GH13743, maker-scaffold642_size120736-snap-gene-0.27 (gene) Tigriopus kingsejongensis

Overview
NameGH13743
Unique Namemaker-scaffold642_size120736-snap-gene-0.27
Typegene
OrganismTigriopus kingsejongensis (Tigriopus kingsejongensis)
Associated RNAi Experiments

Nothing found

Homology
BLAST of GH13743 vs. L. salmonis genes
Match: EMLSAG00000008211 (supercontig:LSalAtl2s:LSalAtl2s495:387785:453642:1 gene:EMLSAG00000008211 transcript:EMLSAT00000008211 description:"maker-LSalAtl2s495-augustus-gene-4.12")

HSP 1 Score: 2291.54 bits (5937), Expect = 0.000e+0
Identity = 2139/6852 (31.22%), Postives = 2894/6852 (42.24%), Query Frame = 0
Query:  186 EGDGKVECRDIDECLTNQVC--------------GINTLCINTHGNFSCECLPGFHGNPHDGCV---------------------DIDECRT----------NPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVS----------------QQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVD---------------IN-ECQSSSLYQ-CGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCL--------------------PNGSCACRKGF--QPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVN-CGQRASCQIVKSEAF----CICEEGWAYNPKE--------ISSGCLDIDECDKS--------ISPTGK---CGVNAICSNSPGSFNCVCAKGFNGDPY------------IGCFDIDECAENR--------FICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSP----------NGRSCIDIDEC------------AGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGC----RGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSN------CEAPAKCVQITGGISYCACPRGYEMNPRT--------------------KNCEDIDECQA-------IGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQ-CLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKL--------------------ATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQG-NCVSLCNQVI-------------------------------CGSNAQCIVSPSGP----TCQCFEGMVGN-------PYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQ-CGVNAFCDP--NRLSCTCQSGFLGDPTLVCMPPTQQAECS--SECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDC-DSLKCGDNAVCSFASGKPECTCKRGYDGIPYERC--------QD------------VDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDD---------------DLCANQQ-CGPNAICNLGQ----CLCASGFKGDDPNDLVEG--CSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQ-CGPNSFCITDN----HQKSCICQDGFTGDANDPQRGCQREE---KCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKL--------TGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPAC-DLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPE-FENLCQCPEGFAGVPTAAQGCVRIPPTCTT--------DCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGE--------ICVDKFCEPGCRTDSDCRLGEVCGAGG------------------------QCSCQPGY---------EMTQSGCSDLNECK----------------NNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVE----------YPCE--GFTCG-----------HGSCHPEDHAPKCHCQ-----DGYQLIGSNCQDID--ECASGNPCHNSAKCTNEQGSYQC-------TCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGF-CGIGAKCVVKNHSPKCSCLPRWRGNPKIKCEL----------LECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPRECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSIC-----MHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREP----ITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHG------KICKEVCRSDSQCQSKEICQGIS--CSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLV-PCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQAGLVC-IDRQCVG-GCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGS-----TKNQCGSGLNCHRGLCA--KSCEASAEC---NCGESCH---------EGFCLQ--------QCQIASDCQNGAECIEGVCISGCGSNR------------------------------------------------DCPYGEMCEGGQCRNPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKT----ECTTNGQCSRDKSCEGG------RCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVD------------------RNDCLLP---NQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKD--SCRTKGACLN-----PCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICP-----QQDVQCLYEDQCPSTLSCIDGACQNPCQGTS-CPDGKSCQVLNHQAL----CICTK---------------------------------------DPC-SISPCGDEAICRAVEGNAICECPEGTRGDPLDSCV---KEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKD---------------ACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLP-ECQTDQDCPSDQSCNN--LKCQDPC--PGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDDGNCVDPC--PERCGLNADCRVQN----HQVQCFCQPGFKGDPYYQCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPC-VNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFP--------------------SPCG------ANAVCKIVRAQEKCHCLPGFLGDPPY-----CRPECLADHECPSHKICHQEKCIDPCE-NVCGINALCHTKNHKVICVCPSNMQGDPFDRCS-PNPPEPLE------------TDPC--SACGINADCDVRPNDQVICSCPKDYLGDPYIECRP-ECLTNADCPSHQACLRNKCVDPCIGTCGVNAECSEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSP----------PNCRPECTEDSACPNHLKCVREKCVDPCPGI--CGRNAECKHTN---MSSAQCAHFQGQKLASFSSLRRANNPLIV--------------DLLNILG--------------HVMRHNPMCTCLEGFIGDPY-------------NEGCIRKPEAIENE-VTPCEPN-PCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRP-ECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECH------------KPPSGIVTEEIIDPC-ANRECGPYSQKVERNGICTCSCLPGYVG--------APPDCQPICVVNSDCPAHLACINNDCVDPCFQNV-CGSNTHCYVKS----HQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPCETCGQHAICHIHNNIAACKCEDNYIDKPPNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKC-EPPKVSQP-----------------------IDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNY----ECLIHDDCPYNRACASNHRCSNPC-IGNCGVQAICNVIEHNAICSCPEELEGDPFIRCIPAGCRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQYECKRHEECPSTLACRDFKCVDPCDCAVGANCRVSNHKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCIS-NPCKNGATC----TVNKHEIFCACPNGFLFIGDFECKAPERP---ECVSDPECPLHLACISERCLDPCTS-QACGVNAKCTVTTHVPVCACELDYVGDPYTVC---QKAGCQSNSECPLSEACINRKCQDPCPFEE-CGRNADCSTNRHVPMCSCLTGYEGNPYEECRQYECLVDSDCPYTLACPNRECIDPC---QCAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDG--DCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCA----CPAGMTGDPYVSCLEI--VTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQYE----------CIQHNDCPNDKACIDNKCVDPCL-ETTCGQRALCKSEFHISHCFCPPGLQGNPIVRC-----FQVECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPCN----CGTGALCDVINHTPICYCPPKYSGNPQIACEKLE---------CRNDDDCGDHQRCYDNLCVDPCLIDNECGINAEC----IPRSHQSTCECPPGYQGDPFVKCSTFE------CLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPC----DCGRGAECFLTGHRPVCRCPEGTKGNPLIECT---PIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPCACGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKTCPAGSGLILNEFEECVCPPGF-VLDSQGICAPCRFDVGFIIEN-GRCICDYTKGFVLDLSGKKCVCPENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPPPVDIDRPEIVVNCLSDGVGVGLTISD-PRYHGLIYVKGHSQDPNCRLRVDEGQNGQRIDFHVKFGTCDLAYDEDGYAHFILVI-GHAKLMTYKSQAYRIRCIYSTGEQNISHGFNVSILTTAGTIANTGPPPTCIMRICNSNGEDISQAEIGDKLMLKVEVSPGEIYGGFARNCIARTVDETNEETVYTVTDDNGCATDPSIFKDWEYNRDKGYLSAVFDAFKFPNSNTIKFKCNIRVCFGQCQPQNCAGRNAFGRRR-RESEHEIAGTVYTGQLREEIKIESNAILAIERK-------AKRLQDNLQNRYIGNEEVCVSKIGFIIALVITALLALVAVAIAVSCWLMAYRRRPRTEGPLPHPPEFPNPLFTTPEP----LAEPTPDYLH 6130
            E + KVEC   D+C TN +C              G NT CI++     C CL G+ GN    C                          CR            PC   A C  +     C CP G  G P    C+  + P                   Q  C++ +CG+NA C+  ++  IC+C  G+ GDP  +C +               IN ECQ+  L++ CG+ A C  ++    C C  G+ GD    C+P +    C SD +C N+ +C                       G C C   F   P G+ C+ I E    E  C  +  C             P       + C +PCL    C Q A C++  +       C C EG+     E        I +GC    EC  S        ISP  K   CG  A CS       C C  GF GDP               C D   C  N+          CG  A+C  ++    C+C  G   DP S      R  C+++++C      F+ AC          C D C+   C   + C V+     C+C  G + +P            + C D ++C              N C   A CE       C CP    GD  S C          EC  D  C    +C+  +C     +  NP   C+ L EC + N   + +V         C CPS         C+   G+S   +         C    C N      C   A+C  I    + C C  GY  NP +                     +C   ++C+        I   PC   A C        C+CP G  G P      P +  C+ +  C +   C++ KC                ++PC   +CG NA C   N    C C   F+G+P T CE+    +   C+    CIN+                         C C  G  GDPY    S  K  EC +D EC   L C   +C++PC    C  NA+C A NH   C C   F  D  G  C  +   VI                               C  NA+C V  + P    TC C EG  G          P         S  SP L      +   C+  C  E  CG  A C    +R  C C  GF+GDP   C+ P    EC+   +C  N  CI    N C                   ++ C +   CG +A+C   + +P C C +G  G P+  C        QD            VD C  + CG  A C        C C     GNP+  C  ++   + D                LC  +  C   A+C        C CAS   GD  +   E       A CQT+ DC  +  C +      + C +PCQ    C P+  C T +       +C+C  G T   N     CQR E   +C  + DC +   C+     E TC+D C + +C  N +C  +    IC C+SG   N          T    +  GC    DC    SC       + C+  C +   C +GA C    H+  C C  GY G+P+  + C    + +C  + EC +   C     Q+ CQ  C+ + CG+ AVC V+NH   C C  G +VG+P  + C +  C  + +CP+++ C   +  C DPC  + CG+NA C    H+  C              +C +  +GD                  P   CK   C      +  C +   C   KC DPC   C   A C     +  C C   F G P     C  IP             DCP+  +C++  C   C  +  C +  +C     L L      C+QG         + ++     GC+++S+C     C  G                         +CSC PGY         E +   C+  ++C+                N  CG    C++     +C CP     D    C    +C +  DC     CLA      K C+DPC  + C   A+CN   H+  C+C    +G   NP I C +VE            C+   F C            +  C   +H  KC C      DGY         +D  EC   + C     C NE+    C       +  +  + +      + +A+C +N++C     C +G C+D C  F CG  A CV   H  +C+C   + GNP+ +C            + C  ++DC    +C N KC++ C +   C   + C++ NH P CSC  G+ G                     C  P +  C  D  C +   C + +C+DPC  P  CG+NA C  K H+ +C C   + G+    C    + C  D  CP    C    C     + QC  + +C +N    E +C        D ++      K     C    DCP   +C N +C DPCK   C   A C+V   Q +C C   +  +P  + AC   P    + C+ ++ CP    C    C+  C   S C  N  C        +     C      +  E C  +      GC+++ D + + AC   QC     ++              +PCS     + A C+  NH A+CSCP G  G+P   C P     C   SDC  S++C    C   C++   C QN  C       +C    +C+ GL+     QC    C +N  CP +  CV  KC +PC  + ++CG  A C ++ HQ  C CPRG  G PY +C+   + C S     TK +C         LC   K C  +A C   N  E+C            FC +        QCQI  DC     CI+  C   C  N+                                                DC   +MC+ G C N C+  +C  NS C+ +     C C RGY       C       E + N  CS D  C G       +CIN C+    C   A+C++ +H++ C CP G+ G+   +C +                   +  CL P     CG NA+C        C CRSG  GDP+  C  P  K    C  + ACLN     PC+    CG  A+C   NH+ +C C E + G+P   CK                  EC   ++C  N +C    CVDPC   KC  N  C  + H+  CTC+     +  G    P       + +C+ +  CPS  +CID  C NPC     C D  +C+V +   L    C C +                                       +PC + SPCGD + C+     ++C+C  G  GDP  +CV   ++E      C  N AC                    V+  C +P ++    + CG  A C    ++  C+CP G  GDP   C   E    D                C  + CG+KA C +   N ++C C  G  GNP   C   EC  D DC +++ CN    KC   C     C   A CE  +H   C C   + GD    C+   + KPP  P   C+ ++DCPS   C    C +PC     C     C V +      + C C      +       RG+   C    G          EC    DCP    C  G CVD C  N+CG  + C    H   CSC  G TG+PY  C   V P P+    P                    +PC        NA CK++  +  C C  G++G P        +PEC+ D +CP  K C   KC  PC  N+CGINALC   NH+  CVC S   GDP+  C  P     LE             DPC    CG NA C+ R N + +C C + + GDPY  CRP ECL + DCP    C   KCVDPC   C   A C                      N    C C  DY G P          P     C  D+ C +   C+  +C +PC     C  NA+CK  +   + +  C  F+G              P++V              D  N +                V  H   CTC  GF GDPY             ++ C R    IEN+ +  C  N PC  NA CI QN    C+C    +GDP   C   EC+ N DCP   +C +  C +PC     CG NA C+V   H A C C   Y G P + C                    T      C +N EC   ++   R+ +  C+C    +G         P   +P C ++SDC  +LAC+N+ C +PC  N  C +N  C V++        C C  G+       C K        +  D    C    +CH    I AC                                      + +CG NA C   +H   C CLP + GDP   C   P   +P                       IDPC+ +PC +N + R      +CTC  G+ G P T C      ECL+ DDCP + AC  +  C  PC    CG+ A CNV  H AIC C    +GDP+  C   GC+SD ECP  +ACI REC++PC +  CGVNAEC  +SH + C C +G +GNPY  C  YEC    +CP  L C++ KCVDPC CA  A C   NH+       G   +P          +   GC+ + +CP   ACI+  C +PC+S  PC   A C    T+    + C+C  G+   GD +C+    P    C +D +C   LAC +  C++PC   + C   A+C V  H   C C     GDPY++C   +   C+ +S+C  ++AC+  +C DPC  ++ CGRNA C T  H P+C C +G  G+P+  C +YECL D+DCP   AC +++C DPC    C   A+C  + H+  C C  G QG       SP +E   ++ +C+++ DC + + C      C   C F  PC   + C   +   K    C C+     NG   C   V+  E  C+   DCP    C N  C NPC+ +NPC     C V D     +    C  G        C+E+     C+S  +C+ +E C +G+C + C      CG  A C A NH + C C I + GNP   C              C   ++CP    C +NKCVDPC+    CG+ A CK  +H+  C CP G +G+P + C       + C  D DC   E C      C   CN   C   A+C   NH+  CFC     G+  V C       +  C  D DC +   C  E  C NPC++ NPC  +  C            C+CP  M       C+     V C  +  C +++AC   KC+ PC     C   ALC  + H   C C P   GNP ++C + E         C  D DC     C ++ C +PC     C  +A C            C C  G+       C   E      C+ +DECP  + C+   C +PC     CG  A+C +S H   CQCP G  G+P I C+P         A C  D +C S+ AC++ SC NPC   DPC   A C+           C+C  G+  D    C      +I+GC  D ECP   AC NR C DPC     C   A C    H   CRC  G +G+P   CT   P  C  D +C     C  N  C   C +  PC   A              CHV+++ PV+ + CECP GY   E   C TL PI+ GC  +D+C ++ +CINAIC+ PCACG NA C I +H+PVCTCK GFYGDPEI C +  CQS++EC+ TH C NG+CT VCG D++PCGG+A C+GV HQ  C CP GL GNP+V+C+ V C DNS+C  D+ CINK C D C+IS+ C   ++C V+NH+VDC+C  G+ G +G SC KV V C  D DCPS+ +CI K C NPC+  EPCG+NA C+V DT+P+RTMTC C+ GYEGDASI+C PVKTCPA SGLIL+  EECVCP GF   +++  C PC  + GFI+ N G+C+C+  +G+  +    KC CP    +N+ GICE  P+C  DP+C   +YCE  N TC +PC + PCGP A+G P DH C C+CI+GY+GDPN  C P+I+P P   D  RPE+VVNCLSDGV V + + D   + G++YVKGHS+D NC   +D G + + IDF V FG C L + + G A+F+LV+  H KL TYK+QAYRI+C+Y  GE NI+  FNVS++TTAGT+ N GPPP C M+ICN NGEDIS A +G+KLMLKV VSP EIYGG AR+CIAR++D++  E  Y VTD NGCATDP IF++W+ +R+ GYL+A+FDAFKFP+S  +KFKC +R+CFGQCQPQNC GRNAFGRRR RES H I G VYTGQLREE  + SNAI  +E         +  L   L++   G+EEVCVSKIGFII+LVITALLALVAVAIAVSCWLMAYR+RP++ GPLPHP EFPNPLF++PEP    L EP PDYLH
Sbjct: 3476 EVETKVECEYNDDCSTNDICQDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTND-CKKPIVPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYE----CLSDPECPNHLKCENEKCVDPCECARNADCDARNHRGICTCILDFTGDPYGIACEPIPEPVIEEVECNEDRDC-------------PSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTC---YRYECKTNEDCP-----FDKAC------ASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCT-DPCFTNNP---CLPLQECKVLNSSPLKTV--------SCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHD-AQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKC----------------QNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPY----SFCKPYECLSDPECPNHLKCKNEKCVDPCE---CARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAX----RXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCV-PASNEECNYDGDCSDNQVCIN---NQC-------------------IDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACIS------KICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLN---YNCQRVESRPECEKDRDCDSSSICN-----EGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRN-----RLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPE--TSCRPPIKPECRYDTECPDHLACI----QQKCQNPCTSVTCGLNAVCRVQNHRAVCSC-LGGYVGDP-YKFCDEPGCKSDFECPNSQAC--YNKNCQDPCLFDECGQNAKCFANNHRSMC--------------VCNEGHKGD------------------PYTFCKPYDCLV----DNDCLDHLRCTNTKCVDPCA--CAKYAECDARNHKAYCSCLVDFTGDPYGI-ACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYK-YECVTKDDCPFDKTCLA------KNCVDPCKNTICGVRASCNAEHHQGICTCISGLQG---NPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQITIQTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGS----------------SETSCQLPQKPECTKDSECANHLACIQQKCQDPCASP-ICGINARCRVKRHRAICVCLENYIGDPYSVCKE--AGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNH--EARCKCLSSFKGDPYV------KCRSYECLVDSDCPRHLACENEKCVDPCK---CAKYADCKVTNHQGYCTCNSYYTGDPYGL-ACEPIPEPIEVECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREK--------------NPCS-----STARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVC----KCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQKCVNPC--DTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKE--IECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHFE-KCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPY----------------ECLIDSDCPTNLQCNNEKCVDPC---KCARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQAC--------------------VNNQCEDPCNNA---NICGYNAICETKNHRAICMCPKGFAGDPHTSCYNFECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHN-SVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCM--EIVKPPSSP--GCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMN------ARGD---CEAIKGLV--------ECQTDRDCPDSDVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPV-PQPEPSITPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLSPKPECIVDQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYTVCEXPGCKSNLECLTTQACINKDCLDPCLFEQCGQNAQCNPR-NHRAMCKCKEGHKGDPYTFCRPYECLVDRDCPDQLKCDHEKCVDPC--QCAKYANCDAK-------------------NHRGYCNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPCLTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHSYECLSNKDCPLDKSCQNKICVNPCSKT-ICGQNAECSVEY-HQAVCKCPRGYQGSPYISCKLLDCHNDNDCKDDEKCDRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSD----CRSSEVCHTGTCITACL-------------------------------------VFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCELPSEPECLVDDDCPSDLACI-HQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEEPGCKSDIECPFDKACISRECQNPCLYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPCQCAKYAECDARNHR-------GIFPEP----------VEVEGCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEYECLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCKTEYHRGICVCEEGLQG-------SPFIE--CKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEK----CVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLVVDSSPSKSVSCSCREGFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDACRIRL--CGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECKPPTPLSIGCSADSDCPVVEAC--LNTKCVDPCN---CGENALCRKINHKAVCFCPSGFSGNPEVLCE------KLECTSDEDCSNDKMC-HENTCANPCILLNPCAINGEC----IPSNHVSKCRCPSDMNGDPYSLCVD----VECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCN----CGGGAKCFLSGHRPICQCPEGFIGNPQIECNP---------AGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPN----LHNAQCECDEGFEGDPYTGC------SIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACI-NEKCDNPCEVLKPCAEQA-------------ICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCINAICRSPCACGLNADCKIIDHQPVCTCKPGFYGDPEIECTDTVCQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNIVSCSDNSDCPTDKECINKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFIGNKGTSCVKVSVTCEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECFPVKTCPANSGLILDNREECVCPTGFGFTENKDECIPCLKENGFILNNEGKCVCNDARGYEYNPDSGKCECPPGERLNNFGICERVPDCEEDPDCPTQKYCEKTNGTCSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPVIIP-PVKTDFPRPEMVVNCLSDGVLVNVDLKDGGNFRGVMYVKGHSKDSNCIKHIDSGGSLKPIDFQVSFGKCGLFHSQ-GEANFVLVVQKHPKLETYKAQAYRIKCLYDVGETNINVNFNVSMITTAGTVRNDGPPPNCTMKICNENGEDISSANVGEKLMLKVIVSPREIYGGLARSCIARSLDDSKFEEEYAVTDANGCATDPEIFQEWKLDRNTGYLTALFDAFKFPDSINLKFKCIVRICFGQCQPQNCGGRNAFGRRRKRESSHIIDGKVYTGQLREETDVYSNAIETLESSPQNEPFNSATLGSGLESE--GDEEVCVSKIGFIISLVITALLALVAVAIAVSCWLMAYRKRPKSSGPLPHPREFPNPLFSSPEPPIHHLDEPDPDYLH 9871          

