NHK  C C+    GN  V C   +K E   CR+DDDC   HAC N KC+  C   N PC    TC    ++ S   +C+C  G        C  +    ECRS  DC  ++ C +  C+  C I+  C   + CV  +HE  C C   F G+   +C             GCRSD+ECP+   C N +C+DPC V DPCG++A C+V   +P+    C C  G++G+ +IEC P PT P   G   D +    CP                 +    +  +C+  C+     +  +   +  C CP      P+  C   LEC  D+DC + K C    NTC +PC+   PC  N     + H   C+C     G+P + C  +        +  R   Q  C+   VL
Sbjct: 1470 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPC----DCGSGAQCFVEDHRPV----CVCPPGYVGNPQISCE------PVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIG---CRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDG-----YVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCACGDHAFCRVINHKPVCTCEDGYEGNPDVAC---IKIE---CRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATC----TAISHKATCACPPGLEGDPYVTCFAI----ECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSC--------RRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCI--CDSARGLVPSQDGTR--CVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKW-PCGPNAYGTATGHRCICKCIEGYVGNPLTGCSPIPTPPPVPADFNRPDLQVNCLADGVL 3848          

HSP 37 Score: 258.455 bits (659), Expect = 8.190e-68
Identity = 226/702 (32.19%), Postives = 315/702 (44.87%), Query Frame = 0
Query:    1 MACTCIEGYE-------EPIIAS---GCQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGDAYSNCSPINEDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPC-KSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEV---ECRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYK----HRETCVCPPPLTGDGYSYCREKVVSILKP---ECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVGGTCLNSCRV--HPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPCS-RNTCGVNAQCRVKN----HRAICSCLSGYVGDPYSVCE-----EPG------------CRNDFECPDTQTCINRECQNPCLFEKCGENAECS------PRNHRATCKCNKGHKGNPYSYC-NAYECLSDPECPDHLHC--ISEKCVDPC---KCAANAECDARNHRGYCACIIDFTGDPY 645
            M C+C EG+        +P+      GC  DD+C +  AC NR C++PC     CG  A+C V +HR  CVC  G+ G+   +C P+    C+ D+DC   + C+   C++PC    PCG  A C   SHK +C C  G  GDP   C    C+ + +CP  KAC  + C++PC     C  NA+C V  H   C+CP G  G+P ++C  +   EC  + DCP    C   +  C+ LC +   C   AIC            C CP     DGY    +     L P    C  D +C +  +CI++ C++PC     C     C+V++  P     C C      + +  C +I    EC  ++DC D   C    C   C     PCG  A C A SH++TC+C  G  G+P  +C  I+          C S++DCP+  +C N  CI+PCA   PC   + C V +H+  C CP G+ GS  T CR + E  CR D++C    ACI QQC+ PCS  + CG NA+C+V +       +C C++GY G+    C       PG            C   +   +   C+   CQ    F   G    C       P      C C    +  P  YC    EC  D +C D  +C   +  C DPC    C  NA   A  HR  C CI  + G+P 
Sbjct: 1563 MICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD----CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVG---CQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHAC--LDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCP-----DGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPV----CTCEDGYEGNPDVACIKI----ECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIE----------CRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCR-RAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCV--RCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPL 3551          

HSP 38 Score: 244.202 bits (622), Expect = 2.538e-63
Identity = 255/816 (31.25%), Postives = 343/816 (42.03%), Query Frame = 0
Query:  813 QCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCY----------EYECLRNSDCPFDKACVSEKCINPC-KNTLCGTRAECSVEYHKP----ICKCPKGLQGSPYIECKNVE------CKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECEIANDCKISDICVSGSCIDACKV-NPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPV----CTCPNGYIGSPTTVCRPHP----------ECPDRLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCL-MYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCIXXXXXXXXXXXXAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPV----CKCLENFAGDPHSSCFKYE---------CQKNEDC---PFDKSCSSNNCIDPCQNT----------VCGRNAECSVEYHKSICKCPSGLQGSPYVACKEV-QCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYTGDGYSFCQ 1564
            +C +PC     C  +A C+ QNH A C CPPG+  +   +C           E EC  + DCP D AC++E+C NPC   + C   A C+V    P    IC C +G       +CK VE      C R +DC +   C  I+ +C   C     C + A C   +HR  CVCPP  +G+   SC       +   C  D+DC     C+   C +PC    PC    EC  +  S      CI       G +G          C    +C ++  C S  CI+ C   NPC  NA C  + H   C CP GYTGNP   C        P+  P C  D DCP+   C ++ C   C   +PC   A C VI+  PV    CTCP+GY+ +  + CR  P          EC +   C N+ C DPC C  +A C   NH+ +CTC   + G+P  +AC  I         C  D DC   +AC NE+C   C     PC   A C           TC C  G  G     C  IE      CRS+ +C  + AC N  CI+PC   NPC   + C   +H+  CEC PGF G   + C    E  C+ D +CPS   C + +C +PC     CG NA C+V++  PV    C C+  + G+    C               +NE C   P   S +   C+  CQ            +C            + C CP  ++  P   C  + +C  D+DC   + C+L   TC   C     C  NA   A+ HR  C C   Y G+  + C 
Sbjct: 1551 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAAC--INRQCLDPCD----CGSGAQCFVEDHRPVCVCPPGYVGNPQISC-------EPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAEC--YPASHKAMCRCI------PGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACV-------PIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCACGDHAFCRVINHKPVCTCEDGYEGNP-DVACIKIE--------CRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAIS----HKATCACPPGLEGDPYVTCFAIE------CRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCR-RAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVR-CQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWP-CGPNAYGTATGHRCICKCIEGYVGNPLTGCS 3848          

HSP 39 Score: 244.202 bits (622), Expect = 2.744e-63
Identity = 244/814 (29.98%), Postives = 337/814 (41.40%), Query Frame = 0
Query: 4406 ECQNPCLFEK-CGLNAECNANGHRAICSCLQGHKGDPYSFCKPYE----------CLSDPECPNHLKCKNEKCVDPC----ECARNADCDARN----HRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKY---ECKTNQDCPLDKVCTSEKCVDPCDTTQ-CGLKALCRT----EYHQSICECPQGLQGNPYVECKSV-----QCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQ-LNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSN-CGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVIN----HKSVCTCPDGYIGSPETSCRP-----PIKPECRYDTE---CPDHLACIQQ----KCQNPCTSVTCGLNAVCRVQNHRA------VCSCLGGYVGDPYKFCDE-PGCKSDFECPNSQAC--YNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFC 5160
             C NPCL+E  C  +A C+   H A C C  G  G+P   C P E          C +D +CP+   C NE+C +PC     C   A C   N       IC+C   +  D      +  P  +  E  C  D DCP+  ACIN +C +PC     C   A+C V D  P+    C C  G+ G     C   EPV   G +  ++C         +CVNPC+ ++PCG +A+C   +H++ C C  G+ GDP+ +C       C  D +C  N+ C +  CI+PC  ++ C K+A C    H+P C+CP G  GNP   C      EC  ++DCP    C    C   C T   C   A+C           IC CP G        C+++      C  D +C +++ C       + +C     C   A C   NHK  C C     G+    C        K EC+ D DC  + AC ++ C+  C   N PC     C  +        TC CP G        C  +E    C  D+DC S   C    C+  C++ N C   +EC  T H+  C C  G  G+   +C             GC +  +CPS T+C N+ CIDPC    PC   A C+V++       VC C  GY G+    C P     P +     + E   CP       +    +CQ     V  G   +C              C C       P  +C     C+ D +C + + C   N  C DPC+   CG NA   A  HR +C C EG+ G+P T C
Sbjct: 1554 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPD---TDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPC----DCGSGAQCFVEDHRPV----CVCPPGYVGNPQISC---EPV---GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIG---CRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSC------INKICKDPCACGDHAFCRVINHKPVCTCEDGYEGNPDVACI-------KIECRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAIS----HKATCACPPGLEGDPYVTCFAIE----CRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCR--------RAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3848          

HSP 40 Score: 243.047 bits (619), Expect = 6.527e-63
Identity = 201/590 (34.07%), Postives = 256/590 (43.39%), Query Frame = 0
Query:    3 CTCIEGYE-EPIIA---SGCQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGDAYSNCSPINEDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPV----CMCPEGLAGDPHAFCYEFE-----CKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCNLNNFKCEELCISSGV-CAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVGGTCLNSCRV-HPCGPNAQC----IASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPG----CDSNQDC---PTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGS---------PTTDCRPQ----PEPECRLDSDCSDHLAC--IGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRN----DFECPDTQT 547
            C CI GYE +P IA    GC+ D EC  N+ACR++ C+NPC   NPC   AEC V  H+ TC C +G+TG+    C PI   EC  D DCP  +AC+   C   C+   PC   AIC      PV    C CP+G      + C         C  +++C    +C+ + C DPC    CG +A C V  H  +C C  G +G+P ++C ++ECR +DDC D   C   N KC  +C      C   A C    H+ TC CPP L GD Y  C          EC  D DCP   AC +  C +PC +  PC    EC V D      V+C CP     S    C R E    C ++ +C  Q  C+   C++ C V  PCG NA+C            C C  GY GN       I+ T      PG     D N+ C   P Y S     C+        C       +I +Q +C    G + S         P  +  P     P  EC LD DC D   C      C  PC +  CG NA      HR IC C+ GYVG+P + C           DF  PD Q 
Sbjct: 1494 CRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPC---ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPVCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTC-------FAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCRRAE--IGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGN-----AAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVR-------CQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGCSPIPTPPPVPADFNRPDLQV 3173          

HSP 41 Score: 236.884 bits (603), Expect = 4.995e-61
Identity = 243/821 (29.60%), Postives = 348/821 (42.39%), Query Frame = 0
Query: 5816 ECQDPCLLEQ-CGENAECLVNNHEARCKCLSSFKGDPYVKCRSYE----------CLVDSDCPRHLACENEKCVDPC----KCAKYADCKVTNHQGY----CTCNSYYTGDPYGLAXXXXXXXXXXXXXLDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDXXXXXXXXXXXXKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSY---ECKTNEDCPFDKHCVGQKC------VNPC-DTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIECKSD----IDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQ-LNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDVVK-CGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVH----HQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACI---QQQCL--------NPCTSIACGRNAECRVTKHRALCSCRSGYIGDP----------YTICNEPGCKSDFECPQQQACL--------NRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFC 6568
             C +PCL E  C  +A C V NH A+C C   + G+P V C   E          C  D DCP   AC NE+C +PC     C   A C V N   +    C+C   +  D     C+P+  P E  C  D DCP   ACI ++C +PC     C + A+C V D  P+         GY G     C  V      GC++++D      CI   C +PC  ++PC   A C   +H A+C C  G  GDP  +C  I    C+ D++C  +++C    C +PC    PC +NAEC+ + H+  C+C  G  GNP   C      EC  ++DCP    C+   C      +NPC D  +C    +        IC CP G     YV+ ++  C++       C+T ++C   +     +C DP  C  +A C + NHK  C C   Y G+    C K E       C++D DC    +C +++C+  C   N PC     C+  +       TC CP          C  I    EC+ D DC     C + +C++ C +   C   SEC  + H+  C+C  G+ G     C      + A I  GC  D +CP  TAC N +CI+PC++ +PC   A C+V+        +C C  GY G+           ECT    CP  +  I    +QC+        N    + C       +  ++ +C    G +               +  +  C    EC     CL        N  C +PC    CG NA  +   HR IC CIEG+ G+P + C
Sbjct: 1554 RCVNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPD-TDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPC----DCGSGAQCFVEDHRPVCVCP----PGYVGNPQISCEPV------GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIG---CRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAIC--TVIDSLPVRTMICTCPDG-----YVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIE-------CRVDDDCLDTHACRNEKCRPVCGPGNAPCGGEATCTAIS----HKATCACPPGLEGDPYVTCFAI----ECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSC------RRAEI--GCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAI--------ECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 3848          
BLAST of EMLSAG00000008211 vs. C. finmarchicus
Match: gi|592923413|gb|GAXK01035002.1| (TSA: Calanus finmarchicus comp111832_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 1238.02 bits (3202), Expect = 0.000e+0
Identity = 642/1162 (55.25%), Postives = 822/1162 (70.74%), Query Frame = 0
Query: 8713 IDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPI--EVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCNCGGGAKCFLSGHRPICQCPEGFIGNPQIECNPAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCINAICRSPCACGLNADCKIIDHQPVCTCKPGFYGDPEIECTDTVCQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNIVSCSDNSDCPTDKECINKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFIGNKGTSCVKVSVTCEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECFPVKTCPANSGLILDNREECVCPTGFGFTENKDECIPCLKENGFILNNEGKCVCNDARGYEYNPDSGKCECPPGERLNNFGICERVPDCEEDPDCPTQKYCEKTNGTCSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGC-IPVIIPPVKTDFPRPEMVVNCLSDGVLVNVDLKDGGNFRGVMYVKGHSKDSNCIKHIDSGGSLKPI-DFQVSFGKCGLFHSQGEANFVLVVQKHPKLETYKAQAYRIKCLYDVGETNINVNFNVSMITTAGTVRNDGPPPNCTMKICNENGEDISSANVGEKLMLKVIVSPREIYGGLARSCIARSLDDSKFEEEYAVTDANGCATDPEIFQEWKLDRNTGYLTALFDAFKFPDSINLKFKCIVRICFGQCQPQNCGGRNAFGRRRKRESSHIIDGKVYTGQLREETDVYSNAIETLESSPQNEPFNSATXXXXXXXXXXXXVCVSKIGFXXXXXXXXXXXXXXXXXXXXCWLMAYRKRPKSSGPLPHPREFPNPLFSSPEPPIHHLDEPDPDYL 9870
            ++PC+ +NPCAP+A C    H + C+C P  +GNP VSC  KE SP+  + E EC  D DCP   ACLN+ CENPC +L+PC  +A+C+VV++ PFRTM+C+CREGW+P  D  C P+E PN PGC +DD+CP+  AC+NR C +PC+CG GA+CF+  HRP+C CP G++GNPQI C P GC SD +CR  + C++  CVNPCL+ DPCG  A+C P  H A C C  G+EGDP+  C +IGC+ D+ECP  KACR++DCI+PCL +NPCA  A C+  +H   CRC VGY G+P  +C  IP PECVED DC +  AC++  C   C+ L PC + AIC VI+SLPV+ M C CPDGYV  E   C+TLPPI+SGC  +D+C  S SCIN IC+ PCACG +A C++I+H+PVCTC+ G+ G+P++ C    C+ D++C +THACRN +C  +CG  N PCGGEA C  ++H+ATC CP GL G+P+VTC  + C  + DCP+DK C N  C   C+I NPC   SEC V +H+V+C C  GF G+KGTSC +  + C  D +CPS+ +CI ++C++PC   +PCG NA C V DT+PVRTM C CI GY+G+A+IEC PV TCP   GLILD  E+CVCP G+ +++N+  C+ C  E GF+L    +C+C+ ARG   + D  +C CPP   L   G C  + +CE D DC   KYCE  N TC +PC + PCGPNA+G    H C C+CI+GY G+P  GC      PPV  DF RP++ VNCL+DGVLV ++L+D  NF+GVMYVKGHS D  C + +++      I DF+V FG CGLFHS GEANFVLV+QKHPKL T+K+QAYRI+C+Y+ G   I+V FNVSM+TTAGT+ N GPPP C+M+ICN NGEDI  A +G++LMLKV V P  IYGG AR C+A ++DD   E EY VTD NGCATDP IF EW+ +R+ G LTA+F+AFKFP S N++F+C +R+CFGQCQPQNC G NA+G R+KRE+    +  VYTGQLREE  V SNAI T+E   ++       +     S GDEEVCVSKIGFII+LVITALLALVAVAIAVSCWLMAYR+RPK+ GPLPHP EFPNPLF++P PP   L EP PDYL
Sbjct:    2 VNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKE-SPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGY-YSDNEGYCVRCQTELGFVLIGN-QCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGCSPIPTPPPVPADFNRPDLQVNCLADGVLVQINLRD-DNFKGVMYVKGHSNDERCRQSVNAKELESGIVDFKVLFGVCGLFHSDGEANFVLVIQKHPKLVTFKSQAYRIRCVYNTGIQTIDVGFNVSMLTTAGTIANTGPPPTCSMRICNSNGEDIGRAEIGDELMLKVDVQPNAIYGGFARRCVAHTMDDDG-ENEYLVTDDNGCATDPSIFGEWQYERSLGVLTAVFNAFKFPASNNIRFQCNIRVCFGQCQPQNCAGSNAYG-RKKREAGE--EATVYTGQLREEIMVQSNAILTIERRTESR------IDPRTGSRGDEEVCVSKIGFIIALVITALLALVAVAIAVSCWLMAYRRRPKAVGPLPHPAEFPNPLFTTPTPP---LAEPAPDYL 3436          

HSP 2 Score: 450.669 bits (1158), Expect = 2.244e-129
Identity = 298/806 (36.97%), Postives = 399/806 (49.50%), Query Frame = 0
Query: 8467 CGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVP----LCRCPEGFEGDPSIECKP-PTPLSIGCSADSDCPVVEACLNTKCVDPCNCGENALCRKINHKAVCFCPSGFSGNPEVLCEKLECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCNCGGGAKCFLSGHRPICQCPEGFIGNPQIECNPAGCSSDKECRSTEACVEASCVNPCLI-NDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCINAICRSPCACGLNADCKIIDHQPVCTCKPGFYGDPEIECTDTVCQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTC-NIVSCSDNSDCPTDKEC--INKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFIGNKGTSC 9263
            C  +A C  +NH + C C   + GNP V+C P    VV    P C +D +CP    C N +C +PCI   PC   A C V   +P    +C C EG+  D   +CKP   P   GC+ D DCP   AC+N +C+DPC+CG  A C   +H+ VC CP G+ GNP++ CE + C SD DC +  MC +  C NPC++ +PC    EC P++H + CRC     GDP+  C  + C  + +C   +AC    CI+PC+ +NPCA NA C   +H  +C C     GNP V+CV   P+P     ECV D DCPS+ ACL+  C+  C +L PC+  A+C+V+D+ P RTM+CTC +G++  ED SC  +  P   GC  DDEC  +++C+N++C++PC CG  A C +  H+P+C C +G+ GNP + C    C  D +C  T AC    C   C   N PCG  A C    H A C C  G EGDPY  C  I C+SD +CP+ KAC N  CI PC   NPC   + CV  DH   C C  G++G    SC       C  D +C +  ACIN++C +PC V  PC   A C V+++LPV+ M C C  GY       C  +P                         P   GL     I+D    C C PG+Y D E  C    CQ+             E   V   +   C              C CP  +   P   C  I+ C  + DC   K C   N  C D C +  PCG  +      H+  C C  G++GN  T C
Sbjct:   29 CAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPI-PAP-----ECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTL-PPILSGCSTDDECGESDSCINKICKDPCACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRA-EIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVP-----------------------TCPPGRGL-----ILDENEQCVCPPGYYSDNEGYCVR--CQT-------------ELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPC-VKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 2290          

HSP 3 Score: 397.897 bits (1021), Expect = 5.640e-112
Identity = 281/802 (35.04%), Postives = 402/802 (50.12%), Query Frame = 0
Query: 3507 NKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQ----HKALCTCPDGFIGSPTNDCKK---PIVPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFEN-CGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPC----ECARNADCDARNHRGICTCILDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPC-IVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCYRYECKTNEDCPFDKACASEKCIDPCQT-TLCGSKAICNVEYHQSSCKCPAGLQGNPYINCK--ELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEA--------------TNHQ------------------------EKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVC--YEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCN 4252
            N C  +  C    H ++C+C  G+ GN  V+C    +P  P   P C +D DCP  TAC N +C NPC    PC  TA C VV        +C+C +G++      CK    P  P C  D +CP+  ACI ++C +PC    CG  AQC V++HR +C C  GYVG+P  +CE  GC+SD +C ++  CI+ +C NPCL ++ CG  AEC P +H+A+C C+ G++GDP+  C+   C  D ECP +  C ++ C++PC     CA+NA+C    H+  C C + +TG+P  +AC       I   EC ED+DCPS++AC++  C   C    PC   A C V D+LP+RTM CTC +G+    D  C  + PI+ +GC ++ EC  S +C N  C  PC     CG+ A C V NH+  CTC  G+ G+P+ +   + EC  D DC D  AC N +C+  C   N PCG  A C    H+  C CPPGL GDP+ TC+  EC++++DCP DKAC +  CI PC     C   + C V  H+ +C+CP G +G+   +C+  E+ CR   +C     C     +C   C+ ++ C   A C+               T +Q                        E+C CP  Y  D   +C           C+ +      F  I ++C   C +    +P Q+             C+CP DM +G  G C  +    EC +++DC     C     +C + C+   CG NA  +   H   CKC EGY GNP +GC+
Sbjct:   23 NPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPR-VAC-----VPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPIL-SGCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPVCTCEDGYEGNPD-VACIKIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTAC--INQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCV---------RCQTELG----FVLIGNQCI--CDSARGLVPSQD----------GTRCVCPPDMELGPDGYCIPI---LECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGCS 2293          

