hypothetical protein L798_13876, maker-scaffold186_size273091-snap-gene-1.41 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of hypothetical protein L798_13876 vs. L. salmonis genes
Match: EMLSAG00000012828 (supercontig:LSalAtl2s:LSalAtl2s979:4:5108:1 gene:EMLSAG00000012828 transcript:EMLSAT00000012828 description:"maker-LSalAtl2s979-augustus-gene-0.3") HSP 1 Score: 60.4622 bits (145), Expect = 9.562e-12 Identity = 44/120 (36.67%), Postives = 58/120 (48.33%), Query Frame = 0 Query: 45 IHSLTARSVPRQFREGLKKGMPFLADRNIKTATDPPRTPWDVTTGEGTQSSPPISAPSTSQPRGSKPTTPLHIIYDSENK-----DLVPYPEGEFIRSPSPEHSGIPALPVTMRLRSRDE 159 IHSLTARSVPR FREGLKKG+ D+NIK + + T S + ++ + H+IYDS+ K E R+PSPEH GIPA V + + R + Sbjct: 201 IHSLTARSVPRHFREGLKKGLTHFTDKNIK-----------IPGSDSTIHSR--NYGNSEEDYYDDDEESSHVIYDSKKKYQSSSVSSNNNTMESTRTPSPEHVGIPASRVRLTPKKRSD 307 The following BLAST results are available for this feature:
BLAST of hypothetical protein L798_13876 vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of hypothetical protein L798_13876 vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of hypothetical protein L798_13876 vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold186_size273091:184288..185101- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold186_size273091-snap-gene-1.41 ID=maker-scaffold186_size273091-snap-gene-1.41|Name=hypothetical protein L798_13876|organism=Tigriopus kingsejongensis|type=gene|length=814bp|location=Sequence derived from alignment at scaffold186_size273091:184288..185101- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'hypothetical protein L798_13876' has the following synonyms
Add to Basket
|