HSP 2 Score: 1642.86 bits (4253), Expect = 0.000e+0
Identity = 1846/6464 (28.56%), Postives = 2556/6464 (39.54%), Query Frame = 0
Query:  117 KYRPCDVFGYCTNTLGSFFCSCNEGYEGD------GFHCKDIDECQI-----------PELANTCVQNAECCNLPAHYVCKCKPGFEGD-----GKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALC-------------------------QRSSNGLICTC----REGFTGD-----PKISCVDINEC------------QSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTP-------PEQPCR-----------------DPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEI--SSGCLDIDECDKSISPTG----------KCGVNAICSNSPGSFNCVCAKGFNGDPY-----IGCFDIDECAENRF----------ICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDAT-CFPNSQCLVQNGLPF----CQCLPGFKLSPNGRSCIDID-----------ECAGN----------------PCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSN--CEAPAKCVQITGGISYCACPRGYEMNP----------RTKNCEDIDECQAI---------GHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPL-----RSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCK----SPCHRFSC--------GFNAECTP-SNPPQC-LCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVE------CGADDECHGQLACIGSQCINPCSS-VPCGSNANCVAENHAAWCRCKSGFAED-----------------SQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPY-------PGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQ-CGVNAFCD-----PNR-LSCTCQSGFL--GDPTLVCMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDV--DECLF----------------------SVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDD-------------DLCANQQCGPNAICNL----GQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQR------EEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMS-CPTNEKCMVSDGMP----ICLCNSGFEKNKLTGSC---DVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMI-------FSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIE--------GCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCT--ETCGPNALCS-----PEFENLCQCPEGFAGVPTAAQGCVRIPPTCTTDCPASS------LCFNGYCMPECTSHGQCARGEQCS----NGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKNNI-CGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVE-----------------YPCEGF-----TCGHGS-CHPEDHAPKCHCQ-----DGYQ--------------LIGSNCQDIDECASG---------NPCHNSAKCTNEQG----SYQCTCHDGMVGDPYTQGCKPKAQ--CYSNSECSSDTRCQNGRCVDPCD-GFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCE--------LLE--CVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPRECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKM-CK-VGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNP-----SPVVACTREPITCQGNKQCPENFLCDASFC-------KPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGIS--CSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLV-PCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQ--------AGLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCH------RGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCISG---CGSNRDCPYGEMCEGGQCRNPCNGFE-CEPNSFCQVNGRNPL----CLCDRGYQRLASGGCAK----TECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQ---DVQCLYEDQCPSTLSCIDGACQNPC-QGTSCPDGKSCQVLNHQALCICTK------------------------------------DPCSIS-PCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEE--------------------SCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVE-PADDPCTPSP------------------CGAFANCLVVLNQLKCVCPPGLFGDPFIQC-QPVEETPKDACQ----------------PSPCGSKANCNINDENQAI---------CSCWEGYFGNPLTGCLP-----ECQTDQDCPSDQSCNNLKCQDPCP-GFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDDGNCVDPCPER--CGLNADCRVQNHQVQCFCQPGFKGDPYYQC---IVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVN-NCGEGAQCQVVKHKPMCSCPDGSTGNPYKRC--------------QIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDP-PYCRP-ECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFD-RCSPNPPEPLETDPCSA------------------------CGINADC---DVRPNDQVICSCPKDYLG---------DPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECSEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRP---ECTEDSACPNHLKCVREKCVDPCP--GICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPY----------NEGC-IRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRP-ECVVNSDCPYGLAC--LSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPS-----------------GIVTEEIIDPC-ANRECGPYSQ--KVERNGICTCSCL---PGYVGAPPDCQPI-----CVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEE--------------------RDPC---ETCGQHAICHIHNNIAACKCEDNYIDKP-PNCR----RECVLHEDCPKHLACIQYKCASPCIN-QCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQPID--------------PCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCN-YECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPF-IRCIP--------AGCRSDSECPSTEACIDRECRDPC-PFQTCGVNAECETRSHL----STCICLEGFEGNPYEGCTQYE------CKRHEECPSTLACRDFKCVDPC----DCAVGANCRVSNHKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCI-SNPCKNGATCTVNKHEIFCACPNGFLFIGDFECKAPERPECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQKAGCQSNSECPLSEAC--INRKCQDPCPFE-ECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQY-------ECLVDSDCPYTLACPNRECIDPCQ----CAANAECSVQN----HKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSIC--QVHDTVPKRTVACNCESGYTSNGNKEC---IRQVEP-IEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSCL-EIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQVECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGD-GNVYCTIKPNP--IEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSL--VGCESSSKCKADQACLNAKCVSPCN----CGTGALCDVINHTPICYCPPKYSGNPQIACEKL---ECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCSTFECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQS--CQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSC-VFLPTDTILGCVKDDECPKDSACINRMCKDPC--------------------------------DC--------------------GRGAECFLTGHRPVCRCPEGTKGNPLIECT----------PIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPCA---CGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGT-RGNSC----KKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKT-----CPAGSGLILNEFEECVCPPGFVLDSQGICAPCRFDVGFIIENGRCICDYTKGFVLDLSGKKCVCPENHSINDNGICE--EEPECRVDPNCTPFEYCEGFNRTCGDPCLKW-PCGPFAYGTPNDHRCQCRCIEGYTGDPNNVC 5745
            + RPC     C        C C EG  GD       F CK  ++C             P  +  C  NA+C     + +CKC  G +G       +VECR  D+C  N  C +N        NF CE L          C+      +  C   A C        C CP  L+GD Y   C+ +V   +  +      C Q   C                            +  + C C    R    G+      K  C + N+C             S  ++ CG  A CI  S    C C  GY G+ + +C+ ++V         C +N  C    SC  R    P            + + PC   + C  +     C C    +G+P       PE  CR                  PC    CG  A C++    A C C  G+  +P  +    GC +  EC  + +             KCG NA CS       C C KG  G+PY       C    EC ++             C   A C  +     C C      DP  + C         + EC+ +  CF+     QE  +   C++ C   + C  N+ C V + LP     C C+ G+    + R C+ I+           EC  N                 CG  A C        C C  G  GD  S C   S  EC  D  C   ++C+S++C                 + C  G +CG N++C        C+CP GF  +  ++C        S  P  +       +  C N  C   A+C  +      C CP+G + +P          R ++C D ++C  I         G   C + A C  +     C CPP   GD +  SC        +  C+ +  C     C+  KC     F     D   CK    SP    +C        G +  C      P+C +       +       +D C +NPC   +IC +     +C CP G TG+P       S + E      C  DD+C     C  + CINPC+   PC   ANC   NH   C C +G+                        CV  C    C  NA C        C C     G+PY       P      + C+    C  Q   C    C   C   + C  NA C      P R ++CTC  GF   GD   + + P     C S    NS C      + AC+ G   NP             ++  C  +A+C   + +P C C  G+ G PY  C     DEC                        S+CG NA C        C+C  +F G+P   C   E    +D             D C N  CG NA C++      C C SG +G       E       C+ + DCG +E C     +  + CS+      C  N+ C    H++ CIC   +TGD       CQ+      + +C+ +EDCP+  +C       QTC +PC + + C T+++C V+D +P     C+C      N   G+C   +    C +++DC     C+  +     C+ AC    C   A+C +  H   C C  G+ GNP  +S C +         +  C SN +C     CK    ++   P      C   A C V NH  +C CP G F+G+P  +         CR   C+ + +CPD+  C+  +  C+DPC+   C  NA C    H+  C C P F               GD  P+G           C P  I +  I    C  +  C     CI  +C +PC   + C  NA C      P     C C EGF G     + CV+I P     C ++S       C NG C+  C  +  C+   +C     N  C  +C           CV K     C+ D+DC   E C    QC               ++ C  N+ CG    C       +C CP     D   +C S  +C  ++DC     C ++S      C+DPC  + C  LATC V  HK  C C   ++G   NP + C +V+                 Y C         C   + C  E+H  KC C      DGY               L+ S+    + C S          +PCH S  C   +     +  C C +G       Q    ++Q  C  +++C+ D  C  G CV+ C    CGI A+C+   H  KCSC P + G+PK  C         LL   C  + DC +   C N  C++ C     C + + C++  H PVC+C  G  G P                +  C  P    C VD  C  D+ C   +C++PC +   CG NA C   NH+ +C+C  G+ G+    C    S C  D  CP    C    C + C     C     C        C     C  GH     + CK   C    DCPN   C+N +C DPC   +C  NA C+    + +C C   F  +P      P+     E + C  ++ CP    C    C       KP C  +++C+  +    +     C      +  E C  I      GCRSD +C     C +  CI    K               +PC  S     A+C  ++H+ALCSCP G  G+P   C+  L   C+  +DC +++ C +  C   C L      NE+C +G   +  N  + C+            C   +    C ++  CP +  C + KC DPC++  + CG  A C T+ HQ  C+C +G  G+PY SCR    R     N C S   C         LC+ +   +    C    H+  C+   Q   D    A C E V       C  ++DCP    C   +C+NPC   + C  N  C+V   +PL    C C  G        C +    TEC  N  C + + C  G C   CS  NSCG NA C    H  +C C  G+ G+                    N+ C   +   + +   GC+ D      CP+   +CR +  C+NPC++   C K AICK +NH+A+C C + + G P   C+                  EC   AEC  +  CI   C +PC+T  C DN +C  QRH+  CTC    +   +   +C +Q   DV C    +C  TL+C +G C NPC +   C     C+V  H+A CIC                                      DPC+I+ PCG  A C      + C+CP    GDP  SC K E                     C TT CG    C+  Y +  CEC  G      +    VE   D  C  +                   C  FANC    ++ +C+CPP   GD +  C + + +  K  CQ                  PC     C+ N E +A          C C +G F      C       EC+ + DC ++  C +  C D C    CG    C    H+  C C +GY G+    C +   P  P   +P C  +QDCPS+  C +  C++PC E   C   A+C+V  H+  C C  GF G P   C   IV                     PEC+   +CP    C++ +C +PC +  CG+ AQC+V  H+ +CSC  G  G+PY  C              Q  +    + PC    CG NA C     +  C CL G  GDP  +C+P ECL+D ECP+H  C  EKC+DPCE  C  NA C  +NH+ IC C  +  GDP+   C P P   +E   C+                         C  NA+C   D  P   + C+C + + G         +P I     C +N +C    AC    C+ PC+                  NPCG  + C S  N  A C C   + G P +      EC  D+ CP++  C+  +C +PC     CG NA C                               I ++         H P+C C  G  GDP+          NE C   K  A E  + PC+   CGS A C  +    SC+C     G+P+++C+  EC  + DC     C   ++KC   C  +  C   A C    NH  +C C ++Y+GD    C  P                     + ++  DPC  N  C P  +   +  + + T SC+     Y+G+   C+ +     C+VN DC +   C    C++ C    CG N  C    H A+C+CF GY GNP  GCN        + E                     DPC   + C   AIC + ++ + C C D ++  P  NCR     EC +  DC    ACI+ KC +PC    CG+NA C   NH  IC C+  + GDP   CE P      +              PCL   CG N E    G   IC+CL G  GDPY+ C  YECL   +CP +  C  N +C +PC   C   A C+   H  IC+C  +  GDP+ I C P          C  D +CPS  ACI+ EC +PC  ++ C  NAEC+    L     TC C+EGF G   E C + E       +   EC   LA R   CV+PC     C   A C+V+NH++ C C  GF GDPYS       P     C  + +C D+  CIN++C+DPC   + C   A C    H   C CP G        C    + EC ++ +CPL   C SE+C+DPC +  CG+ A C    H  +C C     G+PY  C+   C+ + +C  +E C   N KC   C  +  C   A C    H   C C +   G+ Y  C +        EC  D DC  +LAC ++ C +PCQ    C+ + EC   +       +C C  G      T G +   + V    +C++D DC S   C +G C + C  L  CG ++ C   +HD++      C+C SG+T N    C   +  VEP +  GC  HQDCP    C N  CI+PC    PC++ A C V +H   C CP G  G P  SC   I   C+ D EC DH AC    CQNPC+     CG  A C   NHRAVC+C   +VG+P + C +  C    +CPN +AC +  C DPCL   CGQ A C +  H S C C  G +G+P   C   +C  D DC D+ +C     T     +  +C   A C+A+NH+  C C     GD   + C   P P  +E  C  D+DCPS+  C  +  C+NPC    PC  +  C+V DT P RT+ C C  G        C+    +  +GC+S+S+C  + AC   KC++PC     CG+ A C+V NH P C C P Y+G+P   C++    EC +DDDC   + C    C DPC  +  CG NA C    H+  C+CP G  GDP   C  +EC+T D+CP  K C+   C+DPC  N  CG  A C    H   C C  G  G+P I C          E ECR ++DC     C   S  C   C   + C  +A C  V+        C+C    + D    C   + +     C  D +CPK  ACIN  C++PC                                DC                    G  A+C    H   C C  G  GNP  +CT           IGC  D++C     C  N  C+  C +  PC S A C  + H+                   C C  GY  +    C    P    CT D EC +  ACI   C+DPCA   CG NA C ++ HR +C C + + GDP  VCKE GC+S+ EC +   CIN +C   C  +   CG +A C   NH+  C C    +G+PYV C + EC  +S+C    AC N++C DPC    +C   A C V NHQ  CTC   Y G   G +C    + + V C  D DCP Q ACI + CQNPCL+  PC  NA+C V DTLP+RT+TC CL GY G    +CT V+      C A S             P      +   +PCR          +  C  T    +      C CP   + + N  C      EC+ D +C   E C   +  C DPC  + PCG  A     +HR  C+C +G  G+P++ C
Sbjct:  105 RNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCNLN--------NFKCEEL----------CIS-----SGVCAPSAICETYKHRETCVCPPPLTGDGY-SYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVGGTCLNSCRVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINP-----------CAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPYSYCNAYECLSDPECPDHLHCISEKCVDPCKCAANAECDARNHRGYCACIIDFTGDPYGIECTPIPEPVIEEVECVEDKDCFS-----QEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDER-CVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCT----------------DPCSNGQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPCKNTLCGTRAEC-SVEYHKPICKCPKGLQGSPYIECKNVECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGY-SSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRPHPECPDRLKCENEKCVDPCE---CARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQN-ACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRS----NSEC----DRNLACDNGKCINPCR-----------NNNPCSSSAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYVACKE-----VQCRKDNDCGQDEKCDLQRFTCTKLCSN---SNVCAANARCEASRHRERCICSSPYTGDG---YSFCQKIVVPASKSECNVDEDCPSKLSCI-----SQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGF-GNCKRVETATECQSNNDCPDTDVCDRGT-----CINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNP--QSICNLAPLLVEPIKEPGCDSNQDCPSHAACK---DRKCINPCAESSPCASSARCKVINHEPECTCPDG-FIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCE--NEKCVDPCE---CARNADCDARNHRGICTCIPDFT--------------GD--PYG---------IACEP--IPEPVIEEVECKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTG--KGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKC--ICQIGYTGDPYSQCV-KISNSECKYDTDCASNEAC-INDQC---------------VDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCYS-FECKKNEDCPFDKECKSES------CVDPCIDTQCGTLATCTVEYHKGICKCSSGYQG---NPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVERCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSP----------------STNCQPPERPECRVDAECPLDRACIHQKCQNPCSRL-TCGKNADCKVNNHRAICTCLKGYNGDPYSLCKL--SGCESDFECPNHQACINRECQNPCL-FEKCGXXXECKXENHRAIC----HCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDKCVDPC---ECARNADCKARNHRGYCTCIPNFTGDPYGIVCEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKP-CVLNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKD--------------NPCHTS-----AQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCSL------NEICGKGAICENRNHRSVCKCPRGFSGDPHSYCYKYE----CKTDNDCPFDKACAKEKCIDPCKD--TFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECR---NDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGD--GYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTCRKTCS-INSCGANAVCTPVIHGFKCNCFDGYTGDP-------------------NSACYQPVLNVEPLLEPGCSNDD----DCPS-YTTCRNR-QCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRP-------------INVPECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYI--GSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSL-VPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIV---------------------PECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPCE--CARNADCDARNHRGICTCILDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPII--HTGCRSNTECAVSLACENANCISPCLKN----------------NPCGNIAQC-SVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAIC-------------------------------ITEI---------HRPVCKCPPGLAGDPHSTCYRYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEA-TNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPYECLSDPECPNHLKC-KNEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSS----CVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCY---KYECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGT-----TIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDAC-SLSNCGVNAECATTLHDSI------CSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVT--CGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRC-----TNTKCVDPCACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQ-ECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTKDDCPFDKTCLAKNCVDPC-KNTICGVRASCNAEHHQGICTCISGLQGNPYIMCK---------EVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVN----HKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQITIQTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACT-NKKCINPCAVDKPCASTAICKVINHKPF-----------------CSCRDGYIGSSETSC--QLPQKPECTKDSECANHLACIQQKCQDPCASPICGINARCRVKRHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQ--CGENAECLVNNHEARCKCLSSFKGDPYVKCRSYECLVDSDCPRHLACENEKCVDPC----KCAKYADCKVTNHQGYCTCNSYYTGDPYGLACEPIPEPIEVECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEEIKEYGCKANSDX----------SPNLACIGRQCTSPCR---------EKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESC--IDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQC 6115          