HSP 4 Score: 386.341 bits (991), Expect = 3.849e-108
Identity = 290/783 (37.04%), Postives = 390/783 (49.81%), Query Frame = 0
Query:  366 HPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQP----VCTCPNGYIGSPTTDCRPQP---EPECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEK-CGENAECSPRNHRATCKCNKGHKGNPYSYCNAYECLSDPECPDHLHCISEKCVDPC----KCAANAECDARNHRGYCACIIDFTGDPYGXXXXXXXXXXXXXXXXXXDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSNGQL-CGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPCK-NTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVE--CKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASN----HREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDD------CPGLLACMSE----KCQDPCTF----NKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECEIANDCKISDIC--VSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHEC 1112
            +PC P+A C   +H + C C  G+ GNP  SC   +       +P C ++ DCP  ++C N  C NPC    PC + A C V+N  P    +C+C  G++    T C+P     EP C  D DC +  ACI +QCL PC    CG  AQC V++HR +C C  GYVG+P   CE  GC++D +C D   CI+ +C NPCL +  CG  AEC P +H+A C+C  G++G+P+  C    C  D ECP +  C S+ C++PC     CA NAEC    H+  C C + +TG+P       +    I   ECVEDKDC S+ AC+   C   C   +PC + A C V D+LP+RTM C C +GY    D  C  + PI+  GC +D EC  + +C N+ C +PC     CG  A C V NHK  C CE G+ G+    CI+I   EC+ DDDC    AC + +C   C  G   CG  A CTA +H+A C CPPG   D    C+  EC  + DCP DKAC +  CI+PC     C   +EC V  H+  C+CP G +GS    C+  E  C+   +C  Q  C  I+ +C   CS  + C  +A C+  +        CVC     G+    C    VP+  P   +  D      CP      +E    +CQ    F    N+   DS    V     T+   C+CP D  +G DG C  +    ECE+ +DC     C   + +C D C   PCG NA   +  H   C C  GY GNP   C
Sbjct:   23 NPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPR------VACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILS-GCSTDDECGESDSCINKICKDPC----ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKI---ECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTAC--INQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIEC--TPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTR---CVCPPDMELGPDGYCIPIL---ECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 2290          

HSP 5 Score: 369.392 bits (947), Expect = 1.056e-102
Identity = 274/797 (34.38%), Postives = 384/797 (48.18%), Query Frame = 0
Query: 4999 IDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRP---PI----KPECRYDTECPDHLACIQQKCQNPCTSVT-CGLNAVCRVQN----HRAVCSCLGGYVGD------PYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPCA----CAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPE----CSCSPGYTGDPYALCQETS--TKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTKDDCPFDKTCLAKNCVDPC--KNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQITIQ-----TQAECTTNNDCRXTDVCLSGTCIDACK----VFPCGAYAD----CVPNFHEA-------RCACFTGYTGNPRSQCTRVVILVPQEVEIG----------CSGDSDC--PRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQ 5733
            ++PC+ + PCA  ATC V NH + C CP G++G+P  SC P   P+    +PEC  D +CPD  AC+ ++C+NPC +++ C + A+C V N       +CSC  G+V D      P +  +EPGC  D +CPN  AC N+ C DPC   +CG  A+CF  +HR +CVC  G+ G+P   C+P  C  DNDC D   C +  CV+PC     C ++AEC   +HKA C C+  + GDP+ IAC+ I         C  D +CP  + C  ++C NPC +  PC +NAEC V +  P    TC C  GYTG     CV   PI    C  + +C    AC    C   C T  PC   A C V +  P     C+C  GY     + C+        C++DD+C  S++CI   C DPC     CG +A C    H+PVC C +G  G+P   C K EC   DDC     C  + C   C   N  CG  A+C A  H+  C C  GL+G+PY+ C  +ECR + DC  D+ C  N   CI  C+  N C   + C   +H+  C CP    G   + C +         C+ D++CP + ACIN++C +PC + +PC  + +C++ +   +        T  +     +C     C  G  +   +    V P G Y+D    CV    E        +C C +     P    TR V   P ++E+G          C  D DC  P+Y    N  C +PC V  PC   A      H+  C C +GY+G+  T C 
Sbjct:    2 VNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPC---DCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPF-IACEVI--------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKP----TCRCPVGYTGNPRVACV---PIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNN--HCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRA-----EIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCV--CPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPC-VKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGCS 2293          

HSP 6 Score: 363.614 bits (932), Expect = 8.345e-101
Identity = 276/804 (34.33%), Postives = 384/804 (47.76%), Query Frame = 0
Query: 6407 INPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDC---QLPI----QPECTRDYECPDNKACIQQQCLNPCTSIA-CGRNAECRVTK----HRALCSCRSGYIGD------PYTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPC----KCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQN----HKSVCKCSLGYIGDPYSTC--VPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNFECLSNDDCPFDKKCISEKCISPC--LETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAI------KGLV--ECQTXXXXXXXXXXXXGTCVDACRKNS---------CGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDC--PSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQ 7161
            +NPC  + PCA +A C V +H + C CP G++G+P   C   + P+    +PEC  D +CPD+ AC+ ++C NPC +++ C   A C V         +CSCR G++ D      P  + NEPGC  D +CP   AC+NR+C +PC    CG  A C  ++HR +C C  G+ G+P   C+P  C  D+DC     C +  CV+PC     C R A+C   +H+  C C   + GDP+ I+C+ I         C +D +CP N+AC   +CINPCL   PCA  A C V +  P    TC C  GYTG   V CV   PI    C  D  C    AC+   C   C   +PC D + C   +       +C C  GY+    S+C  +P     C  DDEC  + +C+N  C+DPC     CG +A C   NH+ +C C  G+ G+P  +C   EC  +DDC     C +EKC   C      CG +A CT   H + C CP GL+G+PYV C  +EC  D DC +++ C      C   C  +N C + + C  T H   C CP  F G   + C       +  GC+ D +CPS  ACI++QC +PC + +PC    KC V DTLP RT+ C C      NA  +C  +      +GL+  E +     P     ++G CV    +           C S    + S   ++C C       P   C  P+ +        C+ D DC  P Y    N  C +PC +   C  NA      H  +C C  GY+G+P T C 
Sbjct:    2 VNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPC---DCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPF-IACEVI--------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKP----TCRCPVGYTGNPRVACV---PIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPC----ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNN--HCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRR-----AEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYC-IPILE--------CELDDDCLDPKYCELANNTCGDPCVKWP-CGPNAYGTATGHRCICKCIEGYVGNPLTGCS 2293          

HSP 7 Score: 354.369 bits (908), Expect = 6.897e-98
Identity = 276/797 (34.63%), Postives = 388/797 (48.68%), Query Frame = 0
Query:  941 CSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKRE---VPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQT--SPECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVC-----RPHPECPDRLKCENEKCVDPC----ECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCIXXXXXXXXXXXXAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADNKCSNPCR-SNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNNCIDPCQ-NTVCGRNAECSVEYHKSICKCPSGLQGSPYVACK--EVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEA----SRHRERCICSSPYTGDGYSFCQKIVV--PASKSECNVDEDC---PSKLS-----CIS-QTCQNPCSLNNPCSTSQECKVADTL-PSR-TVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRG--TCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICN 1700
            C   N CA SA C   NH  KC+CPP  +G+   SC  +E   VP  +PEC  D DCP   AC++E+C++PC    PC  +  C V ++ P +T+ C C    V   D +C  V+    P C   +DC     C++  C+D C    CG  A C    H   C CP GY GNP   C       EP+   GC++D+DC    +C +  C+NPC    PC   A C   +H  +C C  GY G P   C     R   ECP    C ++ C++PC     CA+NA+C    H+  C C   +TG+P  +AC PIP P      C ED+DCPS++AC++  C   C    PC   A C V D+LP+RTM CTC +G+    D  C  + P++  GC ++ EC  + +C N  C    ++   C   A CR  NH+P C C  G+ G+P   C    + EC+ D+DC     C + KC   C   N+ CG  A C  ++H   C C     GDP+ +CF  EC+ ++DCP DK+C +N+CI PC     C   +EC V  H+  C+CP G +GS   +C+  E+ CR D +C     C  Q+  C   CS ++ C  NA+C+           C+C + Y G+    C  +    P      + +E C   P   S     C+  QT      + N C     C  A  L PS+    C+CPP+  +   G C  +    EC+ ++DC D   C+    TC + C   PCG NA  TA  H  +C C +G+ GNP + C+
Sbjct:   11 CLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISC-------EPV---GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPR-VACVPIPAPE-----CVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILS-GCSTDDECGESDSCINKIC----KDPCACGDHAFCRVINHKPVCTCEDGYEGNPDVACI---KIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQ--CIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCI----CDSARGLVPSQDGTRCVCPPDMELGPDGYCIPI---LECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGCS 2293          

HSP 8 Score: 350.132 bits (897), Expect = 1.780e-96
Identity = 291/861 (33.80%), Postives = 383/861 (44.48%), Query Frame = 0
Query: 2910 NPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELST------ECQVNNDCQQFEICVDGTCRKTC-SINSCGANAVCTPV----IHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLACINRKCQNPCSTLT-CGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTN----HRSFCKCPPNHAGDPHASCYKYE-----CRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNN-CAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGI-CQEVETKVECEYNDDCSTNDICQDGSCIDACRV-NKCGANTRC----ISSFHRSECVCLQGYTGNAQVACY-LPITPNEPSLV----------PGCTSDQDCPSY-TACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLAC--IQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINR-ECQNPCLFENCGINAECSPENHRAVCACLKGHKGD 3727
            NPC+   PC  +  C VQN++      C CP G   +    C   E         EC  + DC     C++  C   C +++ C   A+CT V         C+C +G+  D ++ C      VE   EPGC+ DDDCP+   C NRQC++PC  GS     A C   +H+ VC C  G+VG P   C P+    C  D +C D   CI+  C NPC     CG  A+C    H+A+C C+ GY G P   CE      +GCR ++EC    AC++ +CINPC+  NPC  +A+C V  H+  C CP GY G+P   C PI   EC  D DC S  AC+++ C   C    PC   A C   +        C CP  +     +SC         C   D+C    +C+N+ C DPC    CG  A C+   HK  C C +G +GNP + C ++ECR D DC     C  +N +C  +C   N  C G A C A +H+  C CPP  EGD Y  C         +EC+ D+DC   KAC  + C  PC   NPC E  EC     V    V+C CP G F GS G  C+  E  + C  + +C +   C +  CID C V + CG N +C            CVC+ GY GNA + C  +P  P    L+          PG  SD +   Y   C+             C         Q    C CP      P   C  PI+ EC  D +C D   C      C +PC    CG NA      HR IC C  GYVG+P T     GC      P   A  NR + Q  CL +   +      +N + V   +KGH  D
Sbjct:    5 NPCLYENPCAPSATCSVQNHN----AKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKP----VELPNEPGCARDDDCPNGAACINRQCLDPCDCGS----GAQCFVEDHRPVCVCPPGYVGNPQISCEPVG---CQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEV-----IGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPC---ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTC-------FAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSEC----VVTDHEVNCECPPG-FEGSKGTSCRRAE--IGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNE--GYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYC-IPIL-ECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLT-----GCSPIPTPPPVPADFNRPDLQVNCLADGVLVQINLRDDNFKGVMY-VKGHSND 2440          

HSP 9 Score: 344.739 bits (883), Expect = 9.789e-95
Identity = 267/794 (33.63%), Postives = 361/794 (45.47%), Query Frame = 0
Query: 4356 CGRNAICQARNHRAICSCIKSFSGDPYTFCE----------EPGCKSDFECRDNQACINRECQNPCL-FEKCGLNAECNANG----HRAICSCLQGHKGDPYSFCKPYE------CLSDPECPNHLKCKNEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPV----CKCPQGQAGNPHAYCYKYE-----CKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCL-GKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSN-CGVNAECATT----LHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDC---PSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSV--------CTCPDGYIGSPETSCRPPIKPECRYDTECPDHLAC--IQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFC 5100
            C  +A C  +NH A C C   + G+P   C           EP C +D +C D+ AC+N  C+NPC+    C + A C           ICSC +G   D  + CKP E      C  D +CPN   C N +C+DPC+C   A C   +HR +C C P + G+P  I+CEP+         C  D DC  ++ CI+ +C NPCL+  PC + AEC            C CI G+ G     C  I      G R  +EC  N A R ++C+NPC+ ENPC   A+C V+ H+  C C +G+ G+P  +CVP    EC  D DC     C+++ C   CK  + C   AIC   +  PV    C CP G      + C         C T+ +C     C ++ C DPC    CG  A CR   H+ +C C  G +GNP V C  ++CR D DC D   C  +N KC P+C  G   C  +A C A +HK TC C   L GD Y  CF         EC++D DC    AC +  C +PC + +PC    EC   D      V C CP G       +C+R E    C  D +C S + C    C+D CS+++ CG NA+C       +   +C C +G+ GN  I C  P+PT  P        ++ C   P Y S     C+    E      G  C   + + +        C CP      P+  C P +  EC  D +C D   C      C +PC    CG NA      HR +C C+ GYVG+P   C
Sbjct:   29 CAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQ-ISCEPVG--------CQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACEVI------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPC---ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCF-------AIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCRRAEI--GCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIEC-TPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPIL--ECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 2290          

HSP 10 Score: 342.813 bits (878), Expect = 3.270e-94
Identity = 276/803 (34.37%), Postives = 370/803 (46.08%), Query Frame = 0
Query:  430 INPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQ-------PEPECRLDSDCSDHLACIGQQCLTPC-SRNTCGVNAQCRVKN----HRAICSCLSGYVGD------PYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPYSYCNAYECLSDPECPDHLHCISEKCVDPC----KCAANAECDARNHRGYCACIIDFTGDPYGXXXXXXXXXXXXXXXXXXDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKN----HKMYCNCEVGFTGDAYSKCIQIS--QGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPC--KNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECE-IANDCKISDICVSG----------SCIDACKVNPCGVNAICKSA-----SHD-SRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDC--PTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVC 1183
            +NPC  + PC+  ATC V NH   C CP G++G+P   C P+       PEPEC  D DC D  AC+ ++C  PC + + C V A C V N       ICSC  G+V D      P  +  EPGC  D +CP+   CINR+C +PC    CG  A+C   +HR  C C  G+ GNP   C    C SD +C D   CI   CV+PC     C   AEC   +H+  C CI  + GDP+            E + C +D +C   +AC S++C NPC   +PC +NA C V +  P    TC C  GYTG     CV   PI    C  D++C    AC +  C   C T   C   A C+V +      M C C  G+     S C  +      C  DD+C  + +CI+  C DPC+    CG++A C   NH+ +C C  G+  +    C + EC  + DC    AC +EKC   C   N  CG  A C+   HK  C CP GL+G PY+ C  +EC+  +DC   + C   +  C   C+ +N C   + C  ++H   C CPP   G   +SC + E+      C  D +CP   AC++++C DPC+   PC  + +C+V DT P +T+ C+C T         C  V T P    +  D     +C  G           C         G   IC SA     S D +RC CP      P   C        P+L   C  DDDC  P Y    N  C +PC +  PC P A      H  +C C  GY+G+P T C
Sbjct:    2 VNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPC---DCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPF---------IACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKP----TCRCPVGYTGNPRVACV---PIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKAC--FNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEI-----GCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCI-------PILE--CELDDDCLDPKYCELANNTCGDPCVK-WPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 2290          

HSP 11 Score: 336.265 bits (861), Expect = 4.728e-92
Identity = 272/796 (34.17%), Postives = 351/796 (44.10%), Query Frame = 0
Query: 2405 CGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSG----------CESDFECPNHQACINRECQNPCL-FEKCGXXXECKXEN----HRAICHCLSGHKGQAYVNCKRYE------CLRDSDCPNHLHCVNDKCVDPCECARNADCKARNHRGYCTCIPNFTGDPYGXXXXXXXXXXXXXXXXNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRN----HRSVCKCPRGFSGDPHSYCYKYE-----CKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNL-CANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTCRKTCSI-NSCGANAVC----TPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDC---PSYTTCRNRQCI------NPCSIGSPC----AKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLAC--INRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVC 3149
            C  +A C V NH A C C  G+ G+P   C              C +D +CP+  AC+N  C+NPC+    C     C   N       IC C  G        CK  E      C RD DCPN   C+N +C+DPC+C   A C   +HR  C C P + G+P         +   E V C  D DC  ++ CI+ +C NPCL+  PC   AEC            C CI G+ G     C  I      GCR D+EC     CR  DCINPC+ +NPC  +A+C V  HK  C CPVGY G+P   C  I   EC  D DC    AC+++ C   C     C   AIC   +       +C CP G+     S C         C TD++C    +C  + C DPC    CG  A C    H+  C C  G +GNP V+C ++ECR D+DC     C  R  KC  +C   N  C   A C AI+H+  C CP    GD Y  C  I       ECR DKDCPSD AC +  C +PC +  PC +   C V +++    V+CECP G   S G  C+  E+   C+ + +C     C++  C   CS+ + CG NA C    T  +    C C  GY G+    C  PV    P        ++ C   P Y +     C+          IG+ C    A+  +  P      C C       P   C PI   EC LD +C D   C   N  C +PC    CG NA      HR IC C+ GY+G+P T C
Sbjct:   29 CAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNP---------QISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACEVI------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAI-------ECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHE----VNCECPPGFEGSKGTSCRRAEIG--CRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIEC-TPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLV--PSQDGTRCVCPPDMELGPDGYCIPIL--ECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 2290          

HSP 12 Score: 332.413 bits (851), Expect = 6.497e-91
Identity = 270/828 (32.61%), Postives = 371/828 (44.81%), Query Frame = 0
Query: 4669 IDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCY----------KYECKTNQDCPLDKVCTSEKCVDPC-DTTQCGLKALCRT----EYHQSICECPQGLQGNPYVECKSVQ------CRKDQDCRDNEKC-NLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSN-CGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVIN----HKSVCTCPDGYIGSPETSCR--PPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDE--CGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPCA----CAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIE---PITTIGCKSNSEC-------GDN----LACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETC--IQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTKDDCPFDKTCLAKNCV 5445
            ++PC  ++ C   A C  +NH   C CP G  GNP   C           + EC T+ DCP D  C +E+C +PC   + C + A+C       +   IC C +G   +   +CK V+      C +D DC +   C N Q       CL   +C S A C   +H+  C C     G+    C           CQ+D DCR    CI   C NPC + DPC    EC            C C  G        C+ +     C +D +C  +  C    C++ C   N C  NAEC  + H   C C  G+TGNPR+AC +P+P       P C   +DCPS  +C +  C   C    PC   A C VI+       +CTCPDGY+ + ++SCR  PPI   C  D EC +  +CI + C++PC    CG +A CRV NH+ VC+C  GY G+P   C +  C+ D +C ++ AC N+ C+  C      CG  A C A +H++ C C  G +GDPY  C   +C  D DC     C N  C+ PCA    C + +EC   +H+  C C   F G   G +C       + E  C +D +CPS+  C +Q+C +PC    PC +NA+C+V DTLP+RTM CVC+ GY G    +C  +    P   +    N +C        DN    + C+          Q  C S            C C P     P   C      EC  DDDC   + C      C DPC    PCG NA  ++  HR +CKC  G  G+P + C            F++  L  NC+
Sbjct:    2 VNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQ-------CLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQISC-------EPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACEVIG----CRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVAC-VPIPA------PECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGS-KGTSC------RRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYC--IPILECELDDDCLDPKYCELANNTCGDPC-VKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGCSPIPTPPPVPADFNRPDLQVNCL 2359          

HSP 13 Score: 330.487 bits (846), Expect = 2.597e-90
Identity = 268/803 (33.37%), Postives = 355/803 (44.21%), Query Frame = 0
Query: 6471 LNPCT-SIACGRNAECRVTKHRALCSCRSGYIGDPYTICN----------EPGCKSDFECPQQQACLNRECQNPC-HFEKCGVNAMCSPKN----HRGICSCIEGHKGDPYSFCKPYE------CLIDSDCPTNLQCNNEKCVDPCKCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKN----HRAICMCPKGFAGDPHTSCYNFE-----CLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENS-CTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTXXXXXXXXXXXXGTCVDACR-KNSCGSYSTC----LTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDC---PSYNSCRNRLCINPCAEDDICVINANCKVINHEPV--------CSCPNGYIGSPTTECQLSPKPECIVDQDCPLTKACIIGK--CESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVC 7223
            +NPC     C  +A C V  H A C C  G++G+P   C           EP C +D +CP   ACLN  C+NPC     C V A+C+  N       ICSC EG   D  + CKP E      C  D DCP    C N +C+DPC C   A C +++HR  C C   + G+P  ISC+P+         C  D DC     CID +C+NPCL  +PC   A C            C CI GY G   + C  I      GC+ D +C  N AC   +C+NPC+ ++PC   + C    HK  C+C +GY G+P   CVP+   EC  D +C S  AC+++ C+  C   N C   AIC   +       IC CP G+     +SC         C ++D+C     CI++ C  PC    CG+ A C V  H  VC C  G +GNP V C ++EC  D DCL+   C  R  KC  +C   N+ C   A C A  H   C CP    GD    C  I        C+ D+DCPS  AC +  C +PC + NPC    +CVV D      ++C+C      +    C   +  + C++D +CP    C +  C+D C   + CG  + C            C C+ GY G+    C  PVP   P        ++ C   P Y S     C+    E    +I   C   +   +        C CP      P   C   P  EC +D DC   K C +    C  PC    CG NA   A  HR  C C+ GYVG+P T C
Sbjct:    2 VNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQ-ISCEPV--------GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACEVI------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAI-------ECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCR--RAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECT-PVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYC--IPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 2290          