HSP 3 Score: 1518.44 bits (3930), Expect = 0.000e+0
Identity = 1778/6316 (28.15%), Postives = 2551/6316 (40.39%), Query Frame = 0
Query:  125 GYCTNTLGSFFCSCNEGYEGD------GFHCKDIDECQI-----------PELANTCVQNAECCNLPAHYVCKCKPGFEGD-----GKVECRDIDECLTNQVCGI-----------NTLCIN------THGNFSCECLPGFHGNPHDGCVDI------DECRT----------------NPCGIGAKC----------TNLLGNYQCQCPAG------LSGDPYQGACQAQVAPSVSQ----------QGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTP---------PE---------------QPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKE-------ISSGCLDIDECDKSIS-----------PTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCID---IDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSC-----LPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPS-NPPQCLCKAGFTGN-------PLT--------GCEDLDECA----------LNPCKQGSICIN----KLATYQ--CECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDS----------------------QGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDP--NRLSCTCQSGFLGDPT-LVCMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLK-CGDNAVCSFASGKP----ECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNL----GQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQ-CGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVN-CPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMI----FSQNKCSSNAECAESEVCKRSNGQRSC---QPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNP----QIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTET--CGPNALCS-PEFENLCQCPEGFAGVPTAAQGCVRIP--PTCTT--DCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFC-EPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPC-EGFTCGHGSCHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKC----TNEQGSYQCTCHDGMVGDPYTQGCKPK----AQCYSNSECSSDTRCQNGRCVDPC--DGFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKC---ELLECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPR------ECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKS--ICMHQCQSHNDCAINERCDEGKCLLTC----GVDNDCFLGHVCLDK---MCKVGCSAPKDCPNSQSCINHQCQDPCKAAQ-CGPNALCQVIE----RQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDS--------QCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPC-SVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVP-CSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQAGLVCIDRQCVG--GCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAEC--------IEGVCISGCGSNRDCPYGEMCEGGQCRNPCNGFE-CEPNSFCQVNGRNPL----CLCDRGYQRLASGGCAKTE------CTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGN--------ALQECVVD--------------RNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGC---QCPTPKD-----SCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGA--CVDPCA-THKCEDNERCIAQRHKPKCTCKERLLINSAG---ELICPQQDVQCLYEDQCPSTLSCIDGACQNPC-QGTSCPDGKSCQVLNHQALCICTK---------------------DPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYP--VSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQP------------------VEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPE-CQTDQDCPSDQSCNNLKCQDPC-PGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCV--NNCGEGAQCQVVKHKPM----CSCPDGSTGNPYKRCQIIVR-----------PPPKQPCF----------PSPCGANAVCKIVRAQEKCHCLPGFLGDPPY-CRP----ECLADHECPSHKICHQEKCIDPCE--NVCGINALCHTKNHKVICVCPSNMQGDPFDR-----CSPNPPEPLE--------TDPC--SACGINADCDVRPNDQVICSCPKDYLGDPYIECRP-ECLTNADCPSHQACLRNKCVDPCIGTCGVNAECSEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIG---------SPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPL-IVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIE-NEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSC-----------RPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPP-------------SGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPDC--QPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKG--------PTGTITAEER--DPCETCGQHAICHIHNNIAACKCEDNY-----------IDKPPNCRRECVLHEDCPKHLACIQYKCASPCINQ--CGKNADCSVINHDPI----CRCLPQYFGDPLVKC------------EPPKVSQP--------IDPCLPN-PCGENTEHRKAGSNCICTCLPGFYGDPYTGC----NYECLIHDDCPYNRACASNHRCSNPC--IGNCGVQAICNVIEHNAICSCPEELEGDPFIRCIPAGCRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQYECKRHEECPSTLAC--RDFKCVDPC----DCAVGANCRVSNHKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPC-ISNPCKNGATC----TVNKHEIFCACPNGFLFIGDFECKAPE-RPECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQ----------KAGCQSNSECPLSEACINRKCQDPCPFEE-CGRNADCSTNRHVPMCSCLTGYEGNPYEECR---QYECLVDSDCPYTLACPNRECIDPCQ---CAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPY-VSCLEI-----VTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASN----HRAVCTCPIEWVGNPMRECHQYE------CIQHNDCPNDKACIDNKCVDPCLETT-CGQRALCKSEFHISHCFCPPGLQGNPIVRCFQV---ECQQDGDCADNEKCDLRAQTCQLICNAQS-CVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQAC--LNAKCVSPCN----CGTGALCDVINHTPICYCPPKYSGNPQIAC------EKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRS----HQSTCECPPGYQGDPFVKCSTF----ECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEP-VEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPCD---CGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCR-STCH----VVDTSPVRRIV------------------CECPK-GYFTNENNQCLTLTPI-VVGCTSDDECGDARACINAICKDPCA----CGPNAVCTIENHRPV----CTCKDGFYGDPEIVCK------EVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTV---ECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVK----------------------------TCPAGSG-LILNEFEECVCPP-----GFVLDSQGICA---PCRFD----VGFIIENGRCICDYTKG---------FVLD---LSGKKCVCPENHSINDNGICEE---EPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPI---IVPKPPP 5755
              C N      C C  G+ GD       + CK  ++C             P     C   AEC        CKC  G +G+      +VECR+ ++C +N+ C +           N LC N       +    C C   F G+ +  C +I       ECR                 NPC +   C           + L    C+CP+G            + + + QV     Q          + C+  SCG NA+C    +G  C C +G+TGDP  +C           YQ  +                           EP+ +   CS+D DC +   C  N  C               I+ C S  +PC  ++IC  +     C C+   VGTP         PE               + C++PC  + CG  A C++ +  A C C  G+  +P         +  GC    EC  +++               CG +A C       NC+C  G+NGDPY  C  I +       C  +  C++        C N    DP +++     R C ++ EC+         C C   + G         A+C+   +C + +  PF             ++C++   +D C    CG  AIC+       C+CP G  G+P   C+     EC +D+ C   E C      C              L  C   N C   + C+       C CP  F+G+ ++ C          +P    +E  CQ+    +C+    C++       C  P  Y +NP    C +  EC+A    P            + SC CP G     F GS      +  +  C  N  C  N+ C  G CI                  C    CG N  C  S +  +C+C  G+TGN       P+T        GC    +C           +NPC +   C      K+  ++  C CP G  G P TN C      EC +D EC   LACI  +C NPCSS+ CG NA C  +NH A C C  G+  D                          C + C    CG NA+C        C C +G  G+PY    C    C S   C    + C+  +C+  C   +C  NA CD   +R  CTC   F GDP  + C P  +      EC  +  C    P+  AC      NP            C   K C  NA C      P     CTC  G+ G   ERC  ++  + + C  N +C  +    +  C S  +                     N  CG  A C++      C C  GF G DPN L    +    C  +TDC  N+ C       +  C +PC   + CG N+ CIT+ H+  C C  G  G   DP   C R E C TNEDCP  + C       + C+DPCQ   C +   C V      C C +G + N      ++   C    DC     C+  ++    C P C   N C S A C +  H+  C C   Y G  D  S C +      + +C  + +C     C R      C    P     EC V     ++     CICP  +++G+     ++EG     C+ NEDC   + C     +C++ C  + CG NA C+   H  +C+C   +  +P                           S C    +        GCS N  C     C   KC DPC E   C   A+C     E++C CP+GF G PT      R P  P CT   DC  +  C    C   C++   C R   C       +C   K+   G+     FC EPGC++D +CR  + C    +C                N C    CG    C       ICSC      D    C+ P +C SD +C + L C        +KC+DPC+   C   A C+   H+  C+C P F GDP    I C  +  P  E   C      P  +A           I   C   + C    PC  +A+C    T    +  CTC +G  G    +  K +          SECS +   +   CV+PC  +  CG  AKC V NH  +C C   + G+P   C      EC  + DC  ++ C+NN+C+D C+    CG ++ CR  NH PVC C  G  G+P       EC+ N DCP                          D+VC+  +C DPC     CG+ ALC ++ HQ +C CP G  GN  VEC  +   C  D +C  + +C+     C   C   N+CA    C+      TC     +  D +    C +K   + K  C    DC  S +CI+  CQ+PC+    C P+  C+ ++    R   CVC  G     +           C+ ++ C  + +C+   C   C + S+C  N  C   +   +C   S         C         S + GC +  DC +  +C N  CI                    DPC   + C A A CR  NH+++C+CP+G  G+P   C+P + P C   ++CP    C Q  C   C     C  N VC     VQ   +   C  G V    +     GC S+ +CP+   C    CQDPC  +   CG+ A C   NH+  C C  G  GDPY  C+          N C   L C    C   C  +    C    H+ +C        D   G  C        +E  C+    +++DCP  E+C   +C+NPC   + C  N+ C+V    PL    C+C +GY       C K E      C +N +C  + +CE G+C+N C+    CG  A+C + NH+ +C C  G+ G+        + +EC  D               + C     CG+NA C ++     C C +G  GDP   C   +C T  D     +C  K  C++PC     CG +A C   +HQ +C C     GNP ++CK         EV       EC R+ +C+ +++C   +  C+  C+ ++ C  N  C +  HK KC C   ++ +      + I      +C  +  CP   +CI+  C+NPC     C   + C++     + I T+                     D C + PCG  A C      A C C  G  G+P   C +          P        G   C       P+Y    +  C+ P        PC + A C V+ ++  C C  G  G     CQ                   +++  +D C    CG  A C +   ++AIC C E Y G+P + C    C++D +CPSD++C N +CQDPC    CG  A C V  H+  C+C   +KGDPY +C              +C  + DCP    C++  CVDPC  +C   ADC+V NHQ  C C   + GDPY            +C+P     P     EC + +DCP    C+  +C +PC+  + C   A+C+V    P+    C+C  G +G   ++C  +               P   C            +PC + A C+++     C C  G  GDP Y C P    EC  D +C + + C   +C DPC+    CG NA C   NH+ +C C   + G+P  +     C  N   P +         +PC  + CG NA C    + Q IC CP+   G PY+ C+  EC ++ DC + + C     +  C+  C              P  C +N+ CE   N    C+C   Y G              +P+C  D  CP  + C+ ++C DP    C  N  C              GQK +  +SL     PL  +        ++  N +C  ++       +  C R     + N V  C+   CG N+EC +     +C+C   Y GDP   C            P C  + DCP   AC + KC +PC  ++ C I A C V  +H + C+C + Y+G PQ +C  P                 + ++ ++PC +  CG  ++         CSC  GY+G P     +P C  + +CP   AC+N +C +PC    CG N  C  K+H+  C C  G+ G+P   C           PT      E+  DPC+ C ++A C I N+   C C+ ++           I +P     EC+  +DCP + ACI  +C +PC+    C   A C V +  P+    C C+  Y G   V+C               K +Q         ++PC+ + PCG+ +  +      +C C  G+ GDPY+ C      EC   D+C  N+AC  N++C +PC     CG  AIC    H AIC CP+   GDP   C    C S+ +CP  + CI  +C  PC    CG  AEC    H S C C  G +GNPY  C + EC +  +C +   C  R  KC   C     C   A C  + H   CTCP  F GD  S       P  + GC+ + +CP S+ACI+ +C +PC + NPC +   C    T+    I C C +        +C+A +   EC +D +CP    C    C+D C   +CG  + C  + H   C+C   Y GDPYT C             GCQS+ +CP   +C NR C +PC  ++ C  NA+C    H P+CSC  GY G+P  EC+   + EC+VD DCP T AC   +C  PC    C  NA C   NH+A+C C+ G+ G+ YT         V E   CK + +C + QAC + DC +PCLF + CG ++ C   +        C C+ G+  +    C     P E  C   +DCP    C++  C++PC     C+  A C  ++H G C C A  TGDPY ++C  I       GC+SD +C   +AC +  CQNPC   + PC + A+C   +        CTC   + G    +C          C    +C    AC +  CV+PC+E + C   A C    H + C CP G  G+P   C  V   EC  D +C+  + C      C  ICN  + C   A+C  +NHR  C C P  +GD + +C          C  ++DCP   +C ++  C NPC  +  C  +  C V         VC+CP G      GS   +  L+ C + + CK D+ C      C   CN    C  GA C   +H   C C     G+    C       K EC+ D DC  +  C +++C +PC+I+  C  N +CI  +        C CP G+      KC       +C  + +C  ++ C    C+  C+V   CG NA C+   H  +C+C P   GDP   C   P   EP + A C ID+DC S  AC ++ C +PC   DPC K+A C V+    +   +C C  G++     SC  LP++    C+ DD+CP D ACI++ CK PC    CG  A+C +  HR +C C  G  G+P   C   GC+SD EC     C  +  C   CL    CG NAEC    HRA+C+    H     V   P   +                   C+C K       N++ +   P+ V GC  D +C    ACI+  C++PC     C  NA C + N  P+    C+C++G+ G  +  C+       VGC ++ +C T+  C N +C   C  D  PC   A C+   H+  CTCPPG+ G+PY  C  +   EC  +S+C  ++AC+  +C DPC     C   A C   +H+  C C  G  G   + C +    C+ D+DCP   AC+S+ C +PCL  + CG+ AKC            CVC  G +G   I+C  V+                             C  G+  L  N  E+CVC P     GFVL S  +      CR D          N +C    ++           V+D        C C E   +  NG C E   +PECR   +C   E C+  + +C D C    CG  A     +H   C C   ++G+P   C PI   +V   PP
Sbjct: 2731 AICENRNHRSVCKCPRGFSGDPHSYCYKYECKTDNDCPFDKACAKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTCRKTCSINSCGANAVCTPVIHGFKCNCFDGYTGDPNSAC-----------YQPVLNV-------------------------EPL-LEPGCSNDDDCPSYTTCR-NRQC---------------INPC-SIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQD-----LECKYDTDCSSNEA-----CINNQCIDPCTIN-----RPCGTNAECLTTN--HRSFCKCPPNHAGD------PHASCY-KYECRISDDCPF------------DKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCK---EVECRKDTDCASNEKCNLQNFRC--------------LRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCA-------EKIPQAAKLE--CQID--QDCQGTKACIE-----HGCKDPCFY-INP----CSENQECKAFASVPL----------RTVSCICPQGT----FIGSNGICQEVETKVECEYNDDCSTNDICQDGSCI----------------DACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSP-TNDCKKPIVPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPY--SFCKPYECLSDPECPNHLK-CENEKCVDPC---ECARNADCDARNHRGICTCILDFTGDPYGIACEPIPEPVIEEVECNEDRDC----PSQNACINEECDNP------------CLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCL--------------------KNNPCGNIAQCSVRNHRATCTCPVGFTG-DPNSLH---AHQGECNFDTDCPDNKACI------NNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAG---DPHSTCYRYE-CKTNEDCPFDKAC-----ASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKEL--ECRKHQDCRDNEKCDMTTY---KCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIG--DGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLK--TVSCICPSDMYIGSSGQCERVEG--TSECIVNEDCTSTDVC--YEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNP--------------------------ESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTN---CRPPKKPECTIDPDCNDAYACIRQKCQNPCSTI-TCGRNAICQARNHRAICSCIKS-FSGD--PYTFCEEPGCKSDFECRDNQAC-INRECQ---------------NPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCK-PYECLSDPECPNHLKC------KNEKCVDPCE---CARNADCDARNHRGICTCIPDFTGDPYG--IACEPIPEPVIEEVECNEDRDCPSQNA----------CINEECD--NPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYECKTNQDCPL-------------------------DKVCTSEKCVDPCDT-TQCGLKALCRTEYHQSICECPQGLQGNPYVECKSV--QCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGY--SYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDAC-SLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCI--------------------DPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPC-TSVTCGLNAVCR----VQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACYNKNCQDPCLFDE--CGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCL---VDNDCLDHLRCTNTKCVDPCACAKYAECDARNHKAYCSCLVDFTGD-PYGIACDPIPEPLKVEYECL----ADKDCPSKEVCYDQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSYCYKYECVTKDDCPFDKTCLAKN-CVDPCK-NTICGVRASCNAEHHQGICTCISGLQGNPYIMCK---------EV-------ECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQITIQTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTR-----VVILVPQEVEIGCSGDSDC-------PRYTACTNKKCINPCA---VDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQLPQKPECTKDSECANHLACIQQKCQDPCASPICGINARCRVK-RHRAICVCLENYIGDPYSVCKEAGCRSDYECPSDKACINRECQDPCLLEQCGENAECLVNNHEARCKCLSSFKGDPYVKCRSY-----------ECLVDSDCPRHLACENEKCVDPC--KCAKYADCKVTNHQGYCTCNSYYTGDPYGL----------ACEP----IPEPIEVECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQCTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCLPISTGECKHDSDCLNSESCIDNQCEDPCKVYTPCGQNAECMATNHRSVCKCRKGLIGNPHSQCYSYECKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYH-QSICHCPRGLQGSPYVTCKEIECKSDIDCNTKEKCNLENYI--CVPLCT------------DPKLCAVNANCEI-TNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDP----CQLNKPC------------LVGQKCSVSNSL-----PLRSITCECPSNEIISENGICEKIQIKTECKVDTDCARSDMCKDGNCVNACDVVKCGYNSECKQSFHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKV-VHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACIQQQCLNPCTSIACGRNAECRVTKHRALCSCRSGYIGDPYTICNEPGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPCK-CARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSVCKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACV-NNQCEDPCNNANICGYNAICETKNHRAICMCPKGFAGDPHTSCYNFECLSNDDCPFDKKCISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEVECTKDSDCLNNEECNLRLAKCNRLCQRENSCTKSAICEATRHTEICTCPTPFIGDGKSFCMEIVKPPSSPGCKVDEDCPSSNACISKQCQNPCRLDNPCSSTQKCVVFDTLPTRTISCQCSDNMYMNARGDCEAIKGLVECQTDRDCPDSDVCDDGTCVDACRKNSCGSYSTCLTSFHNSKCSCVAGYTGDPYTACYFPVPQPEPSITPGCQSDQDCPSYNSCRNRLCINPCAEDDICVINANCKVINHEPVCSCPNGYIGSPTTECQLSPKPECIVDQDCPLTKACIIGKCESPCSANICGINALCRANNHRATCVCVSGYVGDPYT---------VCEXPGCKSNLECLTTQACINKDCLDPCLFEQ-CGQNAQCNPRN----HRAMCKCKEGHKGDPYTFC----RPYE--CLVDRDCPDQLKCDHEKCVDPCQ----CAKYANCDAKNHRGYCNCIADYTGDPYGIACEPIPEPVVEEGCESDADCLSQQACIDRECQNPC-LTYRPCVENAKCKVYDTLPLRTMTCTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSC--IENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCH------SYECLSNKDCPLDKSCQNK-ICVNPC-SKTICGQNAECSV----EYHQAVCKCPRGY----QGSPYISCKLLDCHNDNDCKDDEKCDRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKSVACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLVFR-CGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNRLCIDPCVN-DPCVKNAKCRVI----YHEPVCTCSDGYIGSPQTSCE-LPSEP--ECLVDDDCPSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEEPGCKSDIECPFDKACI-SRECQNPCLYDE-CGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPDCPDHLTCKNEKCVDPCQCAKYAECDARNHRGIFPEPVEVEGCQMDKDCPSQEACIDRECQNPCLSFRPCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDR-PCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHECEQDSDCNGNKACVEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYE--YECLRDNDCPLNKACVSQKCTDPCLTTD-CGIKAKCKT----EYHRGICVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLVVDSSPSKSVSCSCREGFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQ--SGSCLDACRIRLCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPP 8509          

HSP 4 Score: 1398.65 bits (3619), Expect = 0.000e+0
Identity = 1784/6515 (27.38%), Postives = 2527/6515 (38.79%), Query Frame = 0
Query:  114 NECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGF------------HCKDIDECQIPELA--------NTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECL-PGFHGNPHDGCVDIDECR---TNP-------------CGIGAKCTNLLGNYQCQCPA--GLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDI---------------NECQSSSLYQ-------------CGVGAIC--INQSPGYRCECPAGYNGDGRFACEPVKV---RTTCSSDF-----DCTNNAQCLPN---GSCACRKGF--QPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVN-CGQRASCQIVKSEAF----CICEEGWAYNPKE--------ISSGCLDIDECDKSIS-PTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACR-DATCFPNSQCLVQNGLPFCQCLPGFKLSPNG----------------RSCID---IDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQS----CSGSSC----------SCLPPYQDIEGRCQLAD-CSNCEAPAKCVQITGGISYCACPRGYEMN--------------PRTKNCEDIDEC------QAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCL------PLRS-ACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFS-CGFNAECTPSN-PPQCLCKAGFTGNPLTGCEDLD--------ECALNP------------------CKQGSICINKLATYQCECPPGTTGDPYTNGCS-----GSKSVECGADDECHGQLACIGSQCINPCSSV-PCGSNANCVAEN----HAAWCRCKSGFAEDSQGNCVSL-------------CNQVI----------------CGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLS---CSSASPCLEQGQTCQGGRCITQCGQEQ-CGVNAFCDP--NRLSCTCQSGFLGDPTLVCMPPT--------QQAECSSE----------CGTNSHC-IYGNPNSCACNIGYFGNPYTGCEVT--TSVEDCDSLK------------------CGDNAVCSFASGKPECTCKRGYDGIPYERCQ------DVDECLF-SVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLC---ANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEK---------CSTNEDCPAGRTCHINFNGEQTCLDPCQIMS-CPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQ-GCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCT--ETCGPNALCS-----PEFENLCQCPEGFAGVPTAAQGCVRIPPTCTTDCPASSL------CFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICV-DKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCK-----PKAQCYSNSECSSDTRCQNGRCVDPC--DGFCGIGAKCVVKNHSP----KCSCLPRWRGNPKIKCELL----ECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPRECEQNLDCPGDGKCDNFVCVKP-------HEKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVEC--VRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGH------VCLDK-MCKVGCSAPKDCPNSQSCINHQCQDPC-KAAQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELC----HGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVPCSSASDCPQSKTCS--QGTCVAQCQLQGDCLQNEVCN--------------EGLCVQICNSNTQCQAGLVC-IDRQCVGGCSSNTQCPSESVCVEGKCQDPC--QNEASVCGEC-ATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKN-QCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECI--------EGVCISGCGSNRDCPYGEMCEGGQCRNPCNGFE-CEPNSFCQVNGRNPLCLCDRGYQRLASGGCAK---TECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECV----------------VDR---NDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGC---------QCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHK-CEDNERCIAQRHKP----KCTCKERLLINSAGELIC----PQQDVQCLYEDQCPSTLSCIDGACQNPC-QGTSCPDGKSCQVLNHQALCICT----------------------------------KDPCSIS-PCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVE-------------ETPKDACQP-----SPCGSKANCNINDENQAICSCWEGYFGNPLTGCL--------PECQTDQDCPSDQSCNNLKCQDPC--PGFCGIGASCEVEQHKP----TCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDDGNCVDPCP-ERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNN--CGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPK---------------------QPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDP-PYC-RPECLADHECPSHKICHQEKCIDPCE-NVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNP-------PEPLE------TDPCSACGINADCDVRPNDQVICSCPKDYLGDPY-IECRP---------ECLTNADCPSHQACLRNKCVDPCI--GTCGVNAECS-----------------------------EP-----------------------IDPC-QPNPCGLNSVCESNVNGLALCRCQNDYIGSP-----PNCRPECTEDSACPNHLKCVREKCVDPC--PGICGRNAECK------------------HTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDL--LNILGHVMRHNPMCTCLEGFIGDPYNE----GCIRKPEAIENEV-----TPCEP-----NPCGSNAECIEQNQSGSCRCIEDYVGDPFVSC--------RPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHAR---CSC---------LNDYVGDPQVECHK----PPSGIVTEEI-IDPCANRECGPYSQKVERNGICTCSCLPGYVGAP------------PDCQPICVVNSDCPAHLACINNDCVDPCFQNV-CGSNTHCYVKSHQAKCECFPGYDGNPLIGCN-------------KGPTGTITAEERDPCE--TCGQHAICHIHNNIAACKCEDNYIDKP------PNCRRECVLHEDCPKHLACIQYKCASPCI-NQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKV--------------SQPIDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPY----------TGCNYECLIHDDCPYNRACASNHRCSNPCIGN--CGVQAICNVIE----HNAICSCPEELEGDPFIRCIP------AGCRSDSECPSTEACIDRECRDPCPFQT-CGVNAECETRSHLSTCICLEGFEGNPYEGCTQY---ECKRHEECPSTLACRDFKCVDPCD----CAVGANCRVSNHKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNG-----FLFIGDFECKAPERPECVSDPECPLHLACISERCLDPCT-SQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQK-------AGCQSNSECPLSEACINRKCQDPCPFEE-------------------------------------------------CGRNADCSTNRHVPMCSCLTGYEGNPYEECRQYECLV----------DSDCPYTLACPNRECIDPCQ----CAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSCLEIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGN-------PMRECHQYECIQHNDCPNDKACIDNKCVDPCL-ETTCGQRALCKSE----FHISHCFCPPGLQGNPIVRCFQVE------CQQDGDCADNEKCDLRAQTCQLICNAQS-CVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAG-CRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPCN---CGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRC--YDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCSTFE-------CLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHM----ASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSC-VFLPTDTIL---GCVKDDECPKDSACINRMCKDPCD----CGRGAECFLTGHRPVCRCPEGTKGNPLIEC-TPIG--CQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPC---ACGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPY-VSCSTV--------ECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVEN----HQVDCTCPPGYEGTRGNSCKK----VVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVK--------TCPAGSGLILNEFEECVCPPGFVLDSQGICAPCRFDVGFIIENGRCICDYTKGFVLDLSGKKCVCPENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPI 5748
            N CK   C     C+       C C +G +G  +             C D ++C +  L         N C  +A C        C C P   GDG   C   +       C ++  C       S +C  P     P   C D  EC+   T+P              GI  +C  +  + +C+      +S     G+C            C    CG NA+C+ +S+   C+C  G+TG+P   C  +               ++C + SL +             C   A C  IN +P   C CP GY G     C P      R  C ++      +C  NA C      G C C   F   P G+ C+ I E    E  C  +  C             P       + C +PCL    C Q A C++  +       C C EG+     E        +  GC    ECD++++   GKC +N   +N+P                               C   A+C  Q    +C+C  G   DP SL    +   C+ D++C  N VC +  C+           + CR ++ C  N+ C V N  P C+CL  F   P+                 +SC     ID C    CG++A C       +CKCP G  G P   C+     +C +D+ C Q E C   R  C +               C   NVC  N+ C+       C C S + G+ ++ CQ      S S C          SC+   Q  +  C L + CS  +       +      C CP    +N                  +C D D C       A    PCG  A C     S  CSC  G  G+P     L      P++   C SN  C  +  C   KCI                +PC   S C  +A C   N  P+C C  GF G+P T C   D        EC  +P                  C + + C  +     C C P  TGDPY   C        + VEC  D +C  Q ACI  +C NPC    PC  NA C   +        C C  GF       CV +             C+  +                C + A+C V      C C  G  G+PY    C  +S   C   + C    + C   +C+  C     CG +A C+   +R  C C  G  GDP + C               EC SE          CGT + C +  +   C C+ GY GNPY  C         DCDS +                  C ++AVC   + + +C+C     G  Y  C       D  ECL  S   ++  CI+      C   S    +P + C  LE+       C      Q G N     GQC+                  S   C  + DC  +++C          C + C   +CG N+ CI + H+  C C  G+ G   DP+  C +            C  + DCP+   C       + C++PC   S C     C V    P+C C  GF  +  T      +  C  D++C    +C       + C   C  + C   A+C    HR  C CL GY+G+P   S C +   + C S+ EC   + C      R CQ  C + +CG    C   NH   C C  G   G   +  C++  C+ + DCP++  C  ++  C+DPC+   C  NA C    H+  C C P+F   P   ++CE                           I +  I    C+ +  C     CI  +C +PC   + C  NA C      P     C C EGF G     + CV+I P   T C + S       C +G C+  C     C    QCS      LC               K     C  D+DC+  + C    QCS           CS LNE    ICG G  C N     +C CP     D    C    +C +D DC    AC        +KC+DPC  ++C   A C    H++ C C    +G   NP + C +VE       C + +    D A    C   Y    + C D       N C N+AKC       +C C     GD Y    +      + +C  + +C SD  C + RC +PC  +  C     C V+N+ P     C C      +   +C+ +    EC  N DC   + C++  C   C ++  CG N+ C    HG  C+C  G+TGDP                N  C +P        E  C  D +C     C   +C +PC   + C  +A+C   NH+ VC+C  GF G    +C  + +P  C+LD+ CP  + C    C + C +   C  N +C   +    C     C  G+      VC ++ +  VGC +  +C  + +C N +C +PC +   CG +A C+V   +A C+C  G+  +P    A  ++ + C+ +  C  N  C  + C   C  +  C  N  C    H   CK  C  +        C        CR   DC  DK C N +C+                    DPC  + CG+ A C+ + H+  C CP G++GNP   C+   V C   +DC  ++ C+     C+  C    +C     C               EG     C       A L C ID+ C G             C+E  C+DPC   N  S   EC A  +     + C CP+GT       C+    +     N  C +   C  G C  +C  + +C     C   F   +C         A+          E   + GC S++DCP    C   QC NPC   + C P + C+V     LC C  G+    +  C K    EC ++ +C    +C   +C N CS S +CGKNA+CR+ NHRA C C  G+ G+    C                 ++R   N CL  N CG NA+C  +     C C  G  GDP+  C         +CP        K  C++PC     C + A C   NH+ +C C   + G+P       +G    P  E      EC    +C     CI   C +PC  +K C  N  C      P     CTC E       G+  C    P     C    +C  +L+C +  C +PC +   C +   C V NH+A C C                                   K+PC ++ PCG  AIC       +C+CP G  GDP  +C + E      C  + AC                     S  C+    DPC  + CG+ A C V  +Q  C CP GL G+P+I C+ +E             +     C P     + C SKA C   + +Q  C C   Y G+  + C         PEC+ DQDC S  +C   KC DPC     C     C+V    P    +C C          QC  +RV         +C  N+DC S  VC +G+C++ C  ++CG NA C    H  QC C  G+ G+P   C +                 P+  P C   +DCP  + C   +C+DPC+ +  C   A C+VV H+ +C+CPDG  G+P   C    RPP K                      PC    CG NA+C+    +  C C+  F GDP  +C  P C +D EC  ++ C   +C +PC    CG+NA C+   H+ IC C    +GDP+  C P         P  L+       DPC  C  NADCD R N + IC+C  D+ GDPY I C P         EC  + DCPS  AC+  +C +PC+    C  NAEC                              EP                       ++PC   NPCG  + C+   N  + C C   +IG P     P    EC  D  C ++  C+  +C+DPC     CG++A C+                  H      +C   Q   L    +  +  +P       L  L     H  +C C +G  G+PY E     C +  +  +NE        C P     N C S A C  +N   +C C     GD +  C        + EC  + DC   LAC+S  C++PC+ N  C  +  C   +    R   C C          N    + + EC K      S I  E   +D C+   CG  ++         CSC  G+ G P            P   P C  + DCP++ +C N  C+DPC ++  C +   C V +H++ C C  GY G+P   C                    I  + ++PC   TCG +A+C + N+ A C C   Y+  P      P C+ +     +CP   AC    C  PC+ ++CG+NA C   NH  +C C   + GDP   C+P                 ++ +DPC    C +  E         C+CL  F GDPY              YECL   DCP    C  +  C NPC  N  C   A C V +        C C +   G    +C+        GC+S+SEC    AC   +C +PC  Q  CG  A+C  ++H   C C  G+ G+PY  C +    EC   ++C ++  C  ++C DPC     C   A C    H+  C CP G  GDP+S             C    +CP    C+   CVDPC +  C   A+C    H+  C C +G     ++   + EC+     +C  D +C L+    S +C+  C+ S  C +NA C    H   C C  D +GD Y+ C K       A C+ +S+CP  +ACIN +C++PC                                                     CG  ADC  N H   C+C TGY GNP  +C +   LV          DSDCP   AC N++CI+PC     CA+ A C V NHK  C+C  G+ G++ T    P      +  +C +D +C +  AC    C++PC     CG ++ C+V     +    C C   Y  +    C       E GC++  +CP  + C N  C +PC  +  C   A+C V +H  +C C +   GDPYV C      C  D +C  H AC N  C +PC      C + A+C  +NH+  CTC   + G+       P+ E  + EC    DCP  KACI+ +C +PCL  + C   A CK           C C  G  G    +C +VE      C+ + D + N  C  R   C   C  ++ C S A C+  NH   C C     GD N  C     PI  G C+ D DC +  +CI + +C++PC V  PC  +  C   +       VC+C  G+       C +      C+++  C  D+ C+  KCV+PC+   CGT A+C    H  IC+CP    G+P + C+++EC++D DC   ++C   + +CV  C     C +NA C   +H+ TC+C P Y GD +  C+  E       C  + +CP    C+ ++C DPC +N+PC    +C VS  +     +C+CP       +  C         ++ EC++D+DCA S  C D +C N C  +  C  ++ C       F    C+C  G+  D  + C + +P        GC  DD+CP  +AC N  C +PC     C   A+C +  H+ +C CP+G  G+P  +C  PI   C  D EC D   C     C+  C   + CG NAEC    HRAL                 C C  GY  +    C        GC SD EC   +AC+N  C++PC    CG NA+C+ +NHR +C+C +G  GDP   CK   C  +S+C T  +C N  C   C      C  +A C+  NH+  CTC     G+PY +SC  +        EC ++ +C  ++ACI+ +C +PC   + C D A C V +      + C+C  GY G     C K    +  GC  D+ C    AC+   C NPC+   PCG  + C   +   +    C C  GY GD    C PV          C +    + N+ E+  C    +     IC           +N R IC   KGF  D           H+   N  C    +C  D  C         +  C  PCL+  CG  A  T   H   C+C  G  G+P  VC  +
Sbjct:  877 NPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKP---CSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECEIANDCKISDICVSGSCI---------DACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNP--VCTCPNGYIGSPTTVCRPHPECPDRLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDC-------------PSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKC-INPCRNNNP-------------------------------CSSSAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADNKCS-----------NPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFKYECQKNEDCPFDKSCSSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYVACK---EVQCRKDNDCGQDEKCDLQRFTCTK--------------LCSNSNVCAANARCEASRHRERCICSSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSCI--SQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCI----------------NPCAESSPCASSARCKVINHEPECTCPDGFIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPY--SQCVKISNSECKYDTDCA-SNEACINDQCVDHCVVNLPCGKDAECETIRHRSVCKCPKGLAGDPHVSCYSFECKKNEDCPFDKECKSESCVDPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCREVQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVESPC--HPSQNCRVLESYLLKTVSCECLEGTQVGTN-----GQCITV---------------QSQNECSIDNDCNQDDMCY------EGTCVNACYVERCGINAECIANFHRSKCSCYPGYLG---DPKNACYQSPTEIEPLLSPGCDVDRDCPSYTMCK-----NRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNCQPPERPECRVDAECPLDRACIH-----QKCQNPCSRLTCGKNADCKVNNHRAICTCLKGYNGDP--YSLCKL---SGCESDFECPNHQACI----NRECQNPCLFEKCGXXXECKXENHRAICHCLSG-HKGQAYV-NCKRYECLRDSDCPNHLHC--VNDKCVDPCE---CARNADCKARNHRGYCTCIPNFTGDPY-GIVCEP--------------------------IPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGFTG--KGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQAC-IENQCS---------EPCS-LNE----ICGKGAICENRNHRSVCKCPRGFSGDPHSYCYK-YECKTDNDCPFDKAC------AKEKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQG---NPYVSCREVE-------CRNDN----DCASNEKCDLRYLKCSALCSD------NNLCANNAKCEAINHQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELSTECQVNNDCQQFEICVDGTCRKTCSINS-CGANAVCTPVIHGFKCNCFDGYTGDP----------------NSACYQPVLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPE-CLLDAECPDHLACINRKCQNPCSTLT-CGDNAQCRVQRHRAICT----CLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCAPIQD-LECKYDTDCSSNEACINNQCIDPCTINRPCGTNAECLTTNHRSFCK--CPPNHAGDPHASCYKYE----CRISDDCPFDKTCLNEKCV--------------------DPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKE--VECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGT----------KACIEHGCKDPCFYINPCSENQECKAFASVPLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGSCIDACRVN-KCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKVVQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCS-SITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFEN-CGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEK--CVDPC----ECARNADCDARNHRGICTCILDFTGDP-------YGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGF--TGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACINNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCYRYECKTNEDCPFDKAC--------------------ASEKCI----DPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATN-HQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQC--ERV-----EGTSECIVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNI-----------AMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNC----RPPKKPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYTFCEEPGCKSDFECRDNQACINRECQNPCLFEKCGLNAECNANGHRAICSCLQGHKGDPYSFCKPYECLSDPECPNHLKCKNEKCVDPCE-CARNADCDAR-NHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQV-TNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVCINNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYCYKYECKTNQDCPLDKVCTSEKCVDPCDTTQCGLKALCRTEYHQSICECPQGLQGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSNCGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVINHKSVCTCPDGYIGSPETSCRPPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSD----FECPNSQACYNKNCQDPCLFDECGQNAKCFANNHRSMCVCNEGHKGDPYTFCKPYDCLVDNDCLDHLRCTNTKCVDPCA---CAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCY-DQECKNPCFFNKPCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPVCKCPNGLAGDPHSY-------CYKYECVTKDDCPFDKTCLAKNCVDPCKNTICGVRASCNAEHHQGICTCISGLQGNPYIMCKEVECR--RNNDCNFDEKCDLN----SFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIASVDTAECKVDSDCPKKQACINERCENPCFLNNPCSSSQECRIAELSQITIQTQAECTTNNDCRXTDVCLSGTCIDACKVFPCGAYADCVPNFHEARCACFTGYTGNPRSQCTRVVILVPQEVEIGCSGDSDCPRYTACTNKKCINPCAVDKPCASTAICKVINHKPFCSCRDGYIGSSETSCQLP------QKPECTKDSECANHLACIQQKCQDPCASPI-CGINARCRVK----RHRAICVCLENYIGDPYSVC------KEAGCRSDYECPSDKACINRECQDPCLLEQ-CGENAECLVNNHEARCKCLSSFKGDPYVKCRSY--ECLVDSDCPRHLACENEKCVDPCK-----CAKYADCKVTNHQGYCTCNSYYTGDPYGLACEPIPEPIEVECELDQDCPRQKACIEQECQNPCLIYSPCVTNAECKVYDTLPLRTLTCTCLKGYSGKGDEKCTRVEEIKEYGCKANSDXSPNLACIGRQ--CTSPCREKNPCSSTARCQVLNHLAICSCPVGTTGDPNYSCL----PISTGECKHDSDCLNSESCI-DNQCEDPCKVYTPCGQNAECMATN----HRSVCKCRKGLIGNPHSQCYS----YECKTNEDCPFDKHCVGQKCVNPCDTTLCGTNAVCKSEYHQSICHCPRGLQGSPYVTCKEIECKSDIDCNTKEKCNLENYICVPLCTDPKLCAVNANCEITNHKETCQCLPFYYGDGYSFCTKKEESKKKPQCQIDGDCPQQMSCIDDRCQDPCQLNKPCLVGQKCSVSNSLPLRSITCECPSNEIISENGICEKI-----QIKTECKVDTDCARSDMCKDGNCVNACDVVK-CGYNSECKQS----FHQATCQCTRGYTGDPLKECNLIIPLQEASINPGCSHDDDCPGHTACRNLKCINPCAMDEPCAITADCKVVHHQSLCTCPDGYIGSPQTDCQLPIQPECTRDYECPDNKACI-QQQCLNPCTSIA-CGRNAECRVTKHRAL-----------------CSCRSGYIGDPYTICNE-----PGCKSDFECPQQQACLNRECQNPCHFEKCGVNAMCSPKNHRGICSCIEGHKGDPYSFCKPYECLIDSDCPTNLQCNNEKCVDPCK-----CARNADCEIKNHRGYCTCQSDFTGDPYGISCDPIPEPVLVEYECIEDKDCPSNQACIDTECINPCLTYEPCADKATCKVYDTLPLRTMTCSCIEGYTGKGDVQCVKIDPIIHTGCKSDNKCAQNLACVRGNCVNPCINDSPCGDFSSCQTQNHKSV----CKCSLGYIGDPYSTCVPVNEKECQFDDECSSNQACVNNQCED-PCNNANICGYNAICE---------TKNHRAICMCPKGFAGDP----------HTSCYNFECLSNDDCPFDKKC--------ISEKCISPCLETICGNKAECTVEYHNSVCKCPSGLQGNPYVVCKEV 6893          