HSP 14 Score: 329.331 bits (843), Expect = 7.125e-90
Identity = 283/840 (33.69%), Postives = 382/840 (45.48%), Query Frame = 0
Query: 7442 VNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVE-------DKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRP----ICKCPPGTIGDPHNFCHSYE------CLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLXXXXXXXXXXXXXXXRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLVFR-CGDNAVCKSFD----HSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCELPSEPECLVDDDCPSDLACIHQSCKTPC--STSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEEPGCKSDIECPFDKACISRECQNPC-LYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYE--CLYDPDCPDHLTCKNEKCVDPCQCAKYAECDARNHRGIFPEPVEVEGCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELI-TEPIVVGCSNDRD----CSTSLACRN--------TECVNPCAKDRPCAQTARCEV-NRHKSHCTCPPGMTGDPYSICVIIEDHECEQDSDCNGNKAC--VEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFC 8238
            VNPC+ E+PC  +A CSV+NH A C CP G+ G+P   C P E       + EC  D +C    +C+  +C   C   +PC   A+C + N  P    IC C  G + D    C   E      C  + DCP   +C N+ C++PC    CG  A+C VE H+ VC CP GY G+P ISC+ + C +DNDC+D + C      C   C   D C   A+C    H   C C     GD +  C    E I   C+ D++C  N AC +  C NPC+   PC  N +C+V    P     C CP G++      C  + P P+C +  DC S   C   TC   C     C D A+C   D     +  C C   +V     +C        P + +GC+ D +C   ++C N++C DPC    C  +A CRVI H+PVCTC DGY G+P  +C    + EC VDDDC    AC ++ C+  C    + CG  A C   SH+A C C  G +GDPY  C    C+SD +CP DKAC +  C +PC + + C   +EC+   H   C+C  G +G+    C+  E  C  D +CP    C N++C+DPC  A                                                PC  NA+C+V +TLP+RTM C C  GY G    +C  + T P   G   D +    C       N        TE       ++    +AR  V ++  + C CPP M   P   C+ I   ECE D DC   K C      C DPC+K  PCG NA      HR +CKC  G  G+P + C
Sbjct:    2 VNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDG--DCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIAC----EVIG--CRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKP----TCRCPVGYTGNPRVACVPI-PAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTL-----PPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVAC---IKIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVAD-----------------------------------------------PCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPI--LECELDDDCLDPKYCELANNTCGDPCVK-WPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 2290          

HSP 15 Score: 328.561 bits (841), Expect = 1.180e-89
Identity = 277/850 (32.59%), Postives = 376/850 (44.24%), Query Frame = 0
Query: 2654 INPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILT-------HECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRN----HRSVCKCPRGFSGDPHSYCYKYE------CKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTCRKTC-SINSCGANAVCTPV----IHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLACINRKCQNPC--STLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTN----HRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCL---NEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKAC--IEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGS 3470
            +NPC+ +NPC  SA CSV++H A C CP G+ G+P   C    +        EC  D DC    AC+  +C  PC     C   AIC   N       +C C  G+  D  + C   E      C  D+DCP   AC   +C+DPC    CG+ A+C  E H+  C C  G  GNP +SC  V C++DNDC   + C      C   C   + C   A+C   +H+  C C   + GD +  C  I        CR D +CP + AC S  C NPC+   PC +N  C V  + P    +C CP G   +    C  +  + EC  + DC     C+D TC+  C ++N C   A+CT +    +    C C DGY    +S+C      + P+L  GCS DD+C    +C N+ C +PC+    C   A C+ INHK VCTC DG+ G P   C  I   EC +D +C D  AC N KC+  C      CG  A C    H+A C C  G  G P+  C       + CRS+ +C    AC N  CI+PC   NPC   ++C V  HE NC CP G+ G   ++C   + + C+ D +C S  ACIN QCIDPC++  PCG NA+C   +        C C   + G+        EC     CP  +  +   NE+CV                        CP G   +   +C  V C+ +                  L  +   C        S    RC+CPP  E     YC   IP    LEC++D DC   K C    + C DPC    PC  N    A+ +       C C +G ++G+
Sbjct:    2 VNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMC--IDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVI-------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKP----TCRCPVGYTGNPRVACVPIP-APECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCR----TLPPILS-GCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKI---ECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTC-----FAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAE-IGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGN-----AAIECTPVPTCPPGRGLILDENEQCV------------------------CPPGYYSDNEGYC--VRCQTELG--------------FVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYC---IP---ILECELDDDCLDPKYCELANNTCGDPCVKW-PCGPN----AYGTATGHRCICKCIEG-YVGN 2275          

HSP 16 Score: 327.791 bits (839), Expect = 2.039e-89
Identity = 281/854 (32.90%), Postives = 373/854 (43.68%), Query Frame = 0
Query: 3643 CGKNAQCRVQNHRAICSCFGGYVGDPYTACE----------EPGCKSDFECPNKQACINRECQNPCL-FENCGINAECSPEN----HRAVCACLKGHKGDPYSFCKPYE------CLSDPECPNHLKCENEKCVDPCECARNADCDARNHRGICTCILDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNS--LHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPV----CKCPPGLAGDPHSTCYRYE-----CKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCT-GSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVCYEGSCINACLIKK-CGFNAQCSTI----LHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPG----CSYNDDC---PSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESV--------CTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYAC--IRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPGCKSDFECRDNQACINR-ECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGD 4440
            C  +A C VQNH A C C  G+VG+P  +C           EP C +D +CP+  AC+N  C+NPC+    C + A C+  N       +C+C +G   D  + CKP E      C  D +CPN   C N +C+DPC+C   A C   +HR +C C   + G+P  I+CEP+         C  D DC  ++ CI+ +C NPCL+  PC + AEC            C CI G+ G     C  I      GCR + EC ++ AC + +CI+PCL  NPC   A+C V  H+ TC CPVG+TG+P    +     EC  D DCP   AC+++ CK  C    PC   AIC      PV    C CP G      S+C         C T+++C    +C ++ C DPC    CG  A C V  H+  C C  G +GNP + C ++ECR   DC D   C     KC P+C  G+  C  +ATC A +H+  C CP    GD Y  C          ECR D+DC S  AC  + C  PC   NPC    EC V +      V+C CP          C R E    C  + +C S   C    CI+ C +   CG NA+C  +    +    C C  GY GN    C        P+  PG       N+ C   P Y       C+    E     I   C       +        C CP      P   C P    EC +D DC D   C      C +PC    CG NA   A  HR IC CI+ + G+P T     GC          A  NR + Q  CL +   +      +  + +   ++GH  D
Sbjct:   29 CAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQ-ISCEPVG--------CQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACEVI------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTC-------FAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHE----VNCECPPGFEGSKGTSCRRAE--IGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPV-----PTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPIL--ECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLT-----GCSPIPTPPPVPADFNRPDLQVNCLADGVLVQINLRDDNFKGVMY-VKGHSND 2440          

HSP 17 Score: 322.783 bits (826), Expect = 6.587e-88
Identity = 268/800 (33.50%), Postives = 369/800 (46.12%), Query Frame = 0
Query: 4605 VNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSC-------VPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRP----VCKCPQGQAGNPHAYCYKYE------CKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDAC-SLSNCGVNAECATT----LHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPC--TSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLF-DECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYD--CLVDNDCLDHLRCTNTKCVDPCA----CAKYAECDARN----HKAYCSCLVDFTGDPYGIACDPIPE-------PLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMT-CVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGK--CLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQ 5359
            VNPC+ ENPC   A C V NH ++C C  G++G+P  SC       VP    EC  DGDC D+  C+N +C +PC   S C   AIC   N  P    +C C +G   +    C   E      C  + DCP    C + +C+DPCD   CG  A C  E H+ +C CP G  GNP + C+ V C+ D DCRD + C   +  C   CL ++ C   A C   +HK  C C     GD +  C           C+ D +C  + AC SK C NPC   +PC+ + EC   +  P    TC CP G T      C  + + PEC +D+DC S   C + TC   C +L+ C   A C       +   IC+C  G+      +C     T+ P L+ GCS   +C    SC N++C DPC     C   A CRVINHK VCTC DGY G+P+ +C   IK ECR D +C D  AC  +KC+  C   +  CG  A C   +H+A C+C  G  GDPY  C    C+SD +CP+ +AC+N +C  PC   + C + ++C   +H   C C  G +G   T C+  +  C  D +C     C N +C+DPC+    C + A+C   +        C C+  + G+   I C P+P         L    +C+      S    Y   C+    F     Q         +P +  T CVC        D  C+ I     + C+ + +C D   CE+    C +PC  + PCG  A      H+  C C  GY G+P   C 
Sbjct:    2 VNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMC--IDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIAC-------EVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKP----TCRCPVGYTGNPRVACVPIPA-PECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCR----TLPPILS-GCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPVCTCEDGYEGNPDVAC---IKIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGN-AAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPI-----LECELDDDCLDPKYCELANNTCGDPC-VKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGCS 2293          

HSP 18 Score: 322.398 bits (825), Expect = 1.078e-87
Identity = 274/808 (33.91%), Postives = 382/808 (47.28%), Query Frame = 0
Query: 1268 NPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCI-KIEPVV---DVGCRSNSECDRNLACDNGKCIXXXXXXXXXXXXAICRTQNHQP----TCECSPGFTGDPYSLCSPTR---EDECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNNCIDPCQ-NTVCGRNAECSVEYHKSICKCPSGLQGSPYVACKEVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRV-ETATECQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINX-XXXXXXXXXXXRCKVINHEPECTCPDGFIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCENEKCVDPCE----CARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKI---QPVVDVGCRSNSECS--PTLACRN-GECLN-------PCIENDPCSNTAKCQVLNHNA-KCICQIGYTGDPYSQCVKISNSECKYDTDCASNEAC--INDQCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSC 2041
            NPCL   PC  +A C V +        C C  G+ G     C  K  PVV   +  C ++ +C  + AC N +C NPC   +PC  +AIC   N  P     C C  G+  D  + C P     E  C  D+DCP+   C + +C +PC     CG+ A C V +H PVC C   + G+P  SC    CQ + DC     C   +C++PC     CGR AEC    HK++C+C  G +G P++AC+ + CR+D +C  ++ C  +   C   C   N CA NA C  S H+  C C   YTG+    C    VP    EC  D+DCPSK +C+  TC+  C   NPC+    C V D+LP RT+ C CP         +C+ +    + C ++++C ++D C    C + C    CG +A C    H  VC+C DG+EGNP   C    + +E      C  + DC    AC++ KC       ++PC   A C  I+H+  C CP G  G         DPY  C   EC SD +CP    C N  C+ PC     C   ++C   +H   C C P F G   G +C         E+ C+ D +CPSQ ACIN++C +PC +  PC +NA+C+V DTLP+RTM C CI G+ G     C  +    P   +    N +C   P     N G C+          I N    ++A+  V + +  +C+C       P   C+ I   EC+ D DC   + C   N+ C D C V  PCG +A      HR +CKC +G  G+P   C
Sbjct:    5 NPCLYENPCAPSATCSVQN----HNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD----CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKAC--RSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVAC----VPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVAC----IKIE------CRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEG---------DPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGS-KGTSC------RRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPI--LECELDDDCLDPKYCELANNTCGDPC-VKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 2290          

HSP 19 Score: 320.087 bits (819), Expect = 4.521e-87
Identity = 258/799 (32.29%), Postives = 369/799 (46.18%), Query Frame = 0
Query: 2984 NSCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPIN----HKAVCTCLDGFVGTPSTDCRPI---NVPECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKY---ECRISDDCPFDKTCLNEKCVDPCDTTR-CGSKAICKA----EYHKGSCECPNGLQGNPYIFCKEVECRKD----TDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYIN-PCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGSCIDACRV-NKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQ----HKALCTCPDGFIGSPTNDCKKPIVPEC-------LSDPE---CPDHLACIQQ----KCQNPCSSITCGKNAQCRVQNHRAICSCFGGY--VGDPYTACEEPG-------CKSDFECPNKQAC--INRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFC 3732
            N C  +A C+   H  KC C  G+ G+P  +C      V P  EP C  D DCP  T C N +C NPC   SPC  +AIC  +N       +C+C +G+V    T C+P+   N P C  D +CP+  ACINR+C +PC    CG  AQC V+ HR +C C  GY+G+P   CE      VGC+S+++C     C +G+C+NPC+  +PCG  A+C    H+A C C  GY GDP+  C   + + C+ D +C  N+AC +  CI+PC    PC  NAECL + H+  C+CP  + G+P  +C      EC    DCP    CL+  C   C T   C   AIC            C CP+G     Y+  ++  CR      + C+++++C   +    ++C D   C   A C   NH+  C C   +EG+    C        K+EC++D DC  T AC    C+  C   N PC     C A +       +C CP G        C      +EC  + DC ++  C +  CI  C + N C   + C+ + H   C C  G+ G+   +C             GC SD +CPS TAC N+QCI+PC+   PC   A C+V+        +C C  G+ G+   +C    VP C       L + E   CP       +    +CQ     +  G   QC   + R +     G   V  P       G       C+ D +C + + C   N  C +PC+   CG NA  +   HR +C C++G+ G+P + C
Sbjct:   23 NPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEP-----VGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIAC---EVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDG-----YVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCACGDHAFCRVINHKPVCTCEDGYEGNPDVACI-------KIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAIS----HKATCACPPGLEGDPYVTC----FAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEI--------GCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTP--VPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGN--QCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 2290          

HSP 20 Score: 318.546 bits (815), Expect = 1.436e-86
Identity = 277/808 (34.28%), Postives = 367/808 (45.42%), Query Frame = 0
Query: 8391 NPCSRRNPCLPSETCLXXXXXXXXXXXXXCREGFYVGKNGDC------IEVDGQPECRSHSDCRYNEQCQSGSCLDAC-RIRLCGINAICVAEN----HESTCACRIRFSGNPEVACLPISPLVVEALP--PGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECKPPTPLSIGCSADSDCPVVEACLNTKCVDPC----NCGENALCRKINHKAVCFCPSGFSGNPEVLCEKLECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDV---ECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQ----HASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCN-----CGGGAKCFLSGHRPICQCPEGFIGNPQIECNPAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGC--SIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHF----AQCRCKVGYQGDPYESCTVIP--PP----------ECVEDGDCTTGMACINEKCDNPCEV---LKPCAEQAICHVIESL-PVKPMT-CECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSC--INAICRSPCA---CGLNADCKIIDHQPVCTCKPGFYGDPEIECT 9141
            NPC   NPC PS TC    S  + +  C C  G+       C      +  D +PEC +  DC  +  C +  C + C  +  C + AIC   N        C+CR  +  + +  C P+       LP  PGC  D +CP    C N +C+DPC     CG  A C V  H P+C CP G+ G+P I C+P     +GC +D+DC   + C++  CV+PC     CG  A C   +HKA+C C  G+ G+P + CE + C  D +C  +K C    C NPC+  NPCA N EC+ S H   CRCP    G+P   CV +   EC  ++DC S+ AC    C   C   NPC   A+C  +         C C    +     SC    P    +   C  D +C    +C+N  C++PC     C   A C V++  P    VCTC +G+    D +CI IE      C  DD+C    AC N  CR  C      CGG A C    H+  C CP G  G+P + C    C SDK+C S +AC    C++PC I +PC   ++C    H   CEC  GFEG   T C  + IGC+SD+ECP++ AC N+ CIDPC   +PC   A C   D        C C  GYQG+    CT +P  PP          +CV    C  G    NE     C+          Q IC     L P +  T C CP     G    C    PI+  CE +DDC +   C   N  C  PC    CG NA      H+ +C C  G+ G+P   C+
Sbjct:    5 NPCLYENPCAPSATC----SVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVE------LPNEPGCARDDDCPNGAACINRQCLDPC----DCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEP-----VGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPP----ILSGCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKP----VCTCEDGYEGNPDVACIKIE------CRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCV----CPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCI---PILE-CELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGCS 2293          

HSP 21 Score: 317.775 bits (813), Expect = 2.884e-86
Identity = 273/800 (34.12%), Postives = 371/800 (46.38%), Query Frame = 0
Query: 1081 NPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNP----VCTCPNGYIGSPTTVCRP-----------HPECPDRLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCIXXXXXXXXXXXXAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPV----CKCLENFAGDPHSSC-----FKYECQKNEDCPFDKSCSSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYVACKEVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNV-CAANARCEASRHRERCICSSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINACK-SRPCGVNAKC----TARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDC---PSHAACKDRKCINXXXXXXXXXXXXRCKVINHEPECTCPDGFIGSPTTD-----CRP---RDPYSFCRP-YECLSDPECPDHLKCE--NEKCVDPC---ECARNADCDARNHRGICTCIPDFTGDPY 1833
            NPC  +A C   +H+++C CP G+ GNP   C        P   P C  D DCP  + C N  C NPC   SPC  TA C V+N  P    +C+C  G++    T C+P             +CP+   C N +C+DPC+C   A C   +HR +C C P + G+P  I+CEP+         C  D DC  ++ CI+ +C NPCL+  PC + AEC            C CI G+ G     C  I      GCR ++EC  N AC +  CINPC   NPC+ +A C    H+PTC C  G+TG+P   C P    EC  D+DCPS   C D+ C   C++ + C + A+C V++  PV    C C + +     SSC         C  +++C    SC +  C DPC    CG +A C V  HK +C C  G +G+P VAC +++CR D+DC     C  ++  C  +C   N  C   A C A  H+  C C     GD Y  C  I       EC  D+DCPS  +C +  C +PC++ NPC    EC V D      V C CPP    +   +C+R E    C+S+ +CP    C    CI+ C  + PCG NAKC    T    + VC C  G++GN    C   P    P +    D N+ C   P + +  +  C+    E           +I ++  C    G +  P+ D     C P     P  +C P  EC  D +C D   CE  N  C DPC    C  NA   A  HR IC CI  + G+P 
Sbjct:   23 NPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQ-ISCEPVG--------CQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACEVI------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPC---ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACRNEK--CRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAI-------ECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCRRAEIG--CRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVP-TCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFV-------LIGNQCICDSARGLV--PSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPL 2281          

HSP 22 Score: 316.235 bits (809), Expect = 7.760e-86
Identity = 263/801 (32.83%), Postives = 353/801 (44.07%), Query Frame = 0
Query: 5064 NPCTSVT-CGLNAVCRVQNHRAVCSCLGGYVGDPYKFCD----------EPGCKSDFECPNSQACYNKNCQDPCL-FDECGQNAKCFANN---HRSM-CVCNEGHKGDPYTFCKPYD------CLVDNDCLDHLRCTNTKCVDPCACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPV----CKCPNGLAGDPHSYCYKYE-----CVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNI-CAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIA------------ELSQITIQTQAE--CTTNNDCRXTDVCLSGTCIDACKVF-PCGAYADC-VPNFHEAR---CACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDC---PRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSE-TSCQLPQKPECTKDSECANHLAC--------------IQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVC 5795
            NPC     C  +A C VQNH A C C  G+VG+P   C           EP C +D +CP+  AC N+ C++PC+    C   A C   N    R+M C C EG   D  T CKP +      C  D+DC +   C N +C+DPC C   A+C   +H+  C C   + G+P  I+C+P+         C +D DC  +++C D +C NPC    PC + AEC            C C+ GY G     C        IGC+ ++EC  N AC    C+NPC  + PC   A+C V  H+P C C  GYTG+P   C      EC  D DC +   C+   C   C+   PC   A+C+     PV    C CP+G      S C         C T D+C    +C+ K C DPC    CG  A C   +H+ +CTC  G +GNP + C ++ECR ++DC     C   + KC  +C   N  C   A C +++HK  C CP  + GD Y  C          EC+ D DCP  +AC N  C +PC + NPC    EC +             E S+ T   +AE  C ++ +C     C++  CID C V  PCG  A C V +    R   C C TGY GN   +CT V    P    I    +  C   P Y +     C+        C +     +I ++  C    G + S + T C  P   E   D  C   L C                  C DPC    CG NA      HR IC C+E Y+G+P + C
Sbjct:    5 NPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQ-ISCEPV--------GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIAC------EVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTC-------FAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLI-LDENEQCVCPPGYYSDNEGYCVR-------CQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 2290          

HSP 23 Score: 315.464 bits (807), Expect = 1.380e-85
Identity = 268/788 (34.01%), Postives = 350/788 (44.42%), Query Frame = 0
Query: 3760 CARNADCDARNHRGICTCILDFTGDPYGIACXXXXXXXXX--XXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCYRYECKTNEDCPFDKACASEKCIDPC-QTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKEL---ECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATN----HQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVCYEGSCINACLIKK--CGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTIT-CGRNAICQARN----HRAICSCIKSFSGDPYTFCE-----EPG------------CKSDFECRDNQACINRECQNPCLFEKCGLNAECNA--------NGHRAICSCLQGHKGDPYSFCKP-YECLSDPEC--PNHLKCKNEKCVDPC---ECARNADCDARNHRGICTCIPDFTGDPY 4499
            CA +A C  +NH   C C   + G+P  ++C P   PV+   E EC  D DCP   AC+NE C+NPC+   PC   A C V ++LP RTM C+C EG+    D +C  +E     GC  + +C    AC N  C+ PC     CG+ AQC V +HR  C CP G+ G+P  +      C  D DC D   CI+  C NPC+V  PCG  A C    H+ +C+C PG  GDP   C    C+ + +CP +KAC S+ CI+PC     C   A C V  H+ +C+CP G  GNP + C  +   EC + +DC     C  +T  C PLC   N C   A C   +        C CP  Y+    S C     P I   C  D +C    +CI   C DPC   +       C+V+N  P+    C C           C ++    EC V++DC  T  C    C   C      CG  A C+ I H A C C  G  G+P   C      +E      C  + DCPS   C N  CI PC    PC   + C V  HE  C CP GF GS  T+CR   +  C  D +C    ACI Q+C +PCS    CGRNA CQ  +       +C CI  + G+    C       PG            C   +   +   C+   CQ    F   G    C++        +G R  C C    +  P  +C P  EC  D +C  P + +  N  C DPC    C  NA   A  HR IC CI  + G+P 
Sbjct:   29 CAPSATCSVQNHNAKCMCPPGWVGNPL-VSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPC----DCGSGAQCFVEDHRPVCVCPPGYVGNPQ-ISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDST--CKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCR--TLPPILSGCSTDDECGESDSCINKICKDPCACGDHAF----CRVINHKPV----CTCEDGYEGNPDVACIKI----ECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTC----FAIE------CRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCR-RAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCV--RCQTELGFVLIGNQCICDSARGLVPSQDGTR--CVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPL 2281          