HSP 5 Score: 1374.76 bits (3557), Expect = 0.000e+0
Identity = 1652/5954 (27.75%), Postives = 2328/5954 (39.10%), Query Frame = 0
Query:  518 FNCVCAKGFNGDPYI--GCFDIDECAENRFI--------------CGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNG----------------RSCID---IDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRC-QLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSC--LPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPS-NPPQCLCKAGFTGNPLTGCEDLDECALNPCKQG---------------SICIN--------------KLATYQ--CECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQG----------------------NCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDP--NRLSCTCQSGFLGDPT-LVCMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKP----ECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQ----CLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQ-CGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVN-CPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCK--RSNGQRSCQPACSYLE-CGVGAVCVVRN----HVGKCICPQGLFVGNPQIEG-CRKV----SCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCP------PS---FIPSPTPEVLCEKNDRGD-------LCPFGQCQTTCASSSQCPPGQICKS--------------GICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPE-FENLCQCPEGFAGVPTAAQGCVRIPPTCT--------TDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGE--------ICVDKFCEPGCRTDSDCRLGEVCGAGG------------------------QCSCQPGYEMT-QSGCSDL--NECK----------------------NNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVE------------YPCEGFTC-----------GHGSCHPEDHAPKCHCQDGYQLIG-SNCQDI---------------------------DECASGNPCHNSAKC----TNEQGSYQCTCHDGMVGDPYT--QGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGF-CGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLE----------CVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPRECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSK-VECVRIPS------TCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGH--------VCLDKMCKVGCSAPKDCPNSQSCINHQCQDPC-KAAQCGPNALCQVIERQAFCVCQRGFIPNP-SPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQG---ISC-SQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVPCSSASDCPQSKTCSQGT--CVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQA-GLVCIDRQCVGG----CSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQL----QCQCPRGTSGDPYQSCRTNYLRCG-STKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQI--------ASDCQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCRNPC-NGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGC---AKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVD-------------------RNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQ---------CPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHK-CEDNERCIAQRHKP----KCTCKERLLINSAGELIC----PQQDVQCLYEDQCPSTLSCIDGACQNPC-QGTSCPDGKSCQVLNHQALCICT------------------------------------KDPCSISP-CGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDACQPSP------------------CGSKANCNINDENQAICSCWEGYFGNPLTGCL--------PECQTDQDCPSDQSCNNLKCQDPCP--GFCGIGASCEVEQHKP----TCRCREG-YKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDDGNCVDPCP-ERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCV--NNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRP-----------------PPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDP-------PYCRPECLADHECPSHKICHQEKCIDPC--ENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNPPEPLE------------------TDPCSA---CGINADCDVRPNDQVICSCPKDYLGDPYIEC-RPECLTNADCPSHQACLRNKCVDPCIGT-CGVNAECS----------------EPIDPCQPNPCGLNSVCES-------NVNGLALCRCQNDYIGS------------------------------PPNCRPECTEDSACPNHLKCVREKCVDPCPGI--CGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPL-IVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENE-VTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCR-----------PECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKP-----------PSGI--VTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPDC--QPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCN--------KGPTGTITAEER--DPCETCGQHAICHIHNNIAACKCEDNY-----------IDKPPNCRRECVLHEDCPKHLACIQYKCASPCI--NQCGKNADCSVINHDPI----CRCLPQYFG---DPLVKCEPP-----------------KVSQPIDPCLP-NPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNY--ECLIHDDCPYNRACASNHRCSNPCIGN--CGVQAICNVIEHNAICSCPEELEGDPFIRCIPAGCRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQYECKRHEECPSTLAC--RDFKCVDPC----DCAVGANCRVSNHKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCIS-NPCKNGATCTVNK----HEIFCACPNGFLFIGDFECKAPE-RPECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQKA----------GCQSNSECPLSEACINRKCQDPCPFEE-CGRNADCSTNRHVPMCSCLTGYEGNPYEECR---QYECLVDSDCPYTLACPNRECIDPCQ---CAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPY-VSCLEI------VTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASN----HRAVCTCPIEWVGNPMRECHQYECI------QHNDCPNDKACIDNKCVDPCL-ETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQV---ECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQAC--LNAKCVSPC----NCGTGALCDVINHTPICYCPPKYSGNPQIAC-------EKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRS----HQSTCECPPGYQGDPFVKC----STFECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEP-VEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPC---DCGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPCACGPNAVCTIENHRPVCTCKDGFYGD---------PEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVN----HQYVCTCPPGLEGNPYVSC------STVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVG-CVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKTCPAGSGLILNEFEECV----CPPGFVLDSQGICAPCRFDVGFIIENGRCICDYTKGFVLDLSGKKCVCPENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRTCGDPCLKW-PCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIV 5750
              C C +G+  +P I  GC   DEC  N+                CG  A C+ +    +C C  G   D  S         C+ D +C  N  C    C      + P CE   R+  C   + C  Q+  P C C  G    P+                 ++C++   +D C    CG +A C     + +CKCP+G  G P   C+     EC  +  C     C  +   C                 C+   VC  +++C+       C CP    G+ ++ C+       S L P   ++  C Q   C + +    CV                    TK C    EC+ +   P            + SC CP         G C  +  ++ C +N+ C + + C+ G C+ S                C    CG NA+C  S +   C C  G+TGNP   C+ +      P + G                +CIN              ++  +Q  C CP G  G P T+ C      EC  D +C   LACIG QC+ PCS   CG NA C  +NH A C C SG+  D                          C + C    CG NA+C       TC+C +G  GNPY   +C+   C S   C +    C   +C+  C   +C  NA CD   +R  C C   F GDP  + C P  +      EC  +  C        AC      NP   C V +         C +NA C      P     C C  GY G   ERC  ++  +   C  + +C      ++  C +    NP                     CG +A C++      C C  GF GD  +  ++   S   C+ + DC +N+ C +        C+DPC   Q CG N+ C   NH+  C C  GF   A D Q  C  E +C  N DCP  + C       + C++PC+   C T  +C V    PIC C  G + +      +V   C    DC     CN +S     C   C   N C + A C +  HR  C C P   G  D  S C  F +   S   EC   + C    +     CQ  C++ + C     C V +        CICP    VG   I+G C +V     C    DC  ++ C  +S +C+D C+   CG NA+C  A H  +C CP      PS   +  SPT E L     R D       LC    C   CA  S C P   C+               G     C  +  C +   C   KC DPC   C  NA C       +C C   F G P     C  IP             DCP+ + C N  C   C  +  C +  +C     L L      C++G         I ++   + GCR++S+C     C  G                          C C PG+     S CS    +ECK                      N++CG    C     S +C C  N   D   +C    +C  ++DC    +C       +  C+DPC  + C   A C+V  HK+ C CP   +G   +P + C +V+               + FTC            +  C    H  +C C   Y   G S CQ I                           + C+  NPC  S +C    T    +  C C      + +   +  +   +C SN++C     C  G C++ C    CG+ AKC  + HS  CSC   + GNP+  C L            C  N DC +  +C + KC++ C  S  C  ++RC++ NH P C+C  G  G P       DC      D +   +P+E  CL D  C D   C   +C DPC+    C  NA C ++NH+ +C+C P FTG+   + C  IP        C  D +CP    C    C + C  +  C  N  C     L    +   C  G         V +  +  VGC +  +C  + +C N +C +PC +   C   A CQV+   A C+CQ G+  +P S  V  +     C+ +  C  N  C    C   C  +  C  +  C      E  R  S C+  +   G   +SC S  C+ + DC  DK C +  C+                    DPC  + CG  A C  + H+ +C C  G +GNP   C+   V C   SDC   + C+  T  C   C+   +C ++ VC      + C+  T     G    +R         C  ++       C+   C++PC  E S C     C      L     C+C  GT       C T   +   S  N C     C+ G C  +C     C     C   F   +C           + C      IE +   GC  +RDCP   MC+   C NPC     C   + C+V    P+C C  G+    S  C    + EC  + +C  D++C   +C N CS   +CGKNA+C++NNHRA C C  G+ G+    C +                    +N CL   +CG   +C  +     C C SG  G  +  C+         CP        K  C++PC     C + A CK  NH+  C C   + G+P       +G    P  E      EC    +C     CI   C +PC  +K C  N  C      P     CTC E       G+  C    P  +  C  + +C   L C DG C NPC +   C     C V +H+ALC C                                      +PCS++  CG  AIC      ++C+CP G  GDP   C K E      C  + AC +                        E   DPC  + CG  A C+   +Q  C C  GL G+P++ C+ VE    + C  +                   C + A C   + +Q  C C   + G+    C         PEC+ D+DCPSD +C + +CQ+PC     C     C+V+ + P    +C C  G Y+ D +    V+           +CQ N DC  F++C DG C   C    CG NA C    H  +C C  G+ GDP   C           QP      P   P C   +DCP    C   QC++PC   + C + A C+ + HK +C+C DG  G P   C+ I  P                   + PC    CG NA C++ R +  C CL G++G P       P     C ++ EC     C   +CI+PC   N CG +A C  K H+  C+CP+   GDP+  C+  P + LE                   DPC+    CG NA+C +  N +  C CP ++ GDP+  C + EC  + DCP  + CL  KCVDPC  T CG  A C                  P   C+   C  ++ C S       N   L LC   N+  G                               P   + EC  D  C     C+   C DPC  I  C  N ECK                  +F+S+     PL  V  +   G  +  N +C  +E  +   YN+ C       +   +  C  N CG+N  CI       C C++ Y G+  V+C            P C  + DCP   AC + +C +PC  ++ C   A C V   H A C+C + ++G P  +C KP           P  +  + ++  +PC++  CG  +Q   +N    CSC  GYVG P     +P C  + +CP   ACIN +C +PC    CG N  C  ++H+A C C  G+ G+P   C         + P       E+  DPCE C ++A C   N+   C C  ++           I +P     EC    DCP   ACI  +C +PC+    C +NA+C V +  P+    C C+  + G   +  VK EP                  + +  I PCL  NPCG   +         CTC  GF GDP +   +  EC    DCP N+AC  N++C NPCI N  CG  AIC    H  +C CP  L GDP   C    C+++ +CP  +AC   +C DPC    CG  A C    H S+C C  G +GNPY  C + EC++H++C     C    +KC   C     CA  A C  +NH+  C CP  + GD YS    P  P +   C  + +C    ACI  +C DPC + NPC     C V        + C CP+        +C+  E   EC+ + +C     C    C++ C  + CG NA+C+   H   C C   Y G+P + C  A          GC  N +CP    C NRKC DPC  ++ C   A C    H  +C+C  G+ G+P   CR   + EC +D DC    AC  ++C +PC    C  NA C  +NH+A C+C+  F G+ YT           E+  CK D +C   QAC + +C+NPCLF + CG ++ C  +         C+C  G+  +    C    +P E  C +  +CP    C N  C++PC     C+  A C  ++H G C C    TGDPY ++C  I         C  D +C    AC N  C NPC   + PC Q AEC   +        CTC   + G     C + E +        ++C  + A     CV+PC+ E  CG  A C+   H S C C  G  G+P   C      EC  DGDC+DN+ C +  Q         +C   AIC  +NHR  C C     G+ + YC       +  C+ ++DCP    C SE +C +PC     C     C+          +C+CP G+     G+       V C     C+ ++ C   N KC   C    NC + ALC+  NH   C+C    SG+    C        K EC+ D DC     C   +C +PC +++ C  + EC           TC CP G        C    S  EC  + +C  +  C    C+D C ++  CG NA+C  + H + C C  G  G+P I C    P  EP +   C    DC S  +C ++ C +PC    PC   A C V++       +C C  G++     SC          C  D ECP   ACI + C++PC    CG  A C +  HR VC C  G  G+P   C   GC+SD EC +   C  N NC   CL    CG NA+C+   HR++C                  C +G+  +    C         C  D++C D   C N  C DPCAC   A C   NH+  C+C   F GD         PE +  E  C ++ +C +   C + +C   C  +  PC  +A C+  +        C C  G  G     C      +T+ C+ NSEC  + AC   +C +PC     C   A+C V+NHQ +C+C PGY G     C++     C  D DC +   CI   C +PC   +PCG NA C+     P+    C C  G  GD    C                  ECV    CP      ++    PC+  +  +     C  ++ +G    +SG +          +  I  +E ECR + +C   E C+  +  C   C +   C   A+    +H+ +CRC     GD  + C   I 
Sbjct:    1 MACTCIEGYE-EPIIASGCQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRNHRTTCVCTIGFTGDAYSNCSPINEDECRYDSDCPLNNACMKHQC------IDP-CE---RNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCK---EVECRHNDDCPDNAKCNLNNFKCEE--------------LCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCRE---KVVSILKPECYVDSDCPQKYACISEKCQNPCVV-------------------TKPCSLTQECKVMDSYP----------TRTVSCICPKDTRTS-LNGECSRIESKTECENNNDCGDQDVCVGGTCLNS----------------CRVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTD-CRPQPEPECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPY--SYCNAYECLSDPECPDHLH-CISEKCVDPC---KCAANAECDARNHRGYCACIIDFTGDPYGIECTPIPEPVIEEVECVEDKDCFSQE----ACISEECDNP---CTVYSP--------CVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDREC-----DHNLACENQKCINPCT---------------TRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQ--ISQGECKYDDDCPFNKACIS------NQCTDPCSNGQLCGNNAICTAQNHRALCKCPPGF---ATDSQSNCY-EYECLRNSDCPFDKAC-----VSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNV--ECKRHEDCGDQEKCNLISL---KCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIG--DGYSSC--FKREVPSDKPECNVDDDCPGLLACMSEKCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVG---IDGRCNRVQTSPECEIANDCKISDIC--VSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSPTTVCRPHPECPDRLKCENEKCVDPC--ECARNADCDARNHRGICTCIPDFTGDPYGI-ACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADNKCSNPCRSNSLCGNNAVCEVMNHSPVCKCLENFAGDPHSSCFK-YECQKNEDCPFDKSC------SSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQG---SPYVACKEVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNVCAANARCEASRHRERCICSSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINACKSRPCGVNAKCTARAHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINPCAESSPCASSARCKVINHEPECTCPDGFIGSP-----TTDCRPR---DPYSFCRPYE--CLSDPECPDHLKCENEKCVDPCE----CARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECKEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIQPVVDVGCRSNSECSPTLACRNGECLNPCIENDPCSNTAKCQVLNHNAKCICQIGYTGDPYSQCVKISNS--ECKYDTDCASNEACINDQCVDHCVVNLPCGKDAEC------ETIRHRSVCKCPKGLAGDPHVSCYSFECKKNEDCPFDKECKSESCV--------------------DPCIDTQCGTLATCTVEYHKGICKCSSGYQGNPYLSCRE--VQCRRNSDCDSKEKCNLKTYKCTPLCRKNNNCAESAVCKAENHREKCSCPTPLIGDGYSFCNRPVKPADKPECLVDSDXSRSEACISDTCKNPCIVE-SPCHPSQNCRVLESYLLKTVSCECLEGTQVGTNGQCITVQSQNECSIDNDCNQDDMCYEGTCVNACYVE-RCGINAECIANFHRSKCSCYPGYLGDPKNACYQSPTEIEPLLSPGCDVDRDCPSYTMCKNRLCINPCAEDSPCAVTAICKVIQHKPVCTCPDGFIGSPSTNCQPPERPECRVDAECPLDRACIHQKCQNPCSRL-TCGKNADCKVNNHRAICTCLKGYNGDPYSLCKLSGCESDFECPNHQACINRECQNPCLF-EKCGXXXECKXENHRAICHCLSGHKGQAYVNCKRYECLRDSDCPNHLHCVNDK--CVDPC----ECARNADCKARNHRGYCTCIPNFTGDP-------YGIVCEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVLNAECKVYDTLPLRTMTCTCIEGF--TGKGDERCVKIEPIIETGCRSDSECDRKLGCRDGDCINPCIKDNPCHTSAQCSVRSHKALCSCPVGYAGDPYSFCKKILTHECNYDNDCQRTQACIENQCSEPCSLNEICGKGAICENRNHRSVCKCPRGFSGDPHSYCYKYECKTDNDCPFDKACAK------------------------EKCIDPCKDTFCGTRAECVTEFHQSTCKCSQGLQGNPYVSCREVECRNDNDCASNEKCDLRYLKCSALCSDNNLCANNAKCEAIN-HQERCVCPSQFTGDGYAYCSEIVRRPDEPECRVDKDCPSDMACISARCQNPCIVNKPCLQNQICKVQNNDPLKTVSCECPSGTYESDGFECKEVELS--------TECQVNNDCQQFEICVDGTCRKTCSINSCGANAVCTPVIHGFKCNCFDGYTGDPNSACY----------QP-VLNVEPLLEPGCSNDDDCPSYTTCRNRQCINPCSIGSPCAKSAICKPINHKAVCTCLDGFVGTPSTDCRPINVPECLLDAECPDHLACINRKCQNPCSTLTCGDNAQCRVQRHRAICTCLSGYIGSPHTVCEEQPVVDVGCRSNSECSPTLACKNGECINPCIENNPCGTSAQCKVKRHEANCICPAGYNGDPYSNCA--PIQDLECKYDTDCSSNEACINNQCIDPCTINRPCGTNAEC-LTTNHRSFCKCPPNHAGDPHASCYKYECRISDDCPFDKTCLNEKCVDPCDTTRCGSKAICKAEYHKGSCECPNGLQGNPYIFCKEVECRKDTDCASNEKCNLQNFRCLRLCSDNNNCAGFANCEASNHRERCICPPPFEGDGYSYCAEKIPQAAKLECQIDQDCQGTKACIEHGCKDPCFYINPCSENQECK------------------AFASV-----PLRTVSCICPQGTFIGSNGICQEVETKVECEYNDDCSTNDICQDGSCIDACRVNKCGANTRCISSFHRSECVCLQGYTGNAQVACYLPITPNEPSLVPGCTSDQDCPSYTACRNRQCINPCAEDKPCAPTANCKV-VQHKALCTCPDGFIGSPTNDCKKPIVPECLSDPECPDHLACIQQKCQNPCSSITCGKNAQCRVQNHRAICSCFGGYVGDPYTACEEPGCKSDFECPNKQACINRECQNPCLFENCGINAECSPENHRAVCACLKGHKGDPYSFCKPYECLSDPECPNHLKCENEKCVDPCE-CARNADCDARNHRGICTCILDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPIIHTGCRSNTECAVSLACENANCISPCLKNNPCGNIAQCSVRNHRATCTCPVGFTGDPNSLHAHQGECNFDTDCPDNKACI-NNQCKNPCIVNKPCGSNAICITEIHRPVCKCPPGLAGDPHSTCYRYECKTNEDCPFDKACASEKCIDPCQTTLCGSKAICNVEYHQSSCKCPAGLQGNPYINCKELECRKHQDCRDNEKCDMTTYKCTPLCTGSNKCASKATCEATNHQEKCFCPSNYIGDGYSFCSLPIEPAIEPECRVDQDCQSVFACIRDKCTDPCFTNNPCLPLQECKVLNSSPLKTVSCICPSDMYIGSSGQCERVEGTSECIVNEDCTSTDVCYEGSCINACLIKKCGFNAQCSTILHDAQCKCFEGYTGNPESGCNIAMVHVEPSLEPGCSYNDDCPSYNQCRNRKCIDPCIEDKPCTITAICKVVHHESVCTCPDGFVGSPTTNCRPPKKPECTIDPDCNDAYACIRQKCQNPCSTITCGRNAICQARNHRAICSCIKSFSGDPYT---------FCEEPGCKSDFECRDNQACINRECQNPCLFEK-CGLNAECNAN----GHRAICSCLQGHKGDPYSFC----KPYE--CLSDPECPNHLKCKNEKCVDPCE----CARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECNEDRDCPSQNACINEECDNPCLM-YKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKIEPVVDVGXRXXSECSPNLAXRXQNCVNPCINENPCGAYAKCQVTNHRSQCDCGIGFIGDPYSSCVPASNEECNYDGDCSDNQVC-INNQCIDPCKEKSTCGKDAICRTENHRPVCKCPQGQAGNPHAYC------YKYECKTNQDCPLDKVCTSE-KCVDPCDTTQ-CGLKALCRT----EYHQSICECPQGL----QGNPYVECKSVQCRKDQDCRDNEKCNLQNFKCSPLCLGKNNCASQALCEARNHKETCHCASHLSGDGYSYCFEKRPLVPKAECQTDGDCRGSLACISKICQNPCQLNDPCSPSQECKTLDTLPFRTVTCVCPSGTTIGLNYNCQRVESRPECEKDRDCDSSSICNEGTCVDACSLSN-CGVNAECATTLHDSICSCHSGHTGNPRIACYLPLPTVEPSLTPGCSNHQDCPSYTSCRNRLCIDPCIEDTPCAAGATCRVIN----HKSVCTCPDGYIGSPETSCR---PPIKPECRYDTECPDHLACIQQKCQNPCTSVTCGLNAVCRVQNHRAVCSCLGGYVGDPYKFCDEPGCKSDFECPNSQACY-NKNCQDPCLFDE-CGQNAKCFANNHRSMCV-----------------CNEGHKGDPYTFCKPY-----DCLVDNDCLDHLRCTNTKCVDPCACAKYAECDARNHKAYCSCLVDFTGDPYGIACDPIPEPLKVEYECLADKDCPSKEVCYDQECKNPCFFNK-PCTQNAECRVYDTLPLRTMTCVCVQGYTGKGDEQCVKIEPITTIGCKSNSECGDNLACEIGKCLNPCTTQRPCGSYAKCNVQNHQPECSCSPGYTGDPYALCQETSTKECTSDDDCQTSETCIQYQCTDPCQYNKPCGKNALCSSEKHRPV----CKCPNGLAGDPHSYCYKY---------------ECVTKDDCPFDKTCLAKNCVDPCKNTICGV--RASCNAEHHQGICTCISGLQ---------GNPYIMCKEVECRRNNDCNFDEKCDLNSFKCIRLCSQSNICAINAFCESVNHKEKCRCPTDMIGDGYSFCDKKIA 5550          

HSP 6 Score: 972.23 bits (2512), Expect = 0.000e+0
Identity = 705/2011 (35.06%), Postives = 979/2011 (48.68%), Query Frame = 0
Query: 3904 TCSCLPGYVGAPPDCQPICVVNSDCPAHLACINNDCVDPCFQ-NVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPCETCGQHAICHIHNNIAACKCEDNYIDKPPNCRRECVLHEDCPKHLACIQYKCASPCINQ--CGKNADCSVINHDPICRCLPQYFGDPLVKC-------------EPPKVSQP-IDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCN-YECLIHDDCPYNRAC-ASNHRCSNPCI--GNCGVQAICNVIEHNAICSCPEELEGDPFIRC-------IPAGCRSDSECPSTEACIDRECRDPCPF-QTCGVNAECETRSHLST----CICLEGFEGNPYEGCTQYE----CKRHEECPSTLACRDFKCVDPCD---CAVGANCRVSNHKTTCTCPPGFTGDPY---SRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCISN-PCKNGATCTVNKHEIFCACPNGFLFIGDFECKAPERPECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQKAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQYECLVDSDCPYTLACPNRECIDPCQCAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSCLEIVTG-CKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQVECQQDGDCADNEKCDLRAQTCQLICNAQS-CVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEA-GCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPCN---CGTGALCDVINHTPICYCPPKYSGNPQIACEKLE----------CRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCSTFECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDP-SIGCSPQP-PVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPCD----CGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIG---CQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPC---ACGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHEC--INGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTV-------ECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVEN----HQVDCTCPPGYEGTRGNSCKKVVVG--CVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGD-------ASIQCTPVKT--------CPAGSG----------------------LILNEFEECVCPPGFV---------LDSQGICAP--CRFDV----GFIIENGRCI--CDYTKGFVLDLSGKK--CVCPENHSINDNGI-CE-------EEPECRVDPNCTPFEYCEGFNRTCGDPCLKW-PCGPFA----YGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPPPVDI 5758
             C+C+ GY    P     C  + +C ++ AC N  CV+PC   N CG    C V++H+  C             C  G TG                               D Y +  P    EC    DCP + AC++++C  PC     CG  A C   +H P+C C     GDP   C             E   V +  +DPC    CG N +      N IC C  G  G PY  C   EC  +DDCP N  C  +N +C   CI  G C   AIC   +H   C CP  L GD +  C       +   C  DS+CP   ACI  +C++PC   + C +  EC+      T    CIC +    +    C++ E    C+ + +C     C    C++ C    C   A C  S+H++TC+C  G+TG+P     R        L  GC+ N +CP   +C N  C++PC  + PC   ATC V  H+  C CPNG++     +C+    PEC  D +C  HLACI ++CL PC+   CGVNA+C V  H  +C+C   YVGDPY+VC++ GC+++ ECP ++ CINR+CQ+PC FE+CG NA+CS   H   C C  G++GNPY  C  YECL D +CP  L C + +C+DPC+CAANAEC  +NH+  C C+  F G+ Y   C+PI EPV+E+ +C +D DC S++AC   +C NPC    PC  ++ C+V+DT+P RT+ C C  GYT  G++ C++    I+ GC++ ++C  +  C N  CINPCTT+  C   A+C V++H   C C  G TGD Y  C++I  G CK DD+C  ++AC +  C +PCS     CG  A C A NHRA+C CP  +  +    C++YEC++++DCP DKAC+  KC++PC  T CG RA C  E+H   C CP GLQG+P + C  VEC++  DC D EKC+L +  C+ +C+ ++ C + A+CEA NHR+ C C PPL+GDG   C  +  P +   C +D DCP   AC+SE +CQ+PC    PC+  Q C+V DT PT+TV C CP    VG  G C    +   CE ++ CK    C++  C+  C    CG  A+C   +H   C CP  Y+GNP   C  +           CRNDDDC  +  C + +C++PC  D+ C   A C   +H   C CP GY G P     T  C  + ECP    C   +C+DPC     C RNA C    H   C C P   GDP  I C P P PV E  E EC  D DC S  ACI++ C NPC    PC ++A C V DT+P RTM C C  G+       C+ +     +GC  + EC ++ AC N  C +PC     C   A C    H+P C C  G  G+P   C+P     C+ D +C    VCA N  C   C   S CG+NA              C V++ SP    VC+C + +  + ++ C         C  +++C   ++C +  C DPC    CG NA C++E H+ +C C  G  G P + CKEV C+ +++C    +C      CT +C   +V C  +A C+   H+  C C     G+ Y  C  +       EC  + +C    +CI++ CQ+PC++++ C    +C V +      V C CPP        +CK+V     C  ++DCP    C   TC N C  + PCGVNAKCT        +  C C  G+EG+       A +   P+K         CP+ +                        ++N   EC CP GF+          D    C P  C  D         EN +C+  C+  +    D    +  C C  + + +  GI CE       EE EC+ D +C     C   N  C +PCL + PC   A    Y T       C CIEG+TG  +  C  I     P VD+
Sbjct:    2 ACTCIEGY--EEPIIASGCQSDDECDSNQACRNRVCVNPCTNSNPCGVLAECSVRNHRTTC------------VCTIGFTG-------------------------------DAYSNCSPINEDECRYDSDCPLNNACMKHQCIDPCERNRPCGTKAICRTQSHKPVCMCPEGLAGDPHAFCYEFECKINNDCPFEKACVEEKCVDPCKSTKCGTNAKCSVEYHNAICKCPQGLQGSPYLSCKEVECRHNDDCPDNAKCNLNNFKCEELCISSGVCAPSAICETYKHRETCVCPPPLTGDGYSYCREKVVSILKPECYVDSDCPQKYACISEKCQNPCVVTKPCSLTQECKVMDSYPTRTVSCICPKDTRTSLNGECSRIESKTECENNNDCGDQDVCVGGTCLNSCRVHPCGPNAQCIASSHRSTCSCSRGYTGNPQDSCQRIQVTGATPLQPGCDSNQDCPTYSSCRNRLCINPCAEDKPCSLYATCRVINHQPVCTCPNGYIGSPTTDCRPQPEPECRLDSDCSDHLACIGQQCLTPCSRNTCGVNAQCRVKNHRAICSCLSGYVGDPYSVCEEPGCRNDFECPDTQTCINRECQNPCLFEKCGENAECSPRNHRATCKCNKGHKGNPYSYCNAYECLSDPECPDHLHCISEKCVDPCKCAANAECDARNHRGYCACIIDFTGDPYGIECTPIPEPVIEEVECVEDKDCFSQEACISEECDNPCTVYSPCVENANCKVYDTLPLRTMTCICIEGYTGKGDERCVKIEPIIDVGCRSDRECDHNLACENQKCINPCTTRTTCGFSARCSVKNHKMYCNCEVGFTGDAYSKCIQISQGECKYDDDCPFNKACISNQCTDPCSN-GQLCGNNAICTAQNHRALCKCPPGFATDSQSNCYEYECLRNSDCPFDKACVSEKCINPCKNTLCGTRAECSVEYHKPICKCPKGLQGSPYIECKNVECKRHEDCGDQEKCNLISLKCEKLCSGRNKCAASAVCEASNHREKCVCPPPLIGDGYSSCFKREVPSDKPECNVDDDCPGLLACMSE-KCQDPCTFNKPCSDSQECKVFDTSPTKTVACICPTDTVVGIDGRCNRVQTSPECEIANDCKISDICVSGSCIDACKVNPCGVNAICKSASHDSRCSCPNGYTGNPSHECYFVSPTSEPLLTPGCRNDDDCPTYSLCKNTMCINPCAEDSPCAPTANCQVINHNPVCTCPNGYIGSP-----TTVCRPHPECPDRLKCENEKCVDPC----ECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIE--EVECNEDRDCPSQNACINEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCIKIEPVVDVGCRSNSECDRNLACDNGKCINPCRNNNPCSSSAICRTQNHQPTCECSPGFTGDPYSLCSPTREDECKHDEDCPSNMVCADN-KCSNPCRSNSLCGNNA-------------VCEVMNHSP----VCKCLENFAGDPHSSCFKYE-----CQKNEDCPFDKSCSSNNCIDPCQNTVCGRNAECSVEYHKSICKCPSGLQGSPYVACKEVQCRKDNDCGQDEKCDLQRFTCTKLCSNSNV-CAANARCEASRHRERCICSSPYTGDGYSFCQKIVVPASKSECNVDEDCPSKLSCISQTCQNPCSLNNPCSTSQECKVADTLPSRTVACICPPNTYVNGFGNCKRVETATECQSNNDCPDTDVCDRGTCINAC-KSRPCGVNAKCTAR----AHSSVCSCFDGFEGNPQSICNLAPLLVEPIKEPGCDSNQDCPSHAACKDRKCINPCAESSPCASSARCKVINHEPECTCPDGFIGSPTTDCRPRDPYSFCRPYECLSDPECPDHLKCENEKCVDPCECARNADCDARNHRGICTCIPDFTGDPYGIACEPIPEPVIEEVECKEDRDCPSQNAC--INEECDNPCLMYKPCVQNAECKVYDTLPLRTMTCTCIEGFTGKGDERCVKI----QPVVDV 1919          