HSP 24 Score: 311.612 bits (797), Expect = 2.406e-84
Identity = 248/796 (31.16%), Postives = 367/796 (46.11%), Query Frame = 0
Query: 6209 CAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEES---KKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTE--CKVDTDCARSDMCKDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPCT-SIACGRNAECRVTKHRALCSCRSGYIGDPYTICN---EPGCKSDFECPQQQACLNRECQNPCH-FEKCGVNAMCSPKN----HRGICSCIEGHKGDPYSFCKPYE-----CLIDSDCPTNLQCNNEKCVDPCKCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCL-TYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKN----HRAICMCPKGFAGDPHTSCYNFECLSNDDCPFDKKCI---SEKCISP----------CL-------------ETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEV-ECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFC 6953
            CA +A C + NH   C C P + G+    CT KE       +P+C  DGDCP   +C+++RC++PC    PC V   C+V NSLP R++ C C    +   +  C+ +++  E  C  D DC     C +  C++ CD   CG  ++C    H+  C C  GY G+P   C  +          GC  D+DC     C +  C+NPC + +PC   A+C    H+++C C  GY G P   C++     C +D ECP NKAC  + C+NPC     C +NAEC V++H+  C C  GY G+P   C     P C  D +CP + ACL+  C+  C     C   A+C+  +       IC+C +G+     S C+        C  D +C  +  C N+ C DPC C  +A C + NH+  CTC+  + G+P  ++C        ++ EC  D DC    AC + +C   C     PC  +ATC           TC+C  G  G   V C  I+      C+SD  C  + AC   +C++PC   +PC + S C   +H+  C+C  G+ G   ++C    E  C+ D EC S  AC+N QC DPC+ A+ CG NA C+  +       +C+C  G+ G+        EC     CP  +  I   +E+C+ P          C+             + IC +          + C CP  ++  P   C  + EC  D DCL+ + C L    C   C +   C  +A   AT H  IC C   ++G+  + C
Sbjct:   29 CAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPV----------GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVI---GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCACGDHAFCRVINHKPVCTCEDGYEGNP-DVAC--------IKIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAIS----HKATCACPPGLEGDPYVTCFAIE------CRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRA-EIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAA-----IECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKW-PCGPNAYGTATGHRCICKCIEGYVGNPLTGC 2290          

HSP 25 Score: 309.301 bits (791), Expect = 1.096e-83
Identity = 222/637 (34.85%), Postives = 312/637 (48.98%), Query Frame = 0
Query:    1 MACTCIEGYEEPIIASGCQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRN----HRTTCVCTIGFTGDAYSNCSPI---NEDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCKSTK-CGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIES-KTECENNNDCGDQDVCVGGTCLNSCRVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAE-DKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPCS-RNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCE--EPGCRNDFECPDTQTCINRECQNPC-LFEKCGENAECSPRN----HRATCKCNKGHKGNPYSYCNAYECLSDPECPDHLHCI---SEKCVDP 616
            ++CT  E    P     C +D +C  + AC N  C NPC   +PC V A C+V N        C C  G+  D  + C P+   NE  C  D DCP   AC+  QC+DPC+    CG+ A C  + H+PVC+CP G  G+P   C    C+ +NDC     C++  CV+PC     CG  A+C    H A+C+C  G +G P+++C+ + CR + +CP N  C   +  C   C+    CA +A C   +H+ TC CP   TG+    C    V I  PEC  D DCP K+AC+   C+  C    PC+    C V+DS P RT+ C CP    ++ +  C  +    + C  +++CG+ D C+   C + C    CG +A C   +H+  C+C  GY GNP  +C +I+          C  + DC    +CRN  C   C   + PC   ATC  I+H+  C CP G  G P   C      ECR D DC    AC    C++PC+ +N C   ++C V +H   C C  G+ G   + C   E GCR+D ECP    CIN++C +PC + + CG NA+C   +        C C  G++GN      A EC   P CP     I   +E+CV P
Sbjct:  110 VSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD----CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKD--CINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVAC----VPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIE----------CRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAI---ECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGN-----AAIECTPVPTCPPGRGLILDENEQCVCP 1927          

HSP 26 Score: 308.145 bits (788), Expect = 2.786e-83
Identity = 260/798 (32.58%), Postives = 362/798 (45.36%), Query Frame = 0
Query: 7192 NICGINALCRANNHRATCVCVSGYVGDPYTVCE----------XPGCKSNLECLTTQACINKDCLDPCL-FEQCGQNAQCNPRN----HRAMCKCKEGHKGDPYTFCRPYE------CLVDRDCPDQLKCDHEKCVDPCQCAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRP----ICKCPPGTIGDPHNFCHSYE-----CLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLXXXXXXXXXXXXXXXRKTYTCYKVCN-SNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLVFR-CGDNAVCKSFD----HSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDC---PSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQ-TSCELPSEP------------ECLVDDDC--PSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQIC 7935
            N C  +A C   NH A C+C  G+VG+P   C            P C ++ +C    AC+N+ C +PC+    C   A C   N       +C C+EG   D  T C+P E      C  D DCP+   C + +C+DPC C   A C  ++HR  C C   Y G+P  I+CEP+       GC+SD DC  +  CID +C NPCL   PC   A+C            C C  GY G     CE      V+GC  D EC  + AC + +C+NPC+ E+PC   A+C V  HK  C CP+G+ G+P   CVP+   EC  D +C    +C+++ C  +C   NPC+  A+C + +  P    IC CP G +    + C +       C ++ +C    SC NKIC +PC+   CG +A C V  H+ VC C  GY+G+P ++C  ++C  D+DC D   C  +   C  +C   N  C   A CTA  H   C C   L GD Y  C         EC+ D DC ++ AC N+ C +PC I  PC+   +C+V +      V C CP G    K   C++   +  C   ++C S   C    CI  C V   CG NA C+  D     +  C C+  + G+    C   P T  P        +  C   P Y + +   C+       C       +I ++ +C  + G + S   T C  P +             EC +DDDC  P      + +C  PC    CG NA      HR IC CI GY G+P   C
Sbjct:   23 NPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQ-ISCEPV-------GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACE------VIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTC------FAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCRRA--EIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVP-TCPPGRGLILDENEQCVCPPGYYSDNEGYCVR------CQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 2290          

HSP 27 Score: 305.449 bits (781), Expect = 1.829e-82
Identity = 275/869 (31.65%), Postives = 385/869 (44.30%), Query Frame = 0
Query: 1669 PCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINXXXXXXXXXXXXRCKVINHEPE----CTCPDGFIGSPTTDCRPRDPYSFCRPYE--CLSDPECPDHLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKISNSECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIR----HRSVCKCPKGLAGDPHVSCYSFE-----CKKNEDCPFDKECKSESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNN-CAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYV-ERCGINAEC----IANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPGCDVDRDC---PSY--------TMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNCQPPERPECRVDAECPLDRAC--IHQKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINR-ECQNPCLFEKCGXXXECKXENHRAICHCLSGHKG----QAYVNCKRYE 2498
            PC  +A C+ + H++ C C  G+ GNP   C      V P  EP C ++ DCP   AC + +C NPC   SPC  +A C V+N  P     C+C +G++    T C+P +      P E  C  D +CP+   C N +C+DPC+C   A C   +HR +C C P + G+P  I+CEP+         C+ D DC  ++ CI+ +C NPCL+  PC + AEC            C CI G+ G     C  I      GCR ++EC    ACR+ +C+NPC+  +PC+  A+C V  H   C C +GYTG+P   CV I   EC  D DC S  AC++  C   C    PC   A C  I        +C CP G       SC +       C  +++C     C ++ C DPC    CG  A C V  HK +C C  GY+GNP ++C +++CR + DC     C  +  KC P+C   N  C   A C A +H+  C+CP  L GD Y  C          EC  D D    +AC ++ C +PC +++PC     C V +      V+CEC  G +      C   +++  C  D +C     C    C++ C V + CG NA+C            C C  GY G+    C   PT   P      D +  C   P Y          C+  L          C         Q    C CP      P   C P    EC +D +C   + C   +  C +PC +  CG NA      HR IC C++GY G+P     L+GC      P   A  NR + Q  CL +        + +N + + + + GH      +  VN K  E
Sbjct:   26 PCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVE-----LPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQ-ISCEPVG--------CQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACEVI------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPC---ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCF-------AIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSC--RRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPT-CPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPIL--ECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNP-----LTGCSPIPTPPPVPADFNRPDLQVNCLADGVLVQINLRDDNFKGVMY-VKGHSNDERCRQSVNAKELE 2479          

HSP 28 Score: 305.064 bits (780), Expect = 2.079e-82
Identity = 267/806 (33.13%), Postives = 360/806 (44.67%), Query Frame = 0
Query: 3177 INPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQ-------DLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSF----CKCPPNHAGDPHASCYKYE------CRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGSCIDACR-VNKCGANTRC--ISSF--HRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPC--SSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFEN-CGINAECSPENHRAVCACLKGHKGDPYSFCKPYE--CLSDPECPNHLKCENEKCVDPCE----CARNADCDARN----HRGICTCILDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACI---NEECDNPCLMYKP----CVQNAECKVYDTLPLRTMTCTC--IEGFTGKGD-ERCV-----KIEP----IIHTGCRSNTECAVSLACENAN--CISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDP 3926
            +NPC+  NPC  SA C V+ H A C+CP G+ G+P  +C P +       + EC  D DC  + AC+N +C +PC    PC   A C   N   F    C C      D    C   E      C   DDCP    C+N +C+DPCD   CGS A C  E H+  C CP G  GNP I C+ V C+ D DC   + C   +  C+  C   + C  FA C  ++H+  C C P +EGD +  C         + C+ D +C   KAC    C +PC Y NPC++N EC      P    +C CP G        C  +    EC  + DC +   C D +C   C+ +N C     C  I S       C C  GY      +C        P ++ GC++D +C    +C N+ C +PCA    C   A C+V+ HK +CTC DG+ G+P   C K    EC  D +C D  AC  +KC+  C   +  CG  A C   +H+A C+C  G  GDPY  C    C+SD +CP+ +AC N  C +PC  +N C   +EC   +H   C C  G +G   + C+  E  C SD ECP+   C N++C+DPC     C RNA C   +       +C CI  + G+                +EC     CP     I   NE+C  P   Y      CV+   C+      L    C C    G     D  RCV     ++ P    I    C  + +C     CE AN  C  PC+K  PCG  A  +   HR  C C  G+ G+P
Sbjct:    2 VNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMC--IDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIAC-------EVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKP----TCRCPVGYTGNPRVACVPIPAP-ECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCR-----TLPPILSGCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPVCTCEDGYEGNPDVACIK---IECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGN--------------AAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVR---CQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVK-WPCGPNAYGTATGHRCICKCIEGYVGNP 2278          

HSP 29 Score: 303.138 bits (775), Expect = 8.886e-82
Identity = 264/789 (33.46%), Postives = 358/789 (45.37%), Query Frame = 0
Query: 7906 CGINAKCNVKSHRAICVCIAGYDGDPYQICE----------EPGCKSDIECPFDKACISRECQNPCL-YDECGVNAECIPKS----HRAMCKCKKGHKGNPYVHCKPYE------CLYDPDCPDHLTCKNEKCVDPCQCAKYAECDARNHR-------GIFPEPV---EVEGCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPV----CKCQSGTAGDPHSFCYEYE-----CLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFEN-PCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLXXXXXXXXXXXXXCREGFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDACRIR-LCGINAICVAEN----HESTCACRIRFSGNPEVACLPI------SPLVVE-----ALPPGCRSDSECPTY-NQCQNNKCVDPCIVNDPCGKDAFCKV--NYHVPLCRCPEGFEGDPSIECKPPTPLSIGCSADSDCPVVEAC--LNTKCVDPCN---CGENALCRKINHKAVCFCPSGFSGNPEVLC 8629
            C  +A C+V++H A C+C  G+ G+P   C           EP C +D +CP D AC++  C+NPC+    C V A C   +       +C C++G   +    CKP E      C  D DCP+   C N +C+DPC C   A+C   +HR       G    P    E  GCQ D DC  ++ CID +C NPCL   PC   AEC   +        C C  GY G     CE      V+GC  D +C  + ACR+ +C+NPC  + PCA+ A C V+ HK  C CP G TG+P   CV I   EC +D DC    AC++  C   C    PC   AIC  ID  PV    C C  G      S C         C  D++C  + +C+++ C DPC    CG  A C+   H+ +C CE+G +G+P + C ++ECR + DC     C     KC P+C   N PC   A+C A +HK  C C P L G+ +V C         ECR D DCPS  AC N  C +PC+ +NPC     C+         V+C C  GF   K   C     +  CRS ++C     C +  C+D C +   CG NA C   +        C C   + GN  + C P+        L+++       PPG  SD+E   Y  +CQ    +   ++ + C  D+   +  +     C CP   E  P   C P     + C  D DC   + C   N  C DPC    CG NA      H+ +C C  G+ GNP   C
Sbjct:   29 CAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEGDPFIACE------VIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCF------AIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECV----VTDHEVNCECPPGFEGSKGTSCRR--AEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNE--GYCVRCQTE--LGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIP----ILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 2290          

HSP 30 Score: 301.597 bits (771), Expect = 2.414e-81
Identity = 224/643 (34.84%), Postives = 310/643 (48.21%), Query Frame = 0
Query:   36 VNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGDAYSNCSPIN-------EDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKP----VCMCPEGLAGDPHAFCYEFE------CKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVGGTCLNSCR-VHPCGPNAQCIASS----HRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPCSRNT--CGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEK-CGENAECSPRNHRATCKCNKGHKGNPYSYCNAYE--CLSDPECPDHLHCISEKCVDPCK----CAANAECDARN----HRGYCACIIDFTGD 643
            VNPC   NPC   A CSV+NH   C+C  G+ G+   +C+P         E EC  D DCP + AC+  +C +PC    PC   AIC   +  P    +C C EG   D    C   E      C  ++DCP   AC+  +C+DPC    CG+ A+C VE H  +C CP G  G+P +SC+ V C+ ++DC D   C   +  C   C+    C   A C    H+  C C P   GD +  C  +V+      C  D++CP   AC S+ C NPC+   PC+   EC V +  PT    C CP     +    C  I +  EC  + DC  +  C+  TC   C+ ++PC   A C            C+C  GY      SC+ +      P+  GC ++ +C    SC N++C +PCA    C  +A CRVINH+PVCTC +GY G+P   C    + ECR+D DC D  AC  ++C   C      CG  A C   +H+A C+C  G  GDPY  C    CR+D +CP  + C N  C +PC  +  C E +EC   +H   C+C  G +G+  + C   E  C SD ECP    CI+++C+DPC     C  NA+C   +        C CI  + G+
Sbjct:    2 VNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPC---DCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMC--IDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIAC--EVIG-----CRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPT----CRCPVGYTGNPRVACVPIPAP-ECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTL-----PPILSGCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPVCTCEDGYEGNPDVACI---KIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGN 1843          

HSP 31 Score: 301.212 bits (770), Expect = 3.486e-81
Identity = 268/802 (33.42%), Postives = 355/802 (44.26%), Query Frame = 0
Query: 5878 VDPC----KCAKYADCKVTNHQGYCTCNSYYTGDPYGLAXXXXXXXXXXXX---XLDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDXXXXXXXXXXXXKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQKCVNPCD-TTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEI---ECKSDIDCNTKEKCNLENYICVPL------CTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKP----QCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDV--VKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPCT-SIACGRNAECRVTK----HRALCSCRSGYIGDPYTICN-----EPG------------CKSDFECPQQQACLNRECQNPCHFEKCGVNAMCS------PKNHRGICSCIEGHKGDPYSFCKP-YECLIDSDC--PTNLQCNNEKCVDPC---KCARNADCEIKNHRGYCTCQSDFTGDPY 6622
            V+PC     CA  A C V NH   C C   + G+P           +         D DCP   AC+ + C+NPC+  SPC   A C V ++LP RT+ C+C +G+    D KC  VE   E GC  + D     ACI RQC  PC     C S A+C V +H  +C CP G  G+P  SC P+    C+ D+DC + + CID  C +PC V  PCG+ AEC   +H+++C+C  G  G+P   C    C+ + +CP +K C  + C+NPC     C  NA C    H+  C CP G  G+P V C  I   EC  D DC +K  C   +  C PL      C DP +C V  +  +     TC        DGY   T+    +  P     C  D +C +  SCI+  C+DPC     C     C V N  P+    C C      + +  C    IK EC+VD DC  +  C++  C   C      CG  + C    H+ATC C  G  GDP   C  I           C  D DCP   AC N  CI+PCA+  PC   ++C V  H+  C CP G+ GS  T C+   +  C  D ECP   ACI QQC++PC+ +  CGRNA+C+V         +C C +GY G+    C       PG            C   +    +  C+   CQ    F   G   +C       P      C C    +  P  +C P  EC +D DC  P   +  N  C DPC    C  NA      HR  C C   + G+P 
Sbjct:    2 VNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD----CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVG---CQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHAC--LDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCP-------DGY-VSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPV----CTCEDGYEGNPDVAC----IKIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAI----------ECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRR-AEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCV--RCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPL 2281          

HSP 32 Score: 295.434 bits (755), Expect = 2.239e-79
Identity = 257/796 (32.29%), Postives = 335/796 (42.09%), Query Frame = 0
Query:  499 RNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCE----------EPGCRNDFECPDTQTCINRECQNPCL-FEKCGENAECSPRN----HRATCKCNKGH------KGNPYSYCNAYECLSDPECPDHLHCISEKCVDPCKCAANAECDARNHRGYCACIIDFTGDPYGXXXXXXXXXXXXXXXXXXDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIID---VGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQN----HRALCKCPPGFATDSQSNCYEYE-----CLRNSDCPFDKACVSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVECKRHEDCGDQEKCNLISLKCEKLCS-GRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECEIANDCKISDICVSGSCIDACKV-NPCGVNAICKSAS----HDSRCSCPNGYTGNPSHECYFVS--PTSEPLLT---------PGCRNDDDCPTYSL-CKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRPHPEC--------PDRLKCENEKCVDPC---ECARNADCDARNHRGICTCIPDFTGDPY 1232
             N C  +A C V+NH A C C  G+VG+P   C           EP C  D +CPD   C+N  C+NPC+    C   A C+  N        C C +G       K  P    N   C  D +CP+   CI+ +C+DPC C + A+C   +HR  C C   + G+P         +   E V C  D DC  ++ CI  +C NPC V  PC   A C            C CI GY G         +P I    +GCR D EC  N AC ++ CINPC     C  +A C V  HK  C C VG+TG+    C+ I   EC  D DCP   AC+ + C   C     C + AICT  +       +C CP G+ +   S+C         C  + +C    +C+++ C +PC    CG  A C V  HKP+C C  G +G+P + C  +EC+  +DC D   C   + KC  +C  G   C   A C A +H+  C CPP L GD Y +CF  E  SDK       DCP   AC +  C  PC    PC +  EC V D      V C CP          C R +    C    +C     C++  CID C V +PCG NA C+           C C  GY GN + EC  V   P    L+          PG  +D++   Y + C+  +          C              C CP      P   C P  EC        P   +  N  C DPC    C  NA   A  HR IC CI  + G+P 
Sbjct:   20 ENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNP---------QISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPAS----HKAMCRCIPGYEG---------DPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA---CGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHACR--NEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDK-------DCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCRRAEIG--CRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNE--GYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPL 2281          

HSP 33 Score: 293.893 bits (751), Expect = 6.148e-79
Identity = 253/815 (31.04%), Postives = 353/815 (43.31%), Query Frame = 0
Query:  226 CISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREK---VVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTE--CENNNDCGDQDVCVGGTCLNSCRVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPC-SRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVC---EEPGCRNDFECPDTQTCINRECQNPC-LFEKCGENAECSPRN----HRATCKCNKGHKGNPYSYCNAYE-----CLSDPECPDHLHCISEKCVDPCKCAANAECDARNHRGYCACIIDFTGDPYGXXXXXXXXXXXXXXXXXXDKDCFSQEACISEECDNPCT-VYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTA-----------------QNHRAL---------------------CKCPPGFATDSQSNCYEYE-----CLRNSDCPFDKACVSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNV-ECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSC 976
            C+    CAPSA C    H   C+CPP   G+    C  K   VV   +PECY D DCP   AC++E+C+NPC+   PC +T  C V++S P RT+ C C +      + +C  +E   E  C  ++DC +   C+   CL+ C    CG  AQC    HR  C C  GY GNPQ SC+ +          GC S+ DC     C +  C+NPC    PC  +A C   +H+ +C C  GY G P   C       CR D++C  + AC  + C+ PC   N C  NA+C V  H+  C C  GY G+P   C     P C  D +CP    C++  C+  C     C + A C+  +        C C  G+     S C         C +D EC +   CI++ C DPC C  +A C   NH+  C C   + G+P         +    ++EC  D DC    AC +E+C   C    +PC   A C           TC C  G  G     C  IE      CRSD++C  + AC N  CI+PC  +  C   + C V +H++ C C  GF G   + C +   G C+ D +CP   ACI+ QC DPCS    CG NA C                   Q + A+                     C CPPG+ +D++  C   +      L  + C     C S + + P ++   GTR           C CP  ++  P   C  + EC+  +DC D + C L +  C   C  +  C  +A   A+ HR  C C    +G+  + C
Sbjct:   11 CLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPV----------GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVI---GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCACGDHAFCRVINHKPVCTCEDGYEGNP---------DVACIKIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAIS----HKATCACPPGLEGDPYVTCFAIE------CRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIG-CRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQC----ICDSARGLVPSQD---GTR-----------CVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCV-KWPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 2290          