HSP 7 Score: 272.322 bits (695), Expect = 2.407e-72
Identity = 520/2087 (24.92%), Postives = 738/2087 (35.36%), Query Frame = 0
Query:   97 CYCNDGYGGKG---CDM---------PDTNEC----------------KYRPCDVFGYCTNTLGSFFCSCNEGYEGDGF---------HCKDIDEC------------QIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQ--------------------VCGINTLCINTHGNFSCECLPGFHGNPHDGCVDID-----ECR------------------TNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQ----------------GACQAQVA--PSVSQQGC--------NAQSCGQNALCQRSSNGLICTCREGFTG---------DPKISCVDINECQSSS------------LYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTP---------PE---------------QPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEI--SSGCLDIDEC--DKS-ISPT-------GKCGVNAICSNSPGSFNCVCAKGFNGDPYIGC------FDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSS----LSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPF----CQCLPGFKLS----------------PNGRSCID---------IDECAGN-PCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSC--------------QSCSGSSCS--CLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNP----------RTKNCEDIDECQAIGH---------TPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRS---ACSSNSQCRENEECLQGKC-----------------------------ICSPPFFVDT------LDGN------------------HCKSPCHRFSCGFNAECTPSN-PPQCLCKAGFTGNPLTGCEDL------------------------------DECALN-PCKQGSICINKLATYQCECPPGTTGDPYTN-GCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSL-------------CNQVICGS----------NAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQ-CGVNAFCDP--NRLSCTCQSGFLGDPTLVCMPPT-QQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLK-CGDNAVCSFASGKP----ECTCKRGY------DGIPYER-----CQDVDECLFSV------------CGKNAQCINTPGGYDCRCHSDFVGNP-----------------FEGCVHLEAVTE---DDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQ-CGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQR--EEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMS-CPTNEKCMVSDGMPI----CLCNSGFEKNKLTGSCD---VYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQ-NEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCT--ETCGPNALCS-----PEFENLCQCPEGFAG 1750
            C C +GY GKG   C++             EC                +  PC     C+       C+C  G+ GD +          C   DEC            QI  + N C +NA C       +CKC PG  GD    C    ECL+N+                    +CG N  C   +    C+C  G+ G+P+  C  +D     +C+                   + C IGAKCT      +C C   L GD Y                   C   +A   SV Q  C        N Q   +N +  +S   + C C +G +           P+  C D ++C+SS             +++CG  A+C +    + CEC   + GD   AC    +    S    CT +  C    +C  R        LC  ID C    +PC  N+ C  +  +  C C    +G+P         PE               Q C+ PC    CG  A C +    A C+C  G+  +P +I    GC    EC  DK+ IS          +CGVNA C        C C KG  G+PY+ C      +D D        C     C N+     CQC    + D  +         +   CQ D++C     C +    CQ P +            C  N++C V N LP     C C  G+                    N R C           ++ CA + PC Q A CE       C CP G  GDP S C      EC QDS C+  ++C+   C+                + C+    CG N++CK +     C+C SG  G+P + C              ++C    C+  CL     I+ +C+              +   GI  C C  G + +P          + ++C+  ++C    +          PC  GA CL       C C P   G+ F    LP+++    C  +  C     C+  KC                              C   F+V        +DG                    C   C    CG NA C   N    C C+  F+GNP   C  +                              D C +N PC + + C        C CP G  GDP          S+ C AD +C    AC+ ++C++PC+   CG NA C   NH A C C SGF+ + +  C  L             C++  C +          N +CI S     C+C   M G+PY    C  + C+    C  + + C   +CI  C  +  C  NA C    +  SC C    +G+P + C+       E   EC  +S C    P+  AC   Y  NP            C SL  C  +A+CS     P     CTC+ G+        IP E      C   DEC  +             CG  A+C  +     C+C   F+GNP                  E CV    V     +D    + +C PN   +  QC C  GF+GD       GCS    C+++++C   + C       +R C DPC +   C   + C++ +H   C C+ G+ G   DP   C      +C  + DC  G  C IN    + C +PC+++  C     C V + +P+    C C  G+ K +L G      +  GC  + DC+   SC         C   C    C   A+C    H+  C C PG+ G+P+     +  +   C S+ EC E+  C+     + C      L CG  A C    H   C CP GL  GNP +  C  VSC +N DCP ++ C  ++  C D C  +  CG  + C V  H+  C C   FI                    G   T+C   S                C  +  C   + CI  +C +PC   E CG NA CS     P     C C EG+ G
Sbjct: 7399 CTCFEGYSGKGDEKCELITEPVVVGCTSDKECSTSLACDNGNCVNPCIEESPCTSTAKCSVRNHKAACTCPIGFNGDPYSLCVPVEDKECSYDDECSRTQSCIENQCIQICNVNNPCSRNALCIMQNHRPICKCPPGTIGDPHNFCHSY-ECLSNKDCPLDKSCQNKICVNPCSKTICGQNAECSVEYHQAVCKCPRGYQGSPYISCKLLDCHNDNDCKDDEKCDRKTYTCYKVCNSNDECAIGAKCTARDHLKKCTCSHPLIGDGYSVCIEPPESIKPECQIDSDCSTNLACMNSVCQNPCVINKPCENNQQCIVENTIPIKS---VACVCPDGHSTGKDGKCKKVTPQPQCYDSSDCRSSEVCHTGTCITACLVFRCGDNAVCKSFDHSFACECLPNFVGDPHDACLHAPITIEPSLTAGCTIDTDCPSYNACHNR--------LC--IDPC--VNDPCVKNAKCRVIYHEPVCTCSDGYIGSPQTSCELPSEPECLVDDDCPSDLACIHQSCKTPCSTSTCGINAKCNVKSHRAICVCIAGYDGDPYQICEEPGCKSDIECPFDKACISRECQNPCLYDECGVNAECIPKSHRAMCKCKKGHKGNPYVHCKPYECLYDPD--------CPDHLTCKNEKCVDPCQCAKYAECDARNHRGIFPEPVEVEGCQMDKDCPSQEACIDR--ECQNPCLSFR--------PCVENAECRVYNTLPLRTMTCSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHECEQDSDCNGNKACVEYECI----------------DPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEYECLRDNDCPLNKACVSQKCTDPCLTTDCGIKAKCK-------------TEYHRGI--CVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACINRKCQNPCSRRNPCLPSETCLVVDSSPSKSVSCSCREGFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDACRIRLCGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECKPPTPLSIGCSADSDCPVVEACLNTKCVDPCN---CGENALCRKINHKAVCFCPSGFSGNPEVLCEKLECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPY--SLCVDVECAINEDCNSE-RACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDC----PSQLACLNDYCENP------------CYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCNCGGGAKCFLSGHRPICQCPEGFIGNPQIECNPAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNL--HNAQCECDEGFEGDP----YTGCSIIG-CKSDSECPNKKACR------NRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQG---DPYESCTVIPPPECVEDGDCTTGMAC-IN----EKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCINAI-----CRSPC---ACGLNADCKIIDHQPVCTCKPGFYGDPE-----IECTDTVCQSDNECQETHACRNGECTQVC--GADNLPCGGEAECRGVAHQATCYCPAGL-TGNPFV-TCNIVSCSDNSDCPTDKEC--INKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFI--------------------GNKGTSCVKVS--------------VTCEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEG 9324          

HSP 8 Score: 191.815 bits (486), Expect = 5.531e-48
Identity = 382/1544 (24.74%), Postives = 534/1544 (34.59%), Query Frame = 0
Query:   97 CYCNDGYGGKG---CDMPD--------------------TNEC-----KYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDI----------NECQSSSLYQ----------CGVGAICINQSPGYRCECPAGYNGDGRFACE-PVKVRT-TCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDI---------------------DECAENRFI--------CGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEK---RRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSP----NGRSCIDIDECAG----------------NPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQL-ADCSN------------------CEAPAKCVQITGG---ISYCACPRGY----------EMNPRTKNCEDIDECQA-------IGHTP--CGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPS-NPPQCLCKAGFTGNPLTGCED--------------------LDECAL-NPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSV-PCGSNANC-VAEN---HAAWCRCKSGFAEDSQGNCVSL------------------CNQVI------CGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQ--CGVNAFCD--PNRLSCTCQSGFLGDPTLVCMP---------PTQQA----------ECSSECGTNSHCIYGNPN-SCACNIGYFGNPYTGCEVTTSV-----EDCDSLK----------------CGDNAVCSFASGKP----ECTCKRGYDGIPYERCQDVDECLFS---VCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEA---VTEDDDLCA-NQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDAN 1390
            C C +GY GKG   C++                        EC     K RPC     C        C+C  G  GD +    I E    E  + C  N  C                    VE   ID C+ ++ CG N +C        C+C  G  G+PH  C + +  R N C                        P   AC +Q         C    CG  A C+   +  IC C EG  G P I C ++          NE    + Y+          C  GA C+ Q+   +C C     G+G   C  PVK     C  D DC +   C+ N  C                      +NPC   + CL  P +  C  +           CR+       G+   C  V  +  C       YN +  S  CLD   C   +     CG+NAIC        C C   F+G+P + C  I                     ++C  N+ +        CG++A C        C+C  G + DP S+ C+        C +D +C     C N  C      V P          C  N+ C   N    C C  GF  +P        C   ++C+                 NPC  +  C        C+CP   NGDP S C      EC  +  C+   +C   +C+                + C+L N C  N++CK +  +  C C     GNPF SC           P   ++E  C + +DC +                  C   A C  +         C C  G+             P    C   DEC +       +   P  CG GA C  +     C CP G  G+P Q  C P  + CSS+ +CR  E C++  C+ +P    D               CG +A+C P+ +  QC C  GF G+P TGC                      +D C   NPC   + C+++    QC C  G  GDPY   C+     EC  D +C   +ACI  +C NPC  + PC   A C V E+       C C  G+ +     C +L                  C   I      CG NA C +    P C C  G  G+  P   C+   C S + C E    C+ G C   CG +   CG  A C    ++ +C C +G  G+P + C           PT +             S+ CG+ S C   N    C+C +G+ GN  T C V  SV     EDC S +                CG NA CS     P     C+C  GY+G     C  V  C  +   +     +C+  P G+       F  N  E    L+    +  ++  C  N   G     + G+C C  G + ++       C     C+ + DC   + C     +    CS+PC +  CGPN+F    +H   C C  G++GD N
Sbjct: 8093 CSCREGYSGKGDEKCELITEPIVVGCSNDRDCSTSLACRNTECVNPCAKDRPCAQTARCEVNRHKSHCTCPPGMTGDPYSICVIIEDHECEQDSDCNGNKAC--------------------VEYECIDPCIKDKPCGRNAICKTIDHRPVCKCQSGTAGDPHSFCYEYECLRDNDC------------------------PLNKACVSQKC----TDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHACI-NRKC----------------------QNPCSRRNPCL--PSE-TCLVVDSSPSKSVSCSCRE---GFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDA--CRIRL-----CGINAICVAENHESTCACRIRFSGNPEVACLPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDP-SIECKPPTPLSIGCSADSDCPVVEACLNTKC------VDP--------CNCGENALCRKINHKAVCFCPSGFSGNPEVLCEKLECTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLC---VDVECAINEDCNSERACYQDKCI----------------DPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKE-------PSPIEVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWIPQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCNCGGGAKCFLSGHRPICQCPEGFIGNP-QIECNP--AGCSSDKECRSTEACVEASCV-NPCLIND--------------PCGVHAKCAPNLHNAQCECDEGFEGDPYTGCSIIGCKSDSECPNKKACRNRDCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPY-ESCTVIPPPECVEDGDCTTGMACINEKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCINAICRSPCACGLNADCKIIDHQPVCTCKPGFYGD--PEIECTDTVCQSDNECQET-HACRNGECTQVCGADNLPCGGEAECRGVAHQATCYCPAGLTGNPFVTCNIVSCSDNSDCPTDKECINKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFIGNKGTSC-VKVSVTCEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECFPVKTCPANSGLILDNREECV-CPTGF------GFTENKDECIPCLKENGFILNNEGKCVCNDARGYEYNPDSGKCECPPGERLNN----FGICERVPDCEEDPDCPTQKYCEKTNGT----CSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPN 9473          