HSP 34 Score: 293.893 bits (751), Expect = 6.254e-79
Identity = 262/852 (30.75%), Postives = 365/852 (42.84%), Query Frame = 0
Query: 5766 CGINARCRVKRHRAICVCLENYIGDPYSVCK----------EAGCRSDYECPSDKACINRECQDPCL-LEQCGENAECLVNN----HEARCKCLSSFKGDPYVKCRSYE------CLVDSDCPRHLACENEKCVDPCKCAKYADCKVTNHQGYCTCNSYYTGDPYGLAXXXXXXXXXXXXXLDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDXXXXXXXXXXXXKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATN----HRSVCKCRKGLIGNPHSQCYSYE-----CKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIECKSDIDCNTKEKCNLENYICVPLCTDPKL-CAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDVVK-CGYNSECK----QSFHQATCQCTRGYTGDPLKEC----------NLIIPLQEASINPGCSHDDDCPGH-----TACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKAC--IQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNR-ECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGD 6563
            C  +A C V+ H A C+C   ++G+P   C           E  C +D +CP D AC+N  C++PC+ L  C   A C V N        C C   +  D   KC+  E      C  D DCP   AC N +C+DPC C   A C V +H+  C C   Y G+P             V C+ D DC  +  CI+ +C NPCL+  PC   AEC            C C+ GY G     C  +      GC+ +++   N AC  + C +PC  +NPC+  A C V  H   C CPVG TG+P  +C+PI   EC  D DC +  +C+D+ C+  CK   PC   A C   +       +C C  G +    S C +       C T+++C     C+ + C +PC    CG +A C+   H+ +C C  G +G+P V C +IEC+ D DC     C   N  C P+C      C   A C   +HK TC C P   GD Y  C   E       C+ D DCP   +C ++ C  PC +  PC    +C V++      + CECP     S+   C + +I   C+ D +C     C +  C++ C V   CG N++C+           C C  GY G+   EC           LI+   E  + P   + D+  G+     T    +   N C  D    +          + C CP      P   C +PI  EC  D +C D K C      C +PC    CG NA    T HR +C C  GY+G+P T     GC      P   A  NR + Q  C  +   V       N +G+   ++GH  D
Sbjct:   29 CAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNP-------QISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECY----PASHKAMCRCIPGYEGDPFIACEVI------GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPC---ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIE-------CRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCRRAEIG--CRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDN-EGYCVRCQTELGFVLIGNQCICDSARGLVPS----QDGTRCVCPPDMELGPDGYC-IPIL-ECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLT-----GCSPIPTPPPVPADFNRPDLQVNCLADGVLVQINLRDDNFKGVMY-VKGHSND 2440          

HSP 35 Score: 289.656 bits (740), Expect = 1.185e-77
Identity = 248/799 (31.04%), Postives = 363/799 (45.43%), Query Frame = 0
Query: 6013 TSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPIST-------GECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATN----HRSVCKCRKGLIGNPHSQCYSYE------CKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDVVK-CGYNSEC----KQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPC--TSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHFEK-CGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYE--CLIDSDCPTNLQCNNEKCVDPCK----CARNADCEIKN----HRGYCTCQSDFTGDPYGISCDPIPE-PVLVEYECIEDKDC---PSNQACIDTECI--NPCLTYEPCADKATC-KVYDTLPLRTMT-CSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGN--CVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTC 6766
             +PC  +NPC+ +A C V NH A C CP G  G+P  SC P  +        EC  D DC +  +C++ +CE+PC   +PC   A C   N       +C CR+G + +  ++C   E      C  ++DCP    C+ ++C++PCD   CG+ A C  E H+ +C CP G  G+P ++C+ + C+SD DC  ++ C   + +   L  DP  C   A C   +HK  C+C+P Y GD +  C       +   C+ D +CP   +C    C +PC    PC    +C VS   P    TC CP     +    C  I    EC  D DC     C D  C   C  +  C   + C            C C  GY       C  + P+       GCS DD+C    +C N  C +PCA    C   A C+V++H+ +CTC DGY G+P   C   I+ EC  D +C D  AC  ++C   C   +  CG  A C    H+A C+C  G  GDPY  C    C+SD +CP  +AC N  C +PC  +  C   + C   +H   C C  G +G   + C+  E  C  D++CP+   C N++C+DPC     C RNA C++ +        C C + + G+   I C P+P  P        E++ C   P   +  +  C+     L +    ++  C      +P +  T C C        D  C+   PI+   C+ D+ C     C   N  C +PC+   PCG  +      H+ +CKC  GY+G+P + C
Sbjct:    2 VNPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD---CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVGCQSDNDCRDRDMCIDGDCVNPCLVQDP--CGRFAECYPASHKAMCRCIPGYEGDPFIAC-------EVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKP----TCRCPVGYTGNPRVACVPIP-APECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILS-----GCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPVCTCEDGYEGNPDVAC---IKIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGN-AAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCI---PILE--CELDDDCLDPKYCELANNTCGDPCVK-WPCGPNAYGTATGHRCICKCIEGYVGNPLTGC 2290          

HSP 36 Score: 284.648 bits (727), Expect = 4.902e-76
Identity = 271/839 (32.30%), Postives = 370/839 (44.10%), Query Frame = 0
Query: 7959 NPCLYDE-CGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYE----------CLYDPDCPDHLTCKNEKCVDPC----QCAKYAECDARN-----------HRGIFPE------PVEVE---GCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEY---ECLRDNDCPLNKACVSQKCTDPCLTTD-CGIKAKCKT----EYHRGICVCEEGLQGSPFIECKEVECRKE----RDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRN-PCLPSETCLXXXXXXXXXXXXXCREGFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDACRIR-LCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPL----CRCPEGFEGDPSIECKP-PT-PLSIGCSADSD----CP-----------------VVEACLNTKCVDPCNCGENALCRKINHKAVCFCPSGFSGNPEVLC-EKLECTSDEDCSNDKMCH--ENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDVECAINEDCNSERACYQDKCIDPCVL 8718
            NPCLY+  C  +A C  ++H A C C  G  GNP V C P E          C  D DCPD   C NE+C +PC     C   A C   N             G  P+      PVE+    GC  D DCP+  ACI+R+C +PC     C   A+C V +  P+    C C  GY G     CE       VGC +D DC     C + +CVNPC    PC + A C    HK+ C C PG  GDP+  C +I    C QD++C  NKAC   +CI+PC+ + PC +NA C   +H+P C+C  G  G+P   C      EC+ D DCP   AC+   C   C T + C   A C           IC C +G     ++  ++  CR        C T+++C  +      +C     C + A C   NHK  C C+    GN  V C   +K E   CR+DDDC   HAC N KC+  C   N PC    TC    ++ S   +C+C  G        C  +    ECRS  DC  ++ C +  C+  C I+  C   + CV  +HE  C C   F G+   +C             GCRSD+ECP+   C N +C+DPC V DPCG++A C+V   +P+    C C  G++G+ +IEC P PT P   G   D +    CP                 +    +  +C+  C+     +  +   +  C CP      P+  C   LEC  D+DC + K C    NTC +PC+   PC  N     + H   C+C     G+P + C  +        +  R   Q  C+   VL
Sbjct:    5 NPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPC----DCGSGAQCFVEDHRPV----CVCPPGYVGNPQISCE------PVGCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIG---CRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDG-----YVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCACGDHAFCRVINHKPVCTCEDGYEGNPDVAC---IKIE---CRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATC----TAISHKATCACPPGLEGDPYVTCFAI----ECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSC--------RRAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCI--CDSARGLVPSQDGTR--CVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKW-PCGPNAYGTATGHRCICKCIEGYVGNPLTGCSPIPTPPPVPADFNRPDLQVNCLADGVL 2374          

HSP 37 Score: 258.455 bits (659), Expect = 9.444e-68
Identity = 226/702 (32.19%), Postives = 315/702 (44.87%), Query Frame = 0
Query:    1 MACTCIEGYE-------EPIIAS---GCQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGDAYSNCSPINEDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPC-KSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEV---ECRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYK----HRETCVCPPPLTGDGYSYCREKVVSILKP---ECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVGGTCLNSCRV--HPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPCS-RNTCGVNAQCRVKN----HRAICSCLSGYVGDPYSVCE-----EPG------------CRNDFECPDTQTCINRECQNPCLFEKCGENAECS------PRNHRATCKCNKGHKGNPYSYC-NAYECLSDPECPDHLHC--ISEKCVDPC---KCAANAECDARNHRGYCACIIDFTGDPY 645
            M C+C EG+        +P+      GC  DD+C +  AC NR C++PC     CG  A+C V +HR  CVC  G+ G+   +C P+    C+ D+DC   + C+   C++PC    PCG  A C   SHK +C C  G  GDP   C    C+ + +CP  KAC  + C++PC     C  NA+C V  H   C+CP G  G+P ++C  +   EC  + DCP    C   +  C+ LC +   C   AIC            C CP     DGY    +     L P    C  D +C +  +CI++ C++PC     C     C+V++  P     C C      + +  C +I    EC  ++DC D   C    C   C     PCG  A C A SH++TC+C  G  G+P  +C  I+          C S++DCP+  +C N  CI+PCA   PC   + C V +H+  C CP G+ GS  T CR + E  CR D++C    ACI QQC+ PCS  + CG NA+C+V +       +C C++GY G+    C       PG            C   +   +   C+   CQ    F   G    C       P      C C    +  P  YC    EC  D +C D  +C   +  C DPC    C  NA   A  HR  C CI  + G+P 
Sbjct:  293 MICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCD----CGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPVG---CQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPASHKAMCRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHAC--LDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCP-----DGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPCA----CGDHAFCRVINHKPV----CTCEDGYEGNPDVACIKI----ECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTCFAIE----------CRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCR-RAEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCV--RCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPL 2281          

HSP 38 Score: 243.432 bits (620), Expect = 5.010e-63
Identity = 201/590 (34.07%), Postives = 257/590 (43.56%), Query Frame = 0
Query:    3 CTCIEGYE-EPIIA---SGCQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGDAYSNCSPINEDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPV----CMCPEGLAGDPHAFCYEFE-----CKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCNLNNFKCEELC-ISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVGGTCLNSCRV-HPCGPNAQC----IASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPG----CDSNQDC---PTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGS---------PTTDCRPQ----PEPECRLDSDCSDHLAC--IGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRN----DFECPDTQT 547
            C CI GYE +P IA    GC+ D EC  N+ACR++ C+NPC   NPC   AEC V  H+ TC C +G+TG+    C PI   EC  D DCP  +AC+   C   C+   PC   AIC      PV    C CP+G      + C         C  +++C    +C+ + C DPC    CG +A C V  H  +C C  G +G+P ++C ++ECR +DDC D   C   N KC  +C   +  C   A C    H+ TC CPP L GD Y  C          EC  D DCP   AC +  C +PC +  PC    EC V D      V+C CP     S    C R E    C ++ +C  Q  C+   C++ C V  PCG NA+C            C C  GY GN       I+ T      PG     D N+ C   P Y S     C+        C       +I +Q +C    G + S         P  +  P     P  EC LD DC D   C      C  PC +  CG NA      HR IC C+ GYVG+P + C           DF  PD Q 
Sbjct:  671 CRCIPGYEGDPFIACEVIGCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVACVPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPILSGCSTDDECGESDSCINKICKDPC---ACGDHAFCRVINHKPVCTCEDGYEGNPDVACIKIECRVDDDCLDTHAC--RNEKCRPMCGPGNAPCGGEATCTAISHKATCACPPGLEGDPYVTC-------FAIECRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTD----HEVNCECPPGFEGSKGTSCRRAE--IGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGN-----AAIECTPVPTCPPGRGLILDENEQCVCPPGYYSDNEGYCVR-------CQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVKWPCGPNAYGTATGHRCICKCIEGYVGNPLTGCSPIPTPPPVPADFNRPDLQV 2350          

HSP 39 Score: 238.424 bits (607), Expect = 1.635e-61
Identity = 241/813 (29.64%), Postives = 341/813 (41.94%), Query Frame = 0
Query: 1403 NPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCF----------KYECQKNEDCPFDKSCSSNNCIDPC-QNTVCGRNAECSV----EYHKSICKCPSGLQGSPYVACKEVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINAC-KSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINXXXXXXXXXXXXRCKVINHEPE----CTCPDGFIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCKEDRDCPSQNACINEECDNPCL-MYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKISNSECKYDTDCASNEACINDQCVDHCVVNLPCGKDAECETIR----HRSVCKCPKGLAGDPHVSCYSF-ECKKNEDCPFDKECKSESCVDP----------CI--DTQCGTLAT---CTVEYHKGI--------CKCSSGYQGNPYLSCREV-QCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCN 2165
            NPC   + C  +A C V NH+  C C   + G+P  SC           + EC  + DCP D +C +  C +PC   + C   A C+V     +   IC C  G        CK V+   +  C +D+ C        + C +   C + A+C    HR  C+C   Y G+    C+ +        C  D DC  +  CI   C NPC + +PC    EC  A    S    C C P    + F  C+ +     C+ + +CP    C    CIN C    PC  NA+C    H   C C  G+ GNP+  C        PI  P C  ++DCPS  AC D  C   C   +PC   A C VI+  P     CTCPDG++ +  + CR   P        C +D EC +   C N+ C DPC C  +A C   NH+ +CTC   + G+P  +AC         ++EC+ D DC   +AC NE+C   C     PC   A C           TC C  G  G     C  I+      CRS+ +C    AC N  C++PC   +PC   ++C V +H   C C  G+ G   + C + +   C+ D +C S  ACIN QC+D C V  PCG++A+C+ +        VC C  G  G+  + C     C        D   ++E CV P          C+   T+ G +     C  +  +G+        C C    +  P   C  + +C  + DC   + C L    C   C K   C  +A   A  HR  C C    +G+  + C+
Sbjct:    5 NPCLYENPCAPSATCSVQNHNAKCMCPPGWVGNPLVSCTPKESPVVPDPEPECYTDGDCPDDTACLNERCENPCIALSPCDVTAICTVVNSLPFRTMICSCREGWVPDTDTKCKPVELPNEPGCARDDDCPNGAACINRQCLDPCDCGSGAQCFVEDHRPVCVCPPGYVGNPQISCEPV-------GCQSDNDCRDRDMCIDGDCVNPCLVQDPCGRFAECYPA----SHKAMCRCIPGYEGDPFIACEVI----GCRQDAECPLNKACRSKDCINPCLYENPCAKNAECLVSEHKPTCRCPVGYTGNPRVAC-------VPIPAPECVEDKDCPSKHACLDSTCKPLCKTLNPCNDPAICTVIDSLPVRTMICTCPDGYVSTEDSSCRTLPPIL----SGCSTDDECGESDSCINKICKDPCACGDHAFCRVINHKPVCTCEDGYEGNP-DVAC--------IKIECRVDDDCLDTHACRNEKCRPMCGPGNAPCGGEATCTAIS----HKATCACPPGLEGDPYVTCFAIE------CRSDKDCPSDKACFNNHCISPCAIQNPCKEPSECVVTDHEVNCECPPGFEGSKGTSCRR-AEIGCRSDAECPSQTACINQQCIDPCSVADPCGRNAKCQVLDTLPVRTMVCVCITGYQGNAAIECTPVPTCPPGRGLILD---ENEQCVCPPGYYSDNEGYCVRCQTELGFVLIGNQCICDSARGLVPSQDGTRCVCPPDMELGPDGYCIPILECELDDDCLDPKYCELANNTCGDPCVK-WPCGPNAYGTATGHRCICKCIEGYVGNPLTGCS 2293          
BLAST of EMLSAG00000008211 vs. C. finmarchicus
Match: gi|592769105|gb|GAXK01185463.1| (TSA: Calanus finmarchicus comp321180_c3_seq2 transcribed RNA sequence)

HSP 1 Score: 1226.08 bits (3171), Expect = 0.000e+0
Identity = 1574/5758 (27.34%), Postives = 2209/5758 (38.36%), Query Frame = 0
Query:   21 DDECDSNQACRNRVCVNPCTNS---NPCGVLAECSVRNHRTTCVCTIGFTGDAYSNCSPINE-------DECRYDSDC---PLNNAC-----------MKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKC--NLNNFKCE----------ELCIS-----SGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVGGTCL---------------NSCRVHP--CGPNAQCIASSHRSTCSCSRGYTGNPQD---------------------------SCQRIQVTGATPLQPGCDSNQDCPTYSSC-RNRLC-------------------------INPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACI------------GQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPYSYCN----AYECLSDPECPDHLHCISEKCV----------------DPC---------KCAANAECDARNHRGYCACIIDFTGDPYGXXXXXXXXXXXXXXXXXXDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQ-----------ECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSP---------------------ECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDC----PTYSLCKNTMCINP----------CAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRPHPECPDRLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGK----CIXXXXXXXXXXXXAICRTQNHQPTCECSPGFTGDPYSLCSP-TREDECKHDEDCPSNMVCADN-----KCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKY----ECQKNEDCPFDKSCSSNN-----CIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSP--YVACKEV---QCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCIC-SSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSC--ISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVN-----------------------------GFG-NCKRVETATECQS-----------NNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINXXXXXXXXXXXXRCK----VINHEPECTCPDGFIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCENEKCVDPCE----CARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGK---GDERCVKIQPVVDV----GCRSNSECSPTLACRNGEC---------------LNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKISNSECKYDTDCASNEACIND-----QCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPH--VSCYSFECKKNEDCPFDKECK--SESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVER-CGINAECIANFHRSKCSCYPGYLGDPKNACYQS---------PTEIE---PLLSPGCDVDRD---------------------CPSYTMCKNRLCI----------------------------NPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTN--------------------------CQPPERPECRVDAECPLDRACIHQKCQNPCS-RLTCGKNADCKVNNHRAICTCLKGYNGDPYSLCKL--SGCESDFECPNHQACINRECQNPCLF-EKCGXXXECKXENHRAICH----CLSGH---KGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPCE---CARNADCKARNHRGYCTCIPNFTGDPYGXXXXXXXXXXXXXXXXNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKD-NPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCS-------LNEICGKGAICENRNHRSVCK----CPRGFSGDPHSYCYKYECKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREV--ECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCV----CPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIV-NKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTCRKTCSI-NSCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQC--------INPCSIGSP---------CAKSAICKPINHKAVCTCLDGFV-GTPSTDCRPINVPECLLDAECPDHLACINRKCQNPCST-LTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQP-----------VVDVGCRSNSECSPTLAC--KNGECINPCIENNPCGTSAQCKVKRHEANCICPAGY--NGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCE-CPNGLQGNPYIFC-KEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCI------------CPPPF---------EGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINP--CSENQECKAFASVPLRTVSCICPQG---------TF------------IGSNGICQEVETKVECEYNDDCSTNDIC---QDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGN-AQVACYLPITPNEPSLVPGCTSDQDC------------PSYTACRNRQCINPCA----------EDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRV-QNHRAICSCFGGYVGDPYTACEEPGCKSD----FECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPCECARNADCDARNHRGICTCILDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCYRYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLP-----------------------------------------IEPAIEPECRVDQDCQSVFACIRDKCTDPC-----------------------------FTN--------------------NPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPYECLSDPECPNHLKCKNEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCV-----------------------------------------------PASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCP-SGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFC 5100
            D +C  N     + C  P  N     PC V A C+       C C  G+ GD + NC  I+E        +C  +++C   P    C           ++ + ID C  +  CG  ++C   +    C C EG AGDP+  C +                     + C S  CG  AKC  +Y   +C+CP G +G PY SC  ++   +  C  NAKC  +  +++CE          + C+         C  +A C   +    C C   LTGD ++ C +        EC   S              NPC     C  T    V          C CP     + N  C   E +T C++N DC +  VC  G CL               + CR  P  CG NA C  +    TCSC   + G+P                              C+         +  GC    +C    +C  N LC                         I+ C     C    TC  +     C CP+G +  P           C+ ++DC  +  C             G  C +PC    C  N+QC + N +  C C  GY         +P  +    C D          N CL + CG+ A C        CKC  G  G+P   C     A +C     CP    C   KCV                D C          C  NA C        C C   + G+P+    +        +    +D      E CI   C N       C E A C    T+      C C  G+  + D  C  I+  +                         +T   CGF A C  K     C C +G TGD YS     +Q +C  D+DC  N+ C+                            C CPP F +D+                        KC +PC+  +CG  A+CS   + P C C  G  G P   C +V+      CG + +C                     + EA ++  KC CP    GD Y +  K   PS + EC  D++CPGLL+C +  C +PC+ + PC ++             CKV     ++          + G++ +C    T P                      C  AN C     C+SG C + C    CG+NA C   ++  +C C  G+ G+ +  C  + P   P+ TPGC +   C    P   +C +    NP            +D  C   A C     + VCTC  G+ G+P   C    EC +++            C +NA C        C C  D+ G+P+                      C  +   I + C       K C  NA C V          C C+ GF G  ++     +      C +N +C  N  C + K    CI     N  C  ++ C T NH  TC C  G++G+P  L     RE  CK   DCP+  VC+ N      C +PCR  S CG   +C V N+ P C+C      +P +   +      C  +  C  D+ C  ++     C   CQ   C +N++C    H+  C+C  G  G+P     C  +   QC  D  C ++E C L    C   C N+ VC   A C    H  +C C    + GD        V+      C  + DCP    C  +S TC + C+ +  C  +  C      P     C CPP T  +                             GF  +C + +     +S           + DCPD  +C RG C N C    CG N +C+     + C C  GF  +P      A   +   +  GC  + DC   + C+  +C   C   + C    +C     +I+      CP   + S             C    C ++  CP    C + KCV+PC+    C  NA C        C+C   F G P      P    V     C   + CP Q+ C    C   C +   C +                  C++G   K    D+ C++ +  +D     GC    +C P   C+ G C               +N C EN  C  +A C  +  + KC C  G  GDPY++  K  N EC  + DC    AC  D     +CV+ C     CG +A CE  +H+  CKC     G+P   + C   EC+KN DC  DK C+  +  C+D C    CG   TC+   H   C+C  GY               N+ C   ++C            +N+ C  +A+C       +C CP   + D +  C          +CL D+D  ++ AC +  C+NPC +   C     C       +    C C   T      +C+ +    EC  ++DCN +  C    CV+ C +   CG N  C A  H ++C C PG+ G+P   C Q          P+ +     + SP C   RD                     CP    C+N LCI                            + CA    C   A C  + HK VCTCPDGF G P+                             QPP    C  D  C  +  C   +C++PC  + +CG NA C V +HR  C C + + G+P   C    S C S  +CP    C +  C  PC   E C     C        C     C  GH        V C+      +SDCP    C+N++C DPC    C  NA C+  +HR  C+C P F  +P      P+   V +   C+ +  CP +  C  + C + C   K C++N  C      PL      C         E C  +  ++  GCRS S C   L C +  C +PC      C  +A CSV +H+A+CSCP G  GDP   C+  +   C+    C++   C+   C+  CS       LNE+C KG        R +C     C  G+      +C    C +D+ C  ++AC   +C DPC  + CG  AEC    HQ+ C C     GNP + C  +   C   +DC   ++C+     C   C  ++ C     C +   ++ C     CP      G             P C  D DC     C++ +CQNPC++ +  C ++  C+V N+ P+    C CP G   +   ECK +    EC+ N++C+  + C++G+C   C + N+CG +A C  + H  KC+C   Y G+PN  C   VL+    L   C  +  C       + +C         + C  G P         C   A+C      A+C C +    G P  +C      +C  D +CP   +C   KC +PCS    CG NA C V+ H+  C C   +IG PH  C   P           V  +GC+ + +CS   AC  +NG+C +PC   + C  + +C V  H+  C C      N      C P + +EC+   +C SN+AC N +C  PC   R C    EC    H++ C C      +P  S     C     CP  + C+  +C +PC+ T C     C  E HK  C+ CP G   +    C + V CR  ++C S + C  QN +C+  C     C    +CE +NH  RCI            C P F           D  +   E        +C I+ DC   K C     K  C  + P  C +N +C+     P+    C C QG         TF             GS+ IC+       C      + N      QDG     CR N+CG N+ C     R  C CL  + GN   + C  P+   +P+    C ++ +C            P YT   N   I  C           E  PC   A C V      C C  GF G+P   C                         QNPC+   CG N +C   +  + +CSC  GY GDP +   + GCK++     +C    ACI ++C +PC    CGI A C  +NH  +C+C  G  GDP+S C     +++P  P           +P  C  NA C  ++ + IC CI D+ GDP  I C         + EC    DCP   ACIN +C +PC     C  NAEC++ +        C C EG+TG    +C  I  +I+               E A+   P    +PCG  A+C +   R  CTC  G+ G P S      EC  +++C    ACIN +C NPC+    CG NA C    H P+C CP G  GDP S+C R   K +E  P  K        D C    CG  AI        +C CP GL G+PY+ C+  EC  + DC   + C  +  KC   C G+  C + A C+  NH   C C   + G+ +  C+ P                                           P   PEC V  DC    AC+  KC+DPC                             FT+                    +PC P   CK L   P+    C C +  YIGS   C       EC+++ +C  T  C +  C++ C    CG NA+C  + H+  C C  GY+G+P   CN     V PS  P                     PC+   PC   A+C+ V+    C+C  G++GSP  NCR    PEC ++ +C    ACI+QKC +PC    CG NA C A NH AIC+C   ++GDP++     GC    E          E  +PC    CG NAEC++      C C++ H GDPY  C+P ECL + ECPNHL C  +KC DPC   C RNA C  RNH  ICTC P ++GDP   AC+ IP               P Q   ++ +  +P     PC  N++ +  + +      C C    T +G     + E VV       S+C+   A   Q CV+PC     CG  A+CQVTNH   C C  GF GDP+S+CV                                               P    EC+ + +C  N+ C+  +CIDPC     CG +A+C+ +NH+P+C+CP G +G+P   C +    T        V T+E  +DPC+ + CG  A CR+      C C  G  G+PY+ C+  +C  + DC  N  C   N KC   C G   C   A+C A  H+  C C +  +GD  + C      VP  E                      +L DPC P+  C        +   CVC  S   IG   NC     RPEC    +C   + C + TC D C    CG NAEC  T H+ IC+C  G+ G+P   C   +P  E    P        P  T        +PC  D PC   A C+ +   + C+C  GY+G P     P  +PEC   +ECP +LACI +KC++PC    CG  A C V  H AVC C  GY GDP+  C
Sbjct:  499 DSQCHCNDGWGGKGCSMPDDNECKYRPCDVFAHCTNNIGSYACTCFPGYEGDGH-NCQDIDECTIPELAAKCVENAECCNLPAEYVCKCKPGFEGDGQVECRDIDECRESNACGANSLCSNFAGNYTCSCQEGYAGDPYTGCIDL--------------------NECLSNPCGAGAKCINQYGGYLCECPAGAKGDPYTSCGTLDQCQSKPCGLNAKCYNDGGSYRCECPQGFQGNPKQQCLDVNECLRNPCGQNAACINTEGSYQCACKQGLTGDPFTACSD------TDECSAQS--------------NPCGSNAVCRNTNPGFV----------CECPPGFSGNGNVACEATEVRTLCQSNFDCTNNAVCQKGECLCRSGFTAAGTLCLDVDECRSTPGICGANAVCRNTLGSFTCSCLTSFVGSPPSVPCSEPCKGVTCSQHAYCKAEQKDAYCVCEDGWTYDPKNIAAGCIDVNECGAPGTCGENSLCTNLPGSFICQCKPGYTGNPQVRCIDIDECKSVSTCGFGTTCENLPGSYKCGCPSGSVADPNNPAECISVKTCQKNNDCPGNAFCSPSKMCVCPEPNQGPNCESPCENVFCAANSQCTLINGQPRCMCHQGY---------QPAGQGKQGCIDI---------NECLGQPCGKGAFCENTPGGYRCKCPSGLSGDPNIACKGEIEAIQCSVSKPCPSGELCSQGKCVCQRGFQRESSGLCRDLDECTRASASEEPACGLNAFCKNLPGSFDCECPAGYNGNPFVKCSSCNGPDCGCQPPYSQDG-----ENCILAGCKN----KGDCSEGAECI---TIAGGVSYCACPSGFNVQPDGTCADIDECL-------------------------STSRPCGFGALCENKIGSFSCVCPIGTTGDPYSGVCSANQAQCSRDNDCRPNEKCV------------------------EPGQCICPPPFFSDTTD--------------------GGKCKSPCERFMCGINADCS-PTNPPQCLCKAGYNGDPIQGCLDVDECAQNPCGPEARC---------------------LNEAGSY--KCQCPKGTRGDPYLAGCK-GTPS-RVECTRDEECPGLLSCQASVCINPCS-SIPCGENAVCIPENHAAWCRCKVGYKENSEGKCTSMCDGVICGLNAQCIISPTGPTCACSKGTLGNPFPGGSCVPETCSGANPCPQPLSCISGKCRERCDSFSCGLNAACDGNTN--KCFCREGFVGDGNFLC--MPPILPPICTPGCGSHSHCAYGIPNQCICNSEFGGNPYEGCSPSTIDIVQDCKCGSNAECVTDGTSKVCTCKEGFDGNPFIGCFDINECTNKI------------CGKNAVCINTIGNYDCRCELDYKGNPF--------------------EACFPEQPTIADLC-----TEKQCGPNAVCSVGQ--------CLCLTGFKGDAEDLRTGCQSST---CSNNLDCGYNEICQSVKGQYRCI-DACGNVQCGPNSRCVTDNHHSTCICQDGYSGNPLDLSGGCVREVTCKTQNDCPTGSVCSINISGKRSCVDPCRIMS-CGKYEICSVKNNRPFCQCSPTHIRNPVTGQCEIASVPSCSNDGQCSEDQVCRPDSLGILRCTPICQLFTCPQNSQCRASNHQGFCQCFEGYNGNPNDRTGCSLISKDQCLSDAQCSEEEVCSLTLKKCIPAC-NTIVCGPQAVCITQNHSPQCTCPPGKFKGDP----NDPVLGCKAVSCLTNTDCPPTKFCDRLSYTCMDVCTADT-CGKNAVCLPEQQRPK----CSCPPGTKPDPLPEVRCSTLNACSKKPCHSSASCSSTTTGFSCSCPQGQVGDPNKSGCFPEGSCPNGDRDCPDKSICIRGMCKNICYDS-CGPNTECSINNRQAQCQCLQGFIPSPLD----ARTCIRDSQ--GCRKDADCIGGSTCQGGQCRYSCRGQNDCLVGEQCSDSMCMISCISSQQCPSSQVCS----------NGVCS-IGCRNNENCPSDEVCISFKCVNPCQQEGACGPNALCKVSGKNVQCSCPERFAGVP-----TPQQGCVRIPARCPNGK-CPPQHTCKGGMCHWQCQINANCAKGER---------------CLDGLCTKVCHSDKNCLQGEICIDSTCQPGCNKEEDCRPGEICQGGSCVCAIGFINTPAGCQDINEC-ENSICHPSANCANIPGSFKCTCPRGLVGDPYTKGCKNPN-ECTTNRDCGPQLACAGDGSGYRKCVNPC-DRAKCGTNANCEVQKHKPFCKCFDKHVGNPSSPLGCTKVECEKNTDCNGDKVCQVANNRCIDACNIVSCGR-GTCSATNHVPSCRCEPGYI------------FSNNQCVDIDEC------------QNSPCEPTAICINTVGAYQCQCPPGTVPDAFGRCR------SSDQCLSDNDCPKTAACNNGKCQNPCEIPGSCGADAICTPANHRPM----CSCPPRTNGNPQVRCVPL----ECVSNSDCNSERTCVRNKCVDVCSLPNVCGQNTNCRATNHIARCFCLPGFTGEPTLGCTQLQLCTVEEQCPSGMLCSFGICSPPCQSSRDCLDNQLCNGGSCISKCQDSTQCPPLHSCQNGLCIQESRCSNDVDCDEVDTCVGRENGLFECEDACAGPVICGRNAKCTSLGHKAVCTCPDGFFGDPNNEKIGCQKKQCLVNGDCPGDSVCDKFICTQPPVTGTCTNDRNCQANEVCDKGQCKDPCGIQGSCGINAFCSVQSHRKQCVCPQDFTGNPEVECVRIPSTCYSSSDCPQPMQCADGICMPPCSSDENCAINERCLQGLCMLTCRVDNDCFLGHVCLNKMCIVGCR-----ANSDCPESNTCINNRCTDPCRGDTCGPNAKCQVVDHRAQCSCPPRFIPNP-----TPVVGCVKQPQTCSSNAQCPERQVCDGKFCKDVCFNDKNCLVNEVCDNGICKPL------CRRDDDCNSQEICKGVTCVL--GCRSSSNCPNDLACINNQCTDPCSSSTTSCGNNALCSVANHQAVCSCPAGLTGDPTRGCRHPV-QVCSSSTQCRQGYKCVGGVCAASCSSSNENCLLNEVCVKGTC------RPLCNSNADCSDGYICK-ERFCVA-GCSSDSQCKENQACINSQCQDPCLSSSCGQCAECSVSNHQAFCSCPASSTGNPSIGCLPLTYTCGKSSDCGRGQRCEDGV--CVKKCGSSSSCECGKTCVSGQCRQECTSSVPCPQGHLCKGGTC---------LPGCIGDNDCSDQELCLAGKCQNPCLLESTGCAKSAECRVTNHRPV----CLCPQGLQGNPKIECKRI----ECRTNSECEHTKSCIEGSCVNLCLLPNACGISAQCKSIRHQKKCSCPQKYVGNPNIEC---VLDKNECLSSPCGENAICQDLVGGYDCKCKAGCTGDGFSGCICGGPLIDPCRNARCGLDALCTVGGGIALCVCPNNKPNGDPLVECTSEKEGKCRADFDCPSSQSCKKGKCVDPCSLRAACGVNAICTVRIHKPRCECPQCHIGRPHVRCRPDPSCNTLPTKPQIVEPIGCQGDKDCSLGTACNRQNGKCFDPCGSTS-CDFNKKCIVSNHKPICKCKYSLVVNQQGVLTC-PDRQVECRTHNECPSNQACDNGRCKSPCDNPRICPAGKECQVLEHKAVCIC--TTGCNPEVS----ICLKDRGCPRGQACIGYQCKNPCEGTTCPGNTPCIVEDHKAVCKFCPPGFTTDANYGCIQGVGCRSSSECPSKQAC--QNKKCVNPCGL-GQCGATQDCEVANHLARCIDVPRCECSSRRDCLPGFTCEDCECVKNPDVDATVCEPSEGDCFEQCTINSDCPEDKYCDRF--KRKCISVCPGFCGDNTQCRFVNHNPI----CSCKQGFNGNPDVGCTFNQPPSNPCIPSPCGSDAICELDNGNPICSCPRGKTGNPFVRCIQDGK---KCRGNQCGPNSGCRMIADRPVCYCLPRFEGNPPAIPCVKPMKQCKPNP---CGANTECVVVNNVQRCTCKPGYTESVNT--IQGCVLISEPVISLCEPGPCGDNAECLVNDLGEDCRCNAGFGGNPFQGCTP-----------------------QNPCNPSPCGPNTECNEDRAGQIVCSCRRGYQGDPTS---DQGCKAECLRNSDCSRALACIAQKCIDPCP-GTCGIFAVCEVQNHNPICSCPPGTVGDPFSRCTQQPVVTEPPRPKDP-------CNPSPCGTNAQCRQQSGQAICQCIRDYQGDPL-IGC---------KPECLLSFDCPQDKACINSKCKDPCPGT--CGINAECQISN----HNAICKCHEGYTGDPFAQCSLIPGVINPP-------------EPADPCQP----SPCGPNAECRIVESRPVCTCFPGYYGAPPSCRP---ECVINSECAPALACINLKCSNPCV--GVCGINAKCDVVNHNPICSCPQGYIGDPFSSCRR---KPDEIRPTPKP-------DICNPNPCGPSAIRKPRNGVCTCACPPGLFGDPYLGCRP-ECILNSDCNRLQAC--SNNKCVDPCPGT--CGTNAECKIINHIPTCGCRKGFTGNAFEECTKPKPVQPVEGKEDPCGGNFCGAYSTQRVQGNRCVCSCLPGYFGFPPNCRPECVVSSDCSQNLACLSQKCSDPCPGRCGVNARCHVISHHPICTCPPDYEGDPFTSCQKRPSTVTPPPKPSNPCYPSPCGPYSSCKPLRDRPM----CSC-NGGYIGSPPNCR-----PECLLSSECQLTKACVQQHCVDPCP-GTCGANAECKVVNHNPICSCPRGYSGDPFFNCNKDPEVVTPSERPH-------------------IPCVP-SPCGPNALCREVNGHEACSCVAGYIGSP-PNCR----PECVLNAECPSNKACIQQKCSDPC-VGACGYNARCTAVNHNAICTCPTGYTGDPFS-----GCSLVPEVIREPP----EIIDPCNPSPCGANAECSSRNRAGACRCIKDHIGDPYVGCRP-ECLINTECPNHLACSQKKCRDPCPGTCGRNAQCSVRNHNPICTCNPGYSGDPTS-ACQIIP---------------PPQPIEVDTDPCDP----NPCGPNSQHREVNGV------CVCACAPTYQGTPPNCRPECVVS------SDCNQLTACVNQKCVDPCPGT--CGNNARCQVTNHNPICQCPPGFTGDPFSNCVRVVVTQPPPRPQPVDPCNPTPCGQFSQCRNSNEVAACSCLPNYIGIPPNCRPECSINAECPSNRACVRERCIDPC--PGACGPNAVCKVQNHQPICQCPTGFSGDPFRDCRRVVIPTT-------VRTTEV-IDPCEPSPCGANAQCRSRQRAGACTCVPGYFGDPYLACRP-ECVMNTDCPTNRAC--VNNKCVDPCPGV--CGINAICNANRHQPICTCLNGYTGDAITQCSLIPTGVPVVE----------------------EL-DPCDPN-PCGAYSQHKEQNGVCVCSCSRNMIGSPPNC-----RPECLVSSECSQVTACMQQTCRDPCP-GLCGRNAECRVTNHNPICTCQRGYQGDPFTGCTK-IPVTERVTQP--------PRPT--------NPCQPD-PCGRYAQCKNVRGVAACSCLVGYVGVP-----PNCRPECLIHSECPSNLACINEKCRDPCPGA-CGAYAECSVIKHNAVCRCQQGYEGDPFSSC 15873          

HSP 2 Score: 1181.78 bits (3056), Expect = 0.000e+0
Identity = 1528/5667 (26.96%), Postives = 2163/5667 (38.17%), Query Frame = 0
Query:  932 LISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPEC---EIANDCKISDICVSGSCIDACKVNP---------------------CGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDD-------DCPT------YSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRPHPECPDRLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCIXXXXXXXXXX----------------XXAICRTQNHQPTCECSPGFTGDPYSL-CS-PTREDECKHDEDCPSNM-----VCADNKCSNP------------CRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYE--------------------------------------------CQKNEDCPFDKSCSSN------------NCIDPCQNTVCGRNAECSV-----------EYHKS-------------------------------ICKCPSGLQGSPYVACK----EVQCRKDNDCGQDEKCDLQRFTCTK--------LC-----------SNSNVCAANARCEASRHRERCICSSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDC-PSHAACKDRKCINXXXXXXXXXXXXRCKV--------INHE------PECTCPDGFIGSPTTDC--------RPRDPYSFCR-----------------PY-----------ECLSDPECPDHLKCENEKCVDPCE---CARNADCDARNHRGICTCIPDFTGD-----------------------PYGIACXXXXXXXX--------XXXXCKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVK--IQPVVDVGCRSNSECSPTL----ACRNGECLNP----------CIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCV------------------KISNSECKYDTDCASN--EACINDQ-CVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDP---HVSCYSFECKKNEDCPFDKECKSES----CVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPY-LS---CREVQCRRNSDCDSKEKCNLKT---YKCTPLCRKNNNCAESAVCKAENHREKCSC-PTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCK----NPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQC-ITVQSQNECSIDNDCNQDDMCYEGT--CVNACYVERCGINAECIANFHRSKCSCYPG-YLGDPKNACYQSPTEIEPLL---SPGCDVDRDCPSYTMCKNRL---CINPCAEDSPCAVTAICKVIQHKP------------------------------------------VCTCPDGFIGSPSTNCQPPERPECRVDAECPLDRACIHQKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDPYS----LCKLSGCESDFECPNHQACINRECQNPCLFEK-CGXXXECKXENHRAICHCLSGHKGQAYVNCKR----YECLRDSDCPNHLHCVNDKCVDPCE----CARNADCKARNHRGYCTCIPNFTGDPYGXXXXXXXXXXXXXXXXNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTGK---GDERCVKIEPIIET----GCRSDSECDRKLGCRDGDC---------------INPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYS-FCKKILTHECNYDNDCQRTQACIEN-----QCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHS--YCYKYECKTDNDCPFDKAC--AKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTCRKTCSI-NSCGANAVCTPVIHGFKCNCFDGYTGDPNSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRP---INVPECLLDAECPDHLACINR-----KCQNPCST-LTCGDNAQCRVQRHRAICTCLSGYIGSPH--------------------TVCEE----QPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKY---ECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPY--------------------------IFCKEV--------------------ECRKDTDCASNEKCNLQNFRCLRLCSDNNN----------------------CAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINP-CSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCT----CPDGFIGSPTNDCKKPI-VPECLSDPECPDHLACIQQKCQNPC--SSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFEN-CGINAECSPENHRAVCACLKGHKGDPYSFC--KPYECLSDPECPNHLKCENE------KC------------------VDPCECAR---NADCDARNHRGICTCILDF-TGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERC----------VKIEPIIHTGCRSNTECAVSLAC--ENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHA---HQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSN---------AICI---------------------------------------------TEIHRPVCK-CPPGLAGDPHSTCYR-YECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQS------SCKCPAGLQGNPYINCKELECRK----------------------HQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGD---GYSFCSLPIEPAIEPECRVDQDCQ-----SVFACIRDKCTDPCF---------TNNPCLPLQECKVLNSSPL-----------KTVSCICPSDM----YIGSSGQCERVEGTSECIVNEDCTSTDVCYEG------SCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIA----------------------------MVHVEPSLEPGCS----YNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPYECLSDPECPNHLKCKNEKCVDPCE---CARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPC--ACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTK-----------------------------------------------ECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQITIQT----QAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQLPQKPECTKDSECANHLACIQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEA 5798
            L   K EKLC G++ C   +     N +E       L   G+       + S   +C+ +D   G    M +   + C + +PC     C    T+   + AC C      G +G  +  Q   EC   E+A  C  +  C +      CK  P                     CG N++C + + +  CSC  GY G+P   C  ++         G +  +       +CP       Y+ C     ++ C +  PC   A C     +  C CP G+ G+P   C    EC                C +NA C        C C    TGDP+                C++  +C +Q+               PC  NA C+  +T P     C C  GF+G G+  C   E  V   C+SN +C  N  C  G+C+         +                ++A+CR      TC C   F G P S+ CS P +   C     C +       VC D    +P            C +   CG N++C  +  S +C+C   + G+P   C   +                                            CQKN DCP +  CS +            NC  PC+N  C  N++C++            Y  +                                CKCPSGL G P +ACK     +QC     C   E C   +  C +        LC           S    C  NA C+       C C + Y G+ +  C     P    +    +D     +CI   C+N       CS   EC    T+      C CP    V   G C  ++   EC S                    SRPCG  A C  +  S  C C  G  G+P S        V    +  C  + DC P+    +  +CI P    S      +CK         IN +      P+C C  G+ G P   C         P  P + C                  PY           EC  D ECP  L C+   C++PC    C  NA C   NH   C C   +  +                       P G  C      +             C     CP   +CI+ +C   C  +  C  NA C         T  C C EGF G G+  C+   + P+   GC S+S C+  +     C +    NP           +++  C + A+C     +  C C+ G+ G+P+  C                    I N +C+ + D   N  EAC  +Q  +        CG +A C   +    C C  G  GD       C S  C  N DC +++ C+S      C+D C + QCG  + C  + H   C C  GY GNP  LS    REV C+  +DC +   C++       C   CR   +C +  +C  +N+R  C C PT +       C    + A  P C  D   S  + C  D+       P      C  +  CR           C+C EG     N +   ++ S+++C  D  C+++++C      C+ AC    CG  A CI   H  +C+C PG + GDP           +P+L   +  C  + DCP    C +RL   C++ C  D+ C   A+C   Q +P                                           C+CP G +G P+ +   PE      D +CP    CI   C+N C   +CG N +C +NN +A C CL+G+   P      +    GC  D +C     C   +C+  C  +  C    +C   +   +  C+S  +  +   C        C  + +CP+   C++ KCV+PC+    C  NA CK       C+C   F G P                    +  CP Q+ C    C      +  C +NA C   +          C++G   K    D+ C++ E  I++    GC  + +C     C+ G C               IN C +++ CH SA C+       C+CP G  GDPY+  CK    +EC  + DC    AC  +     +C  PC   + CG  A CE + H+  CKC     G+P S   C K EC+ + DC  DK C  A  +CID C    CG R  C    H  +C+C  G     Y+        ++N C   ++C             N+ C   A C       +C CP     D +  C    R  D  +C  D DCP   AC + +CQNPC +   C  + IC   N+ P+    C CP  T  +    C    +  EC  N+DC     CV   C   CS+ N CG N  C    H  +C C  G+TG+P   C Q  L         C+ ++ CPS   C    C  PC     C  + +C       +  C D     P   C+    I    C  D +C +   C+ R     +C++ C+  + CG NA+C    H+A+CTC  G+ G P+                    +VC++    QP V   C ++  C     C  G+C +PC     CG +A C V+ H   C+CP  + G+P   C  I    C   +DC     C +  C+ PC+ +  C  N  CL       C+   N     H    K     CR + DCP   TC+N +C DPC    CG  A C+   H+  C CP     NP                            FCK+V                     CR+D DC S E C  +   C+  C  ++N                      C   A C  +NH+  C CP    GD    C   +       C     C+    C+   C   C   N  C  N+ C      PL   +  C  G       IC+E      C  +  C  N  C +  C D C  + CG    C  S H++ C C    TGN  + C LP+T         C    DC     C +  C+  C     C     C   Q +  CT    CP G +      CK    +P C+ D +C D   C+  KCQNPC   S  C K+A+CRV NHR +C C  G  G+P   C+   C+++ EC + ++CI   C N CL  N CGI+A+C    H+  C+C + + G+P   C     ECLS P C  +  C++       KC                  +DPC  AR   +A C       +C C  +   GDP  + C        +E +C  D DCPS  +C   +C +PC +   C  NA C    T+ +    C C +   G+   RC           K + +   GC+ + +C++  AC  +N  C  PC   + C    +C V NH+  C C      +   +      Q EC    +CP N+AC N +CK+PC   + C +          A+CI                                              E H+ VCK CPPG   D +  C +   C+++ +CP  +AC ++KC++PC    CG+   C V  H +       C+C +     P   C++ EC K                      + DC +++ CD    KC  +C G   C     C   NH   C C   + G+   G +F   P  P I   C  D  C+      + +C R K  +P             N C P   C+++   P+             + C+ P         G++ +C  V     C      T +    +G        I+ C    CG NA+C        C+C  G+ GNP  GC                                   +P+ + GC      N DC     C  +KCIDPC     C I A+C+V +H  +C+CP G VG P + C   ++P  T  P           + ++PC+   CG NA C+ ++ +AIC CI+ + GDP   C +P C   F+C  ++ACIN +C++PC    CG+NAEC  + H AIC C +G+ GDP++ C     + +P  P           DPC+   C  NA+C     R +CTC P + G P                EC  + +C    ACIN +C NPC+    C  NA+C V +  P+    C+C +G+ G     C +    +    +      P++            N NPCG  A  +  N    C C  G  GDPY  C P    EC  + DC+  Q C NN+C+DPC    TCG +A C+  NH P C C +G  GN    C K +       P+  V   E   DPC    CG  +  R + ++ +C C  G  G P   C+  +C    DC  N  C  Q  KCS  C G+  C   A C   +H   C C     GD ++ C +KRP               S         NPC    PC P   CK L   P     C C +G  IG   NC     RPEC    +C  +  C +  CVD C    CG NAEC    H+ ICSC  G++G+P   C      V PS  P                     PC+  +PC   A CR +N    C+C  GYIGSP     P  +PEC  + ECP + ACIQQKC +PC    CG NA C   NH A+C+C  GY GDP+      GC    E             DPC    CG NA+C + N    C C + H GDPY  C+P +CL++ +C +HL C+  KC DPC   C + A+C  RNH   C+C   ++GDP   AC  IP P  +E +                   +PC  N PC  N++ R  + +      C C   Y G          P     C  +S+C    AC   KC++PC     CG+ A+C V NH P C C PG+TGDP++ C                                                     EC+ + +C ++  C++ +C DPC     CG NA+C  + H+P+C+CP G +GDP   C +    T        T      +DPC+ + CG  A C +    G CTC+ G  G+PY+ C+  EC  N DC  +  C  N  KC+  C    +C INA C +  H+  C C     GD  + C      V   E ++D   P           NPC   +         +   S+  I +    + EC  +++C     C+  TC D C    CG  A+C    H   C C  GY G+P + CT+  I V + V       +  PR T        NPC  D PC   A CK +     CSC  GY+G          +PEC   SEC ++LACI +KC+DPC    CG  A C V +H A+C C + Y GDP+S C+  
Sbjct:  358 LQIFKVEKLCDGKSDCYLGS---DENQKELKCSNNCLYTTGHRCINGACLDS---QCHCNDGWGGKGCSMPD--DNECKY-RPCDVFAHC----TNNIGSYACTC----FPGYEGDGHNCQDIDECTIPELAAKCVENAECCNLPAEYVCKCKPGFEGDGQVECRDIDECRESNACGANSLCSNFAGNYTCSCQEGYAGDPYTGCIDLNECLSNPCGAGAKCINQYGGYLCECPAGAKGDPYTSCGT---LDQC-QSKPCGLNAKCYNDGGSYRCECPQGFQGNPKQQCLDVNECLRN------------PCGQNAACINTEGSYQCACKQGLTGDPF--------------TACSDTDECSAQS--------------NPCGSNAVCR--NTNP--GFVCECPPGFSGNGNVACEATE--VRTLCQSNFDCTNNAVCQKGECLCRSGFTAAGTLCLDVDECRSTPGICGANAVCRNTLGSFTCSCLTSFVGSPPSVPCSEPCKGVTCSQHAYCKAEQKDAYCVCEDGWTYDPKNIAAGCIDVNECGAPGTCGENSLCTNLPGSFICQCKPGYTGNPQVRCIDIDECKSVSTCGFGTTCENLPGSYKCGCPSGSVADPNNPAECISVKTCQKNNDCPGNAFCSPSKMCVCPEPNQGPNCESPCENVFCAANSQCTLINGQPRCMCHQGYQPAGQGKQGCIDINECLGQPCGKGAFCENTPGGYRCKCPSGLSGDPNIACKGEIEAIQCSVSKPCPSGELCSQGKCVCQRGFQRESSGLCRDLDECTRASASEEPACGLNAFCKNLPGSFDCECPAGYNGNPFVKCSSCNGPDCGCQPPYSQD---GENCILAGCKN----KGDCSEGAECI---TIAGGVSYCACPSGFNVQPDGTCADID---ECLST-------------------SRPCGFGALCENKIGSFSCVCPIGTTGDPYS-------GVCSANQAQCSRDNDCRPNEKCVEPGQCICPPPFFSDTTDGGKCKSPCERFMCGINADCSPTNPPQCLCKAGYNGDPIQGCLDVDECAQNPCGPEARCLNEAGSYKCQCPKGTRGDPYLAGCKGTPSRVECTRDEECPGLLSCQASVCINPCSSIPCGENAVCIPENHAAWCRCKVGYKENSEGKCTSMCDGVICGLNAQCIISPTGPTCACSKGTLGNPFPGGSCVPETCSGANPCPQPLSCISGKCRERCDSFS-CGLNAACDG------NTNKCFCREGFVGDGNFLCMPPILPPICTPGCGSHSHCAYGIPNQCICNSEFGGNPYEGCSPSTIDIVQDCKCGSNAECVTDGTSKVCTCKEGFDGNPFIGCFDINECTNKICGKNAVCINTIGNYDCRCELDYKGNPFEACFPEQPTIADLCTEKQCGPNAVCSVGQ----CLCLTGFKGDAEDLRTGCQSSTCSNNLDCGYNEICQSVKGQYRCIDACGNVQCGPNSRCVTDNHHSTCICQDGYSGNPLDLSGGCVREVTCKTQNDCPTGSVCSINISGKRSCVDPCRI-MSCGKYEICSVKNNRPFCQCSPTHIRNPVTGQC----EIASVPSCSNDGQCSEDQVCRPDSLGILRCTPICQLFTCPQNSQCRASNHQGF----CQCFEGYNGNPNDRTGCSLISKDQCLSDAQCSEEEVCSLTLKKCIPACNTIVCGPQAVCITQNHSPQCTCPPGKFKGDPN----------DPVLGCKAVSCLTNTDCPPTKFC-DRLSYTCMDVCTADT-CGKNAVCLPEQQRPKCSCPPGTKPDPLPEVRCSTLNACSKKPCHSSASCSSTTTGFSCSCPQGQVGDPNKSGCFPEGSCPNGDRDCPDKSICIRGMCKNICYD-SCGPNTECSINNRQAQCQCLQGFIPSPLDARTCIRDSQGCRKDADCIGGSTCQGGQCRYSCRGQNDCLVGEQC--SDSMCMISCISSQQCPSSQVCSNGVCSIGCRNNENCPSDEVCISFKCVNPCQQEGACGPNALCKVSGKNVQCSCPERFAGVPTPQQGCVRIPARC------PNGKCPPQHTCKGGMC------HWQCQINANCAKGE---------RCLDGLCTKVCHSDKNCLQGEICIDSTCQPGCNKEEDCRPGEICQGGSCVCAIGFINTPAGCQDINEC-ENSICHPSANCANIPGSFKCTCPRGLVGDPYTKGCKN--PNECTTNRDCGPQLACAGDGSGYRKCVNPCDRAK-CGTNANCEVQKHKPFCKCFDKHVGNPSSPLGCTKVECEKNTDCNGDKVCQVANNRCIDACNIVSCG-RGTCSATNHVPSCRCEPG-----YI-------FSNNQCVDIDEC------------QNSPCEPTAICINTVGAYQCQCPPGTVPDAFGRC----RSSD--QCLSDNDCPKTAACNNGKCQNPCEIPGSCGADAICTPANHRPM----CSCPPRTNGNPQVRC----VPLECVSNSDCNSERTCVRNKCVDVCSLPNVCGQNTNCRATNHIARCFCLPGFTGEPTLGCTQLQL---------CTVEEQCPSGMLCSFGICSPPCQSSRDCLDNQLCN--GGSCISKCQDSTQCPPLHSCQNGLCIQESRCSNDVDCDEVDTCVGRENGLFECEDACAGPVICGRNAKCTSLGHKAVCTCPDGFFGDPNNEKIGCQKKQCLVNGDCPGDSVCDKFICTQPPVTGTCTNDRNCQANEVCDKGQCKDPCGIQGSCGINAFCSVQSHRKQCVCPQDFTGNPEVECVRIPST-CYSSSDCPQPMQCADGICMPPCSSDENCAINERCLQGLCMLTCRV-DNDCFLGHVCLNKMCIVGCRANSDCPESNTCINNRCTDPCRGDTCGPNAKCQVVDHRAQCSCPPRFIPNPTPVVGCVKQPQTCSSNAQCPERQVCDGKFCKDVCFNDKNCLVNEVCDNGICKPLCRRDDDCNSQEIC--KGVTCVLGCRSSSNCPNDLACINNQCTDPCSSSTTSCGNNALCSVANHQAVCSCPAGLTGDPTRGCRHPV-----QVCSSSTQCRQGYKCVGGVCAASCSSSNENCLLNEVCVKGTCRPLCNSNADCSDGY------ICKERFCVAGCSSDSQCKENQACINSQCQDPCLSSSCGQCAECSVSNHQAFCSCPASSTGNPSIGC-LPLTYT-------CGKSSDCGRGQRCEDGVCVKKCGSSSSCECGKTCVSGQCRQECTSSVPCPQGHL------CKGGTCLPGCIGDNDCSDQELCLAGKCQNPCLLESTGCAKSAECRVTNHRPVCLCPQGLQGNPKIECKRIECRTNSECEHTKSCIEGSCVNLCLLPNACGISAQCKSIRHQKKCSCPQKYVGNPNIECVLDKNECLSSP-CGENAICQDLVGGYDCKCKAGCTGDGFSGCICGGPLIDPCRNARCGLDALCTVGGGIALCVCPNNKPNGDPL-VEC-----TSEKEGKCRADFDCPSSQSCKKGKCVDPCSLRAACGVNAIC----TVRIHKPRCECPQCHIGRPHVRCRPDPSCNTLPTKPQIVEPIGCQGDKDCSLGTACNRQNGKCFDPCGSTS-CDFNKKCIVSNHKPICKCKYSLVVNQQGVLTCPDRQVECRTHNECPSNQACDNGRCKSPCDNPRICPAGKECQVLEHKAVCICTTGCNPEVSICLKDRGCPRGQACIGYQCKNPCEGTTCPGNTPCIVEDHKAVCKFCPPGFTTDANYGCIQGVGCRSSSECPSKQACQNKKCVNPCGLGQCGATQDCEVANHLARCIDVPRCECSSRRDCLPGFTCEDCECVKNPDVDATVCEPSEGDCFEQCTINSDCPEDKYCDRFKRKCISVCPGF--CGDNTQCRFVNHNPICSCKQGFNGNPDVGCTFNQPPSNPCIPSPCGSDAICELDNGNPICSCPRGKTGNPFVRCIQDGKKCRGNQCGPNSGCRMIADRPVCYCLPRFEGNPPAIPCVKPMKQCKPNPCGANTECVVVNNVQRCTCKPGYTESVNTIQGCVLISEPVISLCEPGPCGDNAECLVNDLGEDCRCNAGFGGNPFQGCTPQNPCNPSPCGPNTECNEDRAGQIVCSCRRGYQGDPTSDQGCKAECLRNSDCSRALACIAQKCIDPC--PGTCGIFAVCEVQNHNPICSCPPGTVGDPFSRCT--QQPVVTEPP-----------RPKDPCNPSPCGTNAQCRQQSGQAICQCIRDYQGDPLIGC-KPECLLSFDCPQDKACINSKCKDPCP-GTCGINAECQISNHNAICKCHEGYTGDPFAQCSLIPGVINPPEP----------ADPCQPSPCGPNAECRIVESRPVCTCFPGYYGAP-----------PSCRPECVINSECAPALACINLKCSNPCVGV--CGINAKCDVVNHNPI----CSCPQGYIGDPFSSCRRKPDEIRPTPK------PDIC-----------NPNPCGPSAIRKPRNGVCTCACPPGLFGDPYLGCRP----ECILNSDCNRLQACSNNKCVDPC--PGTCGTNAECKIINHIPTCGCRKGFTGNAFEECTKPK-------PVQPVEGKE---DPCGGNFCGAYSTQRVQGNRCVCSCLPGYFGFP-PNCRP-ECVVSSDCSQNLACLSQ--KCSDPCPGR--CGVNARCHVISHHPICTCPPDYEGDPFTSC-QKRP---------------STVTPPPKPSNPC-YPSPCGPYSSCKPLRDRPM----CSC-NGGYIGSPPNC-----RPECLLSSECQLTKACVQQHCVDPCP-GTCGANAECKVVNHNPICSCPRGYSGDPFFNCNKDPEVVTPSERPH-------------------IPCVP-SPCGPNALCREVNGHEACSCVAGYIGSP-----PNCRPECVLNAECPSNKACIQQKCSDPCVGA-CGYNARCTAVNHNAICTCPTGYTGDPFS-----GCSLVPEVIREPP----EIIDPCNPSPCGANAECSSRNRAGACRCIKDHIGDPYVGCRP-ECLINTECPNHLACSQKKCRDPCPGTCGRNAQCSVRNHNPICTCNPGYSGDPTS-ACQIIPPPQPIEVD------------------TDPCDPN-PCGPNSQHREVNGV----CVCACAPTYQG--------TPPNCRPECVVSSDCNQLTACVNQKCVDPCPGT--CGNNARCQVTNHNPICQCPPGFTGDPFSNCVRVVVTQPPPRPQPVDPCNPTPCGQFSQCRNSNEVAACSCLPNYIGIPPNCRPECSINAECPSNRACVRERCIDPCP--GACGPNAVCKVQNHQPICQCPTGFSGDPFRDCRRVVIPT--------TVRTTEVIDPCEPSPCGANAQCRSRQRAGACTCVPGYFGDPYLACRP-ECVMNTDCPTNRACVNN--KCVDPC--PGVCGINAICNANRHQPICTCLNGYTGDAITQCSLIPTGVPVVE-ELDPCDP-----------NPCGAYSQHKEQNGVCVCSCSRNMIGSPPNCRPECLVSSECSQVTACMQQTCRDPCPGL-CGRNAECRVTNHNPICTCQRGYQGDPFTGCTK--IPVTERV-------TQPPRPT--------NPCQPD-PCGRYAQCKNVRGVAACSCLVGYVGVPPNC-----RPECLIHSECPSNLACINEKCRDPCPG-ACGAYAECSVIKHNAVCRCQQGYEGDPFSSCRRV 15882          

HSP 3 Score: 1181.39 bits (3055), Expect = 0.000e+0
Identity = 1511/5647 (26.76%), Postives = 2150/5647 (38.07%), Query Frame = 0
Query: 3113 NPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQ-----PVVDVGCRSNSECSPTLA-----CKNG-------EC--INPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEV-ECRKDTDCASNEKC--NLQNFRC----------LRLCSDNNNCAGFAN-------CEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINP---CSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGS--CIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVA---------CYLPITPNEPSL---VPGCTSDQDCPSYTACRNRQCIN--PCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQK------------CQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCK----PYECLSDPECPNHLKCENEKCV--------------DPCECAR-----------NADCDARNHRGICTCILDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNS--LHAHQGECNFDTDCPDNKACI-----------------NNQCKNPC--------------------------------------IVNKPCGSNAICITEIHRPVCKCPPGLAGDPH-----STCYRYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFT------------NNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGT-SECIVNEDCTSTDVCYEG---SCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDP---YTFCEEPGCKSDFECRDNQACINRECQNPCLFE----KCGLNAECNANGHRAICSCLQGHKGDPYSF----CKPYECLSDPECPNHLKCK-----NEKCVDPCE---CARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXX-XXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDER-----CVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIG-FIGDPYSSCVPASNEECNYDGDCSDNQVC--INNQCIDPCKEKSTCGKDAICRTENHRP------------------------------------------VCKCPQGQAGNPH-AYCYKYEC--KTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQ----CRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPS--GTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSL-SNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLC---------------IDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPET-SCRPPIKPECRYDTECPDHLACIQ-----QKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYK--FCDEPGCKSDFECPNSQACY--NKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGH---------------------------------------KGDPYTFCKPYD-CLVDNDCLDHLRCTNTKCVDPC----ACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCN----VQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQ-----YQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSY---CYKYECVTKDDCPFD--------------------------KTCLAKNCVDPCK-NTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEV--ECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTD-MIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAE-LSQIT---------------IQTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARC----ACFTGYTGNPRSQCTRVVILVPQEV------EIGCSGDSDCPRYTACTNKKCINPCAVDK-PCASTAICKVINHKPFCSCRDGYIGSSETSCQLPQKPECTKDSECANHLACIQQKCQDPCASPI--CGINARCRVKRHRAICV----CLENYIGDPYSVCKE----AGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCR--SYECLVDSDCPRHLACENEKCVDPCKCAKYADCKVTNHQGYCTCNSYYTGDPYGLAXXXXXXXXXXXXXLDQDCPRQKACIEQECQNPCLIYSP-CVTNAECKVYDXXXXXXXXXXXXKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPIS----TGECKHDSDCLNSESCIDNQCE------------------DPCKVYTPCGQNAECMATNHRSVCKCRKGLI-GNPHSQCYSYE---CKTNEDCPFDKHCVGQKCVNPCDT-TLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKE----------------IECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEE----SKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDVVKCGYNSECKQSFHQATCQ-CTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCT------------CPDGY-------IGSPQTDCQL--PIQ----PECTRDYECPDNKAC--IQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPY-------SFCKPYECLIDSDCPT-----------NLQCNNEK--CVDPCK------CARNADCEIKNHRGYCTCQSDFTGDPYGI-SCDPIPEPVLVEYE---CIEDKDCPSNQACIDTEC--------------INPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSD----NKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCV--PVNEKECQFDDECSSNQACVNNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNFECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDS------------------------------------------DCLNNEECNLRLAKCNRLCQRE--NSCTKSAICEATRHTEICTCPTPFIGDGKSFCME-----------------------IVKPPSS-------------------PGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTXXXXXXXXXXXXGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLSPKPECIVDQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPRNHRAMCKCKEGHKGDPYTFCRPYECLVDRDCPDQLKCDHEKCVDPCQCAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHSY------------------------------------------------ECLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLXXXXXXXXXXXXXXXRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCEL-PS--------------------------------------------EPECLVDDDCPSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEE---------------------------------------------------PGCKSDIECPFDKACISRECQNPCLYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCK 7996
            N C    C   A C        CTC  GY G  H  C++      P +   C  N+EC    A     CK G       EC  I+ C E+N CG ++ C        C C  GY GDPY+ C  +                   N+C+     + PCG  A+C+       C+CP    GDP+ SC                      +D C +  CG  A C  +     CECP G QGNP   C +V EC ++  C  N  C     +++C             CSD + C+  +N       C  +N    C CPP F G+G   C        +  CQ + DC     C +  C     +      C +  EC++   +               G+N +C+       C     C T+ +    S  C + C+   C  +  C +    + CVC  G+T + +           C  P T  E SL   +PG    Q  P YT     +CI+   C     C     C+ +     C CP G +  P N  +   V  C  + +CP +  C   K            C++PC ++ C  N+QC + N +  C C  GY         +P  +       KQ CI+    N CL + CG  A C        C C  G  GDP   CK      +C     CP+   C   KCV              D  EC R           NA C        C C   + G+P+             +   ++D +      CI   C N       C + AEC    T+      C C  GF  + D  C  I+  + T                         + PCG  A C  +    +C CP+G TGDP S    A+Q +C+ D DC  N+ C+                   +CK+PC                                          PCG  A C+ E     C+CP G  GDP+      T  R EC  +E+CP   +C +  CI+PC +  CG  A+C  E H + C+C  G + N                        +  KCT +C G   C   A C  +     C C    +G+ +     P    +   C     C    +CI  KC + C +             N C   +    +       +  I P     G         G  ++CI N +       YEG   S I+     KCG NA+C T      C C EG+ GNP  GC                        N+C N          K C   A+C        C C   + G+P   C P +       P   D            C+   CG NA+C        C C+  F GD     T C+   C ++ +C  N+ C + + Q  C+      +CG N+ C  + H + C C  G+ G+P        +   C +  +CP    C         CVDPC    C +   C  +N+R  C C P    +P    CE    P    + +C+ED+ C   +  I   C   C ++  C QN++C+  +        C C EG+ G  ++R       K + + D        CS  L    + C+ P  N   CG  A C   NH  QC C  G F GDP    +      C  + DC   + C  ++  C+D C    TCGK+A+C  E  RP                                           C CPQGQ G+P+ + C+        ++DCP   +C    C + C  + CG    C     Q+ C+C QG   +P      ++    CRKD DC     C  Q  +C   C G+N+C     C   +      C S         C      V    C+ + +C     CIS  C NPCQ    C P+  CK    +  + V C CP            C R+ +R  C   + C     C  G C   C + +NC     C   L   +C  HS         C      ++ +  PGC+  +DC     C+   C               I+ C E++ C   A C  I     CTCP G +G P T  C+ P   EC  + +C   LAC       +KC NPC    CG NA C VQ H+  C C   +VG+P     C +  C+ + +C   + C   N  C D C    CG+   C A NH   C C  G+                                         D +  C+  D CL DNDC     C N KC +PC    +C   A C   NH+  CSC     G+P  + C P+        EC+++ DC S+  C   +C + C     C QN  CR  + +      C C+ G+TG+    C +++      C    +C   + C  G C  PC + R C     CN    +   Q    C P ++       QE+    C++D DC   +TC+      ++C D C     CG+NA C+S  H+ VC CP+G  GDP++    C K +C+   DCP D                          + C    C DPC     CG+ A C+ + H+  C C     GNP + C  +   C  ++DC    +C      C+  CS    CAIN  C        CR   D  +G     C  K+  V    C+ +SDCP+   CIN RC +PC   + C  + +C++ +  +Q +               ++    C++N  C    VC    C D C              F++  C     C  G     +  C R      QE+       +GC   S+CP   AC N +C +PC+     C + A+C V NH+  CSC  G  G     C+ P +  C+  ++C     C+   C   C+S    C +N  C     R +C     C + YI      CKE    AGC SD +C  ++ACIN +CQDPCL   CG+ AEC V+NH+A C C +S  G+P + C   +Y C   SDC R   CE+  CV  C  +   +C  T   G C      +  P               C  D DC  Q+ C+  +CQNPCL+ S  C  +AEC+V +  P+        +G  G    +C R+E      C+ NS+     +CI   C + C   N C  +A+C+ + H   CSCP    G+PN  C+       +  C  ++ C +     D +C+                  DPC+    CG +A C      ++C C      G+P  +C S +   C+ + DCP  + C   KCV+PC     CG NA+C    H+  C CP+   G P+V C+                 I C+ D DC+    CN +N  C   C     C  N  C ++NHK  C+C        YS    ++       ++ +C+   +CP   +C + RC+ PC   + C  G++C V   L  +++         I   G   ++ I   C  D  C R   C    C N C+   C  N+ C    H+A C+ C  G+T D    C   +         GC    +CP   AC+N KC+NPC + + C  T DC+V +H + C             C  G+       + +P  D  +  P +     +CT + +CP++K C   +++C++ C    CG N +CR   H  +CSC+ G+ G+P   C                  N+   NPC    CG +A+C   N   ICSC  G  G+P+         C+  +C  +S C               + N     CV P K      C  N +C + N+   CTC+  +T     I  C  I EPV+   E   C ++ +C  N    D  C               NPC    PC     C          + CSC  GY G         DP    GCK++    + C++ LAC+   C++PC     CG F+ C+ QNH  +C C  G +GDP+S C   PV  +  +  D C                N + CG NA C  ++ +AIC C + + GDP   C   ECL + DCP DK CI+ KC  PC  T CG  AEC +  HN++CKC  G  G+P+  C  +    +                                           +C+ N EC   LA  N  C       C  +A C+   H  IC+CP  +IGD  S C                         I KP +                    P C ++ DC    AC + +C +PC     C +  +C + + +PT    C C      NA  +C   K +   +                 D C  N CG+YST     +   CSC+ GY G P            P+  P C    DC    +C ++ C +PC     C +NA C VI+H P+C+CP  Y G P T CQ  P            +      K  +PC  + CG  + C+    R  C C  GY+G P      P C  + EC  T+AC+ + C+DPC    CG NA+C   NH  +C C  G+ GDP+     + C  D +     +  H  CV P  C   A C   N    C+C+A Y G P          P     C  +A+C S +ACI ++C +PC+    C  NA+C   +        CTC  GY+G     C L+ E +                +    ++PC   SPC + A+CS RN   AC C     GDPY  C P    EC  + EC    +C + +C   C     C RNA C ++NH PIC C PG  GDP + C                                                   EC+ + DC    +C N+ CV+PC  T CG NA C V  H  +C+CP G+ G P+ +C  +                 T            C   ++C   + +  C+C    IG         P + +PEC I+++C +N AC+   C +PC     C  N  C V+N  PI    C CP G S      C++V         +  R++EV      I  C    CG NA C+S   + AC C+P + GDP+ AC              C ++TDCP+  AC N  C+DPC    C  NA C    H+P+CTC +GY G   T C L P+                                             PECLV  +C    AC+ Q+C+ PC    CG NA+C V +H  IC C  GY GDP+  C +                                                   P C    ECP + ACI+ +C++PC    CG  AEC    H A+C+C++G++G+P+  C+
Sbjct:  559 NECKYRPCDVFAHCTNNIGSYACTCFPGYEGDGHN-CQDIDECTIPELAAKCVENAECCNLPAEYVCKCKPGFEGDGQVECRDIDECRESNACGANSLCSNFAGNYTCSCQEGYAGDPYTGCIDL-------------------NECL-----SNPCGAGAKCINQYGGYLCECPAGAKGDPYTSCGT--------------------LDQCQSKPCGLNAKCYNDGGSYRCECPQGFQGNPKQQCLDVNECLRNP-CGQNAACINTEGSYQCACKQGLTGDPFTACSDTDECSAQSNPCGSNAVCRNTNPGFVCECPPGFSGNGNVACEAT---EVRTLCQSNFDCTNNAVCQKGECLCRSGFTAAGTLCLDVDECRSTPGI--------------CGANAVCRNTLGSFTCS----CLTSFVGSPPSVPCSEPCKGVTCSQHAYCKAEQKDAYCVCEDGWTYDPKNIAAGCIDVNECGAPGTCGENSLCTNLPGSFICQCKPGYTGNPQVRCIDIDECKSVSTCGFGTTCENLPGSYKCGCPSGSVADPNNPAECISVKTCQKNNDCPGNAFCSPSKMCVCPEPNQGPNCESPCENVFCAANSQCTLINGQPRCMCHQGY---------QPAGQG------KQGCIDI---NECLGQPCGKGAFCENTPGGYRCKCPSGLSGDPNIACKGEIEAIQCSVSKPCPSGELCSQGKCVCQRGFQRESSGLCRDLDECTRASASEEPACGLNAFCKNLPGSFDCECPAGYNGNPFVKCSSCNGPDCGCQPPYSQDGE-----NCILAGCKN----KGDCSEGAECI---TIAGGVSYCACPSGFNVQPDGTCADIDECLST-------------------------SRPCGFGALCENKIGSFSCVCPIGTTGDPYSGVCSANQAQCSRDNDCRPNEKCVEPGQCICPPPFFSDTTDGGKCKSPCERFMCGINADCSPTNPPQCLCKAGYNGDPIQGCLDVDECAQNPCGPEARCLNEAGSYKCQCPKGTRGDPYLAGCKGTPSRVECTRDEECPGLLSCQASVCINPCSSIPCGENAVCIPENHAAWCRCKVGYKEN------------------------SEGKCTSMCDGV-ICGLNAQCIISPTGPTCACSKGTLGNPF-----PGGSCVPETCSGANPCPQPLSCISGKCRERCDSFSCGLNAACDGNTNKCFCRE--GFVGDGNFLCMPPILPPICTPGCGSHSHCAYGIPNQCICNSEFGGNP--YEGCSPSTIDIVQDCKCGSNAECVTDGTSKVCTCKEGFDGNPFIGCF---------------------DINECTN----------KICGKNAVCINTIGNYDCRCELDYKGNPFEACFPEQ-------PTIADL-----------CTEKQCGPNAVCSV----GQCLCLTGFKGDAEDLRTGCQSSTCSNNLDCGYNEICQSVKGQYRCIDACGNVQCGPNSRCVTDNHHSTCICQDGYSGNPLDLSGGCVREVTCKTQNDCPTGSVCSINISGKRSCVDPCRIMSCGKYEICSVKNNRPFCQCSPTHIRNPVTGQCEIASVPSCSNDGQCSEDQVCRPDSLGI-LRCTPICQLFT-CPQNSQCRASN----HQGFCQCFEGYNGNPNDRTGCSLISKDQCLSDAQCSEEEVCSLTL----KKCI-PACNTIVCGPQAVCITQNHSPQCTCPPGKFKGDPNDPVLGCKAVSCLTNTDCPPTKFCDRLSYTCMDVCT-ADTCGKNAVCLPEQQRPKCSCPPGTKPDPLPEVRCSTLNACSKKPCHSSASCSSTTTGFSCSCPQGQVGDPNKSGCFPEGSCPNGDRDCPDKSICIRGMCKNICYDS-CGPNTECSINNRQAQCQCLQGFIPSPLDARTCIRDSQGCRKDADCIGGSTC--QGGQCRYSCRGQNDCLVGEQCS--DSMCMISCISSQQCPSSQVCSNG---VCSIGCRNNENCPSDEVCISFKCVNPCQQEGACGPNALCK----VSGKNVQCSCPERFAGVPTPQQGCVRIPAR--CPNGK-CPPQHTCKGGMCHWQCQINANCAKGERCLDGLCTKVC--HSDKN------CLQGEICIDSTCQPGCNKEEDCRPGEICQGGSCVCAIGFINTPAGCQDINEC-ENSICHPSANCANIPGSFKCTCPRGLVGDPYTKGCKNPN--ECTTNRDCGPQLACAGDGSGYRKCVNPCDRAKCGTNANCEVQKHKPFCKCFDKHVGNPSSPLGCTKVECEKNTDCNGDKVCQVANNRCIDACNIVSCGR-GTCSATNHVPSCRCEPGYIFSNNQCVDIDECQNSPCEPTAICINTVGAYQCQCPPGTVPDAFGRCRSSDQCLSDNDCPKTAACNNGKCQNPCEIPGSCGADAICTPANHRPMCSCPPRTNGNPQ-VRCVPL--------ECVSNSDCNSERTCVRNKCVDVCSLPNVCGQNTNCRATNHI----ARCFCLPGFTGEPTLGCTQLQL-----CTVEEQCPSGMLCSFGICSPPCQSSRDCLDNQLCNGGSCISKCQDSTQCPPLHSCQNGLCIQES---RCSNDVDCDEVDTCVGRENGLFECEDACAGPVICGRNAKCTSLGHKAVCTCPDGFFGDPNNEKIGCQKKQCLVNGDCPGDSVCDKFICTQPPVTGTCTNDRNCQANEVCDKGQCKDPCGIQGSCGINAFCSVQSHRKQCVCPQDFTGNPEVECVRIPSTCYSSSDCPQPMQCA--DGICMPPCSSDENCAINERCLQGLCMLTCRVDNDCFLGH---VCLNKMCIVG---CRANSDCPESNTCINNRCTDPC-RGDTCGPNAKCQVVDHRAQCSCPPRFIPNPTPVVGCVKQPQTCSSNAQCPERQVCDGKFCKDVC--------------FNDKNCLVNEVCDNGIC---KPLCRRDDDCNSQEICKGVTCVLGCRSSSNCPNDLACINNQCTDPCSSSTTSCGNNALCSVANHQAVCSCPAGLTGDPTRGCRHPVQ-VCSSSTQCRQGYKCVGGVCAASCSSSNENCLLNEVCVKGTCRPLCNSNADCSDGYI------CKERFCVAGCSSDSQCKENQACINSQCQDPCLSSSCGQCAECSVSNHQAFCSCPASSTGNPSIGCLPLTYTCGKSSDCGRGQRCEDGVCVKKCGSSSSCECGKTCVSGQCR-QECTSSVPCPQGHLCKGGTCLPGCIGDNDCSDQELCLAGKCQNPCLLESTGCAKSAECRVTNHRPVCLCP----QGLQGNPKIECKRIE------CRTNSECEHTKSCIEGSCVNLCLLPNACGISAQCKSIRHQKKCSCPQKYVGNPNIECVLDKNECLSSPCGENAICQDLVGGYDCKCKAGCTGDGFSGCICGGPLIDPCR-NARCGLDALCTVGGGIALCVCPNNKPNGDPLVECTSEKEGKCRADFDCPSSQSCKKGKCVDPCSLRAACGVNAICTVRIHKPRCECPQCHIGRPHVRCRPDPSCNTLPTKPQIVEPIGCQGDKDCSLGTACNRQNGKCFDPCGS-TSCDFNKKCIVSNHKPICKCK-------YSLVVNQQGVLTCPDRQVECRTHNECPSNQACDNGRCKSPCDNPRICPAGKECQV---LEHKAV--------CICTTGCNPEVSI---CLKDRGCPRGQACIGYQCKNPCEGTTCPGNTPCIVEDHKAVCKFCPPGFTTDANYGCIQGV---------GCRSSSECPSKQACQNKKCVNPCGLGQ-CGATQDCEVANHLARCIDVPRCECSSRRDCLPGFTCEDCECVKNPDVDATVCEPSEGDCFEQCTINSDCPEDKYCDRFKRKCISVCPGF-CGDNTQCRFVNHNPICSCKQGFNGNPDVGCT----------------FNQPPSNPCIPSPCGSDAICELDNGNPICSCPRGKTGNPFVRCIQDGKKCRGNQCGPNSGCRMIADRPVCYCLPRFEGNPPAIPCVKPMKQCKPNPCGANTECVVVNNVQRCTCKPGYTESVNTIQGCVLISEPVISLCEPGPCGDNAECLVNDLGEDCRCNAGFGGNPFQGCTPQNPC-NPSPCGPNTECNEDRA---GQIVCSCRRGYQG---------DPTSDQGCKAECLRNSDCSRALACIAQKCIDPCPGT--CGIFAVCEVQNHNPICSCPPGTVGDPFSRCTQQPVVTEPPRPKDPC----------------NPSPCGTNAQCRQQSGQAICQCIRDYQGDPLIGC-KPECLLSFDCPQDKACINSKCKDPCPGT-CGINAECQISNHNAICKCHEGYTGDPFAQCSLIPGVINPPEPADPCQPSPCGPNAECRIVESRPVCTCFPGYYGAPPSCRPECVINSECAPALACINLKCSNPCVGVCGINAKCDVVNHNPICSCPQGYIGDPFSSCRRKPDEIRPTPKPDICNPNPCGPSAIRKPRNGVCTCACPPGLFGDPYLGCRPECILNSDCNRLQACSNNKCVDPC--PGTCGTNAECKIINHIPT----CGCRKGFTGNAFEECTKPKPVQPVEGKE--------------DPCGGNFCGAYSTQRVQGNRCVCSCLPGYFGFP------------PNCRPECVVSSDCSQNLACLSQKCSDPCPGR--CGVNARCHVISHHPICTCPPDYEGDPFTSCQKRP------------STVTPPPKPSNPCYPSPCGPYSSCKPLRDRPMCSCNGGYIGSPPNC--RPECLLSSECQLTKACVQQHCVDPCP-GTCGANAECKVVNHNPICSCPRGYSGDPF-----FNCNKDPEVVTPSERPHIPCV-PSPCGPNALCREVNGHEACSCVAGYIGSP----------PNCRPECVLNAECPSNKACIQQKCSDPCVGA--CGYNARCTAVN----HNAICTCPTGYTGDPFSGCSLVPEVIR---------------EPPEIIDPC-NPSPCGANAECSSRNRAGACRCIKDHIGDPYVGCRP----ECLINTECPNHLACSQKKCRDPCP--GTCGRNAQCSVRNHNPICTCNPGYSGDPTSACQIIPPPQPIEVDTDPCDPNPCGPNSQHREVNGVCVCACAPTYQGTPPNCRPECVVSSDCNQLTACVNQKCVDPCPGT-CGNNARCQVTNHNPICQCPPGFTGDPFSNCVRVVVTQPPPRPQPVDPCNPT-----------PCGQFSQCRNSNEVAACSCLPNYIGI--------PPNCRPECSINAECPSNRACVRERCIDPCP--GACGPNAVCKVQNHQPI----CQCPTGFSGDPFRDCRRVV------IPTTVRTTEV------IDPCEPSPCGANAQCRSRQRAGACTCVPGYFGDPYLACRPE-----------CVMNTDCPTNRACVNNKCVDPCPGV-CGINAICNANRHQPICTCLNGYTGDAITQCSLIPTGVPVVEELDPCDPNPCGAYSQHKEQNGVCVCSCSRNMIGSPPNCRPECLVSSECSQVTACMQQTCRDPCP-GLCGRNAECRVTNHNPICTCQRGYQGDPFTGCTKIPVTERVTQPPRPTNPCQPDPCGRYAQCKNVRGVAACSCLVGYVGVPPNCRPECLIHSECPSNLACINEKCRDPCP-GACGAYAECSVIKHNAVCRCQQGYEGDPFSSCR 15876          

HSP 4 Score: 1181.01 bits (3054), Expect = 0.000e+0
Identity = 1594/5899 (27.02%), Postives = 2216/5899 (37.57%), Query Frame = 0
Query:  437 KPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPYSYC-NAYECLSDPECPDHLHCISEKCVDPCKCAANAECDARNHRGYCACIIDFTGDPYGXXXXXXXXXXXXXXXXXXDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCS-NGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYE----CLRNSDCPFDKACVSEKC---------------INPCKNT--LCGTRAECSVEYHKPICKCPKGLQGSP-----YIECKNVECKRHEDCGDQEKCNL-------------ISLKCEKL--CSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGL-----LACMSEKCQDP-----CTFNKPCSDSQECKVFDT-SPTKTVACICPT------------DTVVGIDGRCNRVQTSPECEIANDCKISDICVSGSCIDA--CKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRPHPECPDRLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACXXXXXXXXXXXXCNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCIXXXXXXXXXXXXAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCAD-----------------NKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYVA-CK----EVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYT----GDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGF--GNCKRVETATECQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINXXXXXXXXXXXXRCKVINHEPECTCPDGFIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPY--------------GIACXXXXXXXXXXXXCKEDRDCPSQNACINEECDNPCL-MYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIE---NDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVK-ISNSECKYDTDCASNEAC-IN----DQCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSF----ECKKNEDCPFDKECKSES-----CVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNP--YLSCREV---QCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEAC--ISDTCKNPCIVES-----PCHPSQN-------------------CRVLESYLLK-------------TVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLL--SPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICK----VIQHKPVCTCPDGFIGSPSTNCQPPERPECRVDAECPLDRACIHQKCQNPCSR-LTCGKNADCKVNNHRAICTCLKGYNGDP---YSLCKLSGCESDFECPNHQACINRECQNPC-LFEKCGXXXECKXENHRAICH----CLSGH---------KGQAYVNCKRYECLRDSDCPNHLHC