HSP 9 Score: 132.109 bits (331), Expect = 5.817e-30
Identity = 299/1276 (23.43%), Postives = 437/1276 (34.25%), Query Frame = 0
Query:  113 TNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGF-HCKDID-----ECQIPE--------------LANTCVQNAECCNLPAHYVCKCKPGFEGDGKV-----------ECRDIDECLTNQVCGINTLCINTHGNFSCECLP---------------------GFHGNPHDGCVDI------------------------DECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQ---GCNAQS----------------------CGQNALCQRSSNGLICTCREGFTGDPKISCVD----------------INECQSSSLY---QCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTN---------------------NAQCLP-NGSCACRKGFQPNG---VLCQDI-----DECQS--------------TENPCGANSICLNVPGDYECQCIAPLVGTP------------------------PEQP------CRDPCLEVN-CGQRASCQIVKSEAF----CICEEGWAYNPKEISS----------GCLDIDECDKSISPTGK-------CGVNAICSNSPGSFNCVCAKGFNGDPYI-----GCFDIDECAENRFI--------------CGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDAC-RDATCFPNSQCLVQNGLPFCQCLPGFKLSP-------------------NGRSCIDIDECAG-----NPCGQDAICENL----LGSFVCKCPKGTNGDPLSGCRGESTF--ECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSC-QSCSGSSCSCLPPYQDIEGRCQL---ADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTK----NCEDIDECQAIGH-------------TPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGK----CICSPPFFVDTLDGNHCKSPCHRFSCG--------FNAECTP------------SNPPQCLCKAGFTGNPLTGCEDLDECALNPC---------KQGSICINKLATYQ-------CECPPGTTGDPYTNGCSGSKSVECGADDECHGQLAC--IGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSL 1059
            T+ C    C +   C        C C EG +G  F  CK+++     +C+  E                N C + A C        C C+P   G+G V           ECR  D+C +   C IN  C N     +  CLP                     GF+   +  C+++                        D CR   CGI A C        C C    SG+P + AC   ++P V +    GC + S                      CG++A C+ + +  +C C EGF GDP I C                  +  C ++       CG  A+C   +    C CP+G++G+    CE ++    C+SD DC+N                     N +C+P N    CR     NG    LC D+     ++C S               +NPC  N++C  V     C CI PL+G P                        P Q       C +PC  +  C   A C +V +  F    C C EGW   P+E  S          GC+  DEC  + +   +       CG  A C  S     C C +GF G+P I     GC    EC                    CG  A C   + +  C+C  G + DP +         C+SD EC     C N            +C D C +D  C   + C+ ++    C+C  G++  P                    G +CI+ ++C        PC + AIC  +    +    C+CP G     L GC+        C ++  C    SC+++ C       R+P               CG+N+ CK +     C C  GF G+P   C  +   S   C   +    G C     AD   C   A+C  +    + C CP G   NP       +C D  +C                   PCGS ++C        CSC  G  G+    SC+ +   C  +  C   + C++ +    C+ + P  ++     +   P    +C          + EC P             N  +C+C  GF        E+ DEC   PC          +G    N    Y+       CECPP   G+   N     +  +C  D +C  Q  C      C NPC+  PCG NA     +H   C+C  G++ D    C+ +
Sbjct: 8261 TDPCLTTDCGIKAKCKTEYHRGICVCEEGLQGSPFIECKEVECRKERDCKTNEKCDMNTYKCFPLCDFENPCAEGASCLAQNHKEKCVCQPPLLGNGFVLCSLPVKTEEPECRIDDDCPSKHAC-INRKCQNPCSRRN-PCLPSETCLVVDSSPSKSVSCSCREGFYVGKNGDCIEVDGQPECRSHSDCRYNEQCQSGSCLDACRIRLCGINAICVAENHESTCACRIRFSGNP-EVAC-LPISPLVVEALPPGCRSDSECPTYNQCQNNKCVDPCIVNDPCGKDAFCKVNYHVPLCRCPEGFEGDPSIECKPPTPLSIGCSADSDCPVVEACLNTKCVDPCNCGENALCRKINHKAVCFCPSGFSGNPEVLCEKLE----CTSDEDCSNDKMCHENTCANPCILLNPCAINGECIPSNHVSKCRCPSDMNGDPYSLCVDVECAINEDCNSERACYQDKCIDPCVLDNPCAPNALCKTVQHASSCVCIPPLIGNPFVSCVEKEPSPIEVEKECVVDSDCPSQLACLNDYCENPCYSLTPCHTSAMCSVVDTSPFRTMVCTCREGWI--PQEDRSCIPIETPNPPGCVKDDECPSNEACVNRMCRNPCNCGGGAKCFLSGHRPICQCPEGFIGNPQIECNPAGCSSDKECRSTEACVEASCVNPCLINDPCGVHAKCAPNLHNAQCECDEGFEGDPYTGC---SIIGCKSDSECPNKKACRNR-----------DCIDPCLKDNPCAVFANCVSRDHFAQCRCKVGYQGDPYESCTVIPPPECVEDGDCTTGMACIN-EKCDNPCEVLKPCAEQAICHVIESLPVKPMTCECPDGYVKGELKGCKTLPPIISGCERNDDCSNSTSCINAIC-------RSPCA-------------CGLNADCKIIDHQPVCTCKPGFYGDPEIECTDTVCQSDNECQETHACRNGECTQVCGADNLPCGGEAECRGVAHQAT-CYCPAGLTGNPFVTCNIVSCSDNSDCPTDKECINKLCTDSCSISNPCGSKSECKVKNHKVDCSCALGFIGNK-GTSCVKVSVTCEVDEDCPSKQSCIEKECLNPCVYNEPCGINAYCSVYDTVPVRTMTCSCIEGYEGDASIECFPVKTCPANSGLILDNREECVCPTGFGFT-----ENKDECI--PCLKENGFILNNEGKCVCNDARGYEYNPDSGKCECPP---GERLNNFGICERVPDCEEDPDCPTQKYCEKTNGTCSNPCTRNPCGPNAFGDPYDHICHCQCIKGYSGDPNLGCIPV 9479          
BLAST of GH13743 vs. L. salmonis genes
Match: EMLSAG00000001609 (supercontig:LSalAtl2s:LSalAtl2s1280:24278:39251:1 gene:EMLSAG00000001609 transcript:EMLSAT00000001609 description:"maker-LSalAtl2s1280-augustus-gene-0.11")

HSP 1 Score: 280.796 bits (717), Expect = 7.759e-79
Identity = 262/869 (30.15%), Postives = 368/869 (42.35%), Query Frame = 0
Query: 3508 NVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNPPEPLETDPCSA--CGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECSEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPDCQPICVVNSDCPAHLACINNDCVDPCFQN-VCGSNTHCYVKSHQAKCEC--FPGYDGNPLIGCNKGPTGTITAEERDPCETCGQHAICHIHNNIAACKCEDNYIDKPPN--CRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQPIDPCLPNPCGENTEHRKAGSNC-ICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCI-GNCGVQAICNVIEHNAICSCPEELEGDPFIRCIPAGCRSDSECPSTEACIDRECRDPCPF---QTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQYECKRHEECPSTLACRDFKCVDPCDCAVGANCRVSNHKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFL 4364
            N CG +A C     + +C CP +  GDP+  C        E DPC+   CGIN+DC+   N + IC C   + GDPY+ C                                       +PC  +PCG N+VCE NVN  A C+C+ +Y G P                ++C  + C+      CG NA+C+ +  +S              SS R                      +C C EG+ GDP+ E C          + PC  NPCG+NA+C  ++ S  CRCIE Y+GDPF +C                      DPC +N  CG NA C  +    + C C   + GDP   C +           DPCAN  CG  ++   R     C+C  G++G P               H++C     +DPC  N  CG NT C     ++ C+C            GC   P  T+        + CG +A C   N+   C+C  N+   P     R ECV + +C  + AC  Y C +PC++ C   A+C V NH  ICRC   Y GDP   C      +     + + CG NT+   +  +  IC C   F G+P TGC YEC    +C  N+    N RC   C  G CG  A C    +  ICSCPE   GDP+ RC    C + S+C    AC+   C++PC       CGV A+CE +SH + C C  GF G+P+  C ++             C+   C D   C  G + R  N +  CTCP G+ GDP ++        +   CE ++EC  + AC + +C DPC ++ C   + C    H   C+C +G++
Sbjct:  113 NPCGNDAQCEPVGERPLCTCPESYSGDPYTHC--------EADPCTINPCGINSDCESNGN-RAICKCLPGFEGDPYVRCND-------------------------------------NPCNKSPCGANAVCE-NVNARASCKCRPNYEGDP---------------FVQCTLDPCL---ISPCGINADCEKSPSNS----------RTGISSTR---------------------AICKCREGYEGDPF-ERC---------NLNPCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNCE--------------------LDPCSNN-PCGQNAEC-TSRGRSSVCKCPRGFSGDPYSYCDE-----------DPCANNPCGTNAECKNRANRPICNCPSGFIGDP---------------HISCS----LDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTV--------DICGINAECRNQNDRPVCECLPNHKGDPYIQCFRGECVSNSECSSNEACKDYSCINPCLDSCSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTTEE-----ICSACGANTDCEVSNDDQPICKCKTNFIGNPITGCRYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYSRCY-TECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSCREFN--------KQDLCKPDPCGDGALCQPGTD-RSGNSRPVCTCPQGYRGDPLTK-------CVRGECENDNECTSNQACFDFKCKDPC-TDACGINSECRALNHGAICSCRSGYV 792          

HSP 2 Score: 277.715 bits (709), Expect = 1.008e-77
Identity = 281/939 (29.93%), Postives = 384/939 (40.89%), Query Frame = 0
Query: 3943 CFQNVCGSNTHCY-VKSHQAKCECFPGYD----GNPLIGCNKGPTGTITAEERDPCETCGQHAICHIHNNIAACKCEDNYIDKPPNCRRECVLHEDCPKHLACIQYKCASPCI-NQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQPIDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGN-CGVQAICNVIEHNAICSCPEELEGDPFIRCIPAGCRSDSECPSTEACIDRECRDPCPFQTCGVNAECE-----TRSHLST----CICLEGFEGNPYEGCT-----QYECKRHEECPSTLACRDFKCV-------------DPCD---CAVGANCRVSNHKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFLFIGDFECKAPERPECVSDPECPLHLACISE------RCL---------------DPC-TSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQKAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQYECLVDSDCPYTLACPNRECIDPCQCAANAECSVQN-HKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQ-ACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNP--CSSLAKCYVQDHMGKCACPAGMTGDPYVSCLEIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECD-----ASNHRAVCTCPIEWVGNPMRECHQYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPI 4813
            C  N CG NT C   ++  A C C PGYD    GN + GC   P        R        H+   + N +++ +     ID P        +H    +  +    +  +PC  N CG +A C  +   P+C C   Y GDP   CE        DPC  NPCG N++    G+  IC CLPGF GDPY  CN                      NPC  + CG  A+C  +   A C C    EGDPF++C                       DPC    CG+NA+CE     +R+ +S+    C C EG+EG+P+E C         C  + +C +  +    +C+             DPC    C   A C      + C CP GF+GDPYS  D                             DPC +NPC   A C    +   C CP+GF  IGD        P C  +  C L+  C +       +C                DPC T   CG+NA+C      PVC C  ++ GDPY  C +  C SNSEC  +EAC +  C +PC  + C   A+C    HV +C C  GY G+P++ CRQ+    +  C                C AN +C V N  +  C C   F GN  TG             +C+ D +C + Q  C +  C+ P      CG ++ C   +  P     C+C   +  +    C  +       C  H DC  ++ C    C NPC+  NP  C   A C  + H   C+CP G TGDP+VSC E        D C+                  DPCG  A C      + N R VCTCP  + G+P+ +C + EC   N+C +++AC D KC DPC +  CG  + C++  H + C C  G  GNP+
Sbjct:   25 CQYNPCGVNTICDDSRTGTAVCRCQPGYDHAPHGNTIDGC---PINIRXXNNR--------HS--SLSNILSSGR-----IDSP-----RSSIHN---RLKSRTNIRSGNPCNPNPCGNDAQCEPVGERPLCTCPESYSGDPYTHCE-------ADPCTINPCGINSDCESNGNRAICKCLPGFEGDPYVRCN---------------------DNPCNKSPCGANAVCENVNARASCKCRPNYEGDPFVQCT---------------------LDPCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDPFERCNLNPCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNCELDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCDE----------------------------DPCANNPCGTNAECKNRANRPICNCPSGF--IGDPHISCSLDP-CKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDPYIQCFRGECVSNSECSSNEACKDYSCINPC-LDSCSTKAECQVQNHVAICRCPRGYTGDPFQNCRQF--TTEEICS--------------ACGANTDCEVSNDDQPICKCKTNFIGNPITGC----------RYECETDRECSNNQHQCVNKRCQ-PACRDGVCGENANCLARNNKP----ICSCPENFLGDPYSRCYTE-------CINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSCREF----NKQDLCKP-----------------DPCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGECENDNECTSNQACFDFKCKDPCTD-ACGINSECRALNHGAICSCRSGYVGNPL 796          

HSP 3 Score: 247.669 bits (631), Expect = 8.554e-68
Identity = 222/753 (29.48%), Postives = 299/753 (39.71%), Query Frame = 0
Query: 3855 CSCLNDYVGDPQVECHKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPCETCGQHAICHIHNNIAACKCEDNYIDKPPNCRRECVLHEDCPKHLACIQYKCASPCI-NQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQPIDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGN-CGVQAICNVIEHNAICSCPEELEGDPFIRCIPAGCRSDSECPSTEACIDRECR---------------------DPCP-FQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQYECKRHEECPSTLACRDFKCVDPC--DCAVGANCRVSNHKTTCTCPPGFTGDPY-----------------------SRDDPP---------RPPIL--TVGCEGNHECPDS-HACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFLFIGDFECKAPERPECVSDPECPLHLACISERCLDPCTS---QACGVNAKCTVTTHV------------------------------------------------PVCACELDYVGDPYTVCQKAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECR 4495
            C+C   Y GDP   C             DPC    CG  S          C CLPG+ G P               ++ C +N    PC ++ CG+N  C   + +A C+C P Y+G+P + C   P           CE    ++   I +  A CKC + Y   P      C L+                PC  N CG NADCS  +   +CRC+  Y GDP   CE       +DPC  NPCG+N E    G + +C C  GF GDPY+ C+                      +PC  N CG  A C    +  IC+CP    GDP I C    C+ +  C     C     R                     DPC     CG+NAEC  ++    C CL   +G+PY  C + EC  + EC S  AC+D+ C++PC   C+  A C+V NH   C CP G+TGDP+                       S DD P           PI      CE + EC ++ H C+N RC   C    C   A C    ++  C+CP  FL      C      EC++  +C  + AC+  RC +PC+      CGV A C   +H                                                 PVC C   Y GDP T C +  C++++EC  ++AC + KC+DPC  + CG N++C    H  +CSC +GY GNP E  R
Sbjct:  130 CTCPESYSGDPYTHCE-----------ADPCTINPCGINSDCESNGNRAICKCLPGFEGDP---------------YVRCNDN----PCNKSPCGANAVCENVNARASCKCRPNYEGDPFVQCTLDPCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDP---FERCNLN----------------PCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNCE-------LDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCD---------------------EDPCANNPCGTNAECKNRANRPICNCPSGFIGDPHISCSLDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDPYIQCFRGECVSNSECSSNEACKDYSCINPCLDSCSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTTEEICSACGANTDCEVSNDDQPICKCKTNFIGNPITGCRYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYSRCYT----ECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSCREFNKQDLCKPDPCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGECENDNECTSNQACFDFKCKDPC-TDACGINSECRALNHGAICSCRSGYVGNPLEAXR 800          

HSP 4 Score: 237.654 bits (605), Expect = 1.963e-64
Identity = 246/866 (28.41%), Postives = 350/866 (40.42%), Query Frame = 0
Query: 3056 LCICTKDPCSISPCGDEAICR-AVEGNAICECPEGT----RGDPLDSC---VKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVD--------------------RVPKPPIRPLPQCQRNQDCPSFKVCDDGNCVDPCPER-CGLNADCRVQNHQVQCFCQPGFKGDPY----------------YQCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNN-CGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQI------------------------------IVRPPPKQPCFPSPC------GANAVCKIVRAQEKCHCLPGFLGDPPY--CRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNPPEPLETDPCSACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQ-ACLRNKCVDPCI-GTCGVNAECSEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSP-PNCRPECTEDSACPNHLKCVREKCVDPC----PGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRAN-------NPLIVDLLNILGHVMRHN--PMCTCLEGFIGDPYNEGCIRKPEAIENEVT------------PCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCR 3809
              + T   C  +PCG   IC  +  G A+C C  G      G+ +D C   ++  +   ++   N+        P          +  +  G      +PC P+PCG  A C  V  +  C CP    GDP+  C+       D C  +PCG  ++C  N  N+AIC C  G+ G+P   C           +D  CN   C        G  A CE    + +C+CR  Y+GDP+ QC +D                    R      R + +C+   +   F+ C+    ++PC +  CG NADC  ++    C C  G+ GDP+                 +C  RG   VC C  G+ G P +   E                   DPC NN CG  A+C+   ++P+C+CP G  G+P+  C +                                 P     C   PC      G NA C+    +  C CLP   GDP     R EC+++ EC S++ C    CI+PC + C   A C  +NH  IC CP    GDPF  C     E +    CSACG N DC+V  +DQ IC C  +++G+P   CR EC T+ +C ++Q  C+  +C   C  G CG NA C                      N   +C C  +++G P   C  EC   S C ++  CV  +C +PC    P +CG  A+C+      A C+  +G     F S R  N       +P     L   G     N  P+CTC +G+ GDP  + C+R     +NE T            PC  + CG N+EC   N    C C   YVG+P  + R
Sbjct:   17 FILSTYGECQYNPCGVNTICDDSRTGTAVCRCQPGYDHAPHGNTIDGCPINIRXXNNRHSSLS-NILSSGRIDSPRSSIHNRLKSRTNIRSG------NPCNPNPCGNDAQCEPVGERPLCTCPESYSGDPYTHCE------ADPCTINPCGINSDCESNG-NRAICKCLPGFEGDPYVRC-----------NDNPCNKSPC--------GANAVCENVNARASCKCRPNYEGDPFVQCTLDPCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDPFERCN----LNPCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNCELDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCDE-------------------DPCANNPCGTNAECKNRANRPICNCPSGFIGDPHISCSLDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDPYIQCFRGECVSNSECSSNEACKDYSCINPCLDSCSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTTEEI----CSACGANTDCEVSNDDQPICKCKTNFIGNPITGCRYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLA-------------------RNNKPICSCPENFLGDPYSRCYTECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCE-AKSHKAICSCPRGFTGDPFVSCREFNKQDLCKPDPCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTK-CVRGECENDNECTSNQACFDFKCKDPCT-DACGINSECRALNHGAICSCRSGYVGNPLEAXR 800          

HSP 5 Score: 236.113 bits (601), Expect = 5.731e-64
Identity = 247/847 (29.16%), Postives = 343/847 (40.50%), Query Frame = 0
Query: 3327 CGLNADCR-VQNHQVQCFCQPGFKGDPYYQCI------VRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNPPEPLETDPC--SACGINADCDVRPND--------QVICSCPKDYLGDPYIECRPE------CLTNADCPSHQACLRNKCVDPCIGT--------------CGVNAECS----------------EPI-----DPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHN--PMCTCLEGFIGDPYNE----GCIRKPEAIENE-------VTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQV----------ECHKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAP-PDCQPICVVNSDCPAHLACINNDCVDPCFQ---NVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPC--ETCGQHAICH-----IHNNIAACKCEDNYIDKPPN--CRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPL 4079
            CG+N  C   +     C CQPG+   P+   I      +R      S             P   I        +   G   +P  N CG  AQC+ V  +P+C+CP+  +G+PY  C+         PC  +PCG N+ C+    +  C CLPGF GDP Y R              C+   C    ++ CG NA+C   N +  C C  N +GDPF +C+         DPC  S CGINADC+  P++        + IC C + Y GDP+  C         C  NADC +  +    +C++  IG               CG NAEC+                +P      DPC  NPCG N+ C++  N   +C C + +IG P               H+ C  + C D     CG N EC+ +   S              SS  R++    VD+  I       N  P+C CL    GDPY +     C+   E   NE       + PC  + C + AEC  QN    CRC   Y GDPF +CR                        E   ACG N  C V+N+    C C  +++G+P            EC       V +     C +  CG  +  + RN    CSC   ++G P   C   C+ +SDC  + AC+   C +PC +   NVCG    C  KSH+A C C  G+ G+P + C +         ++D C  + CG  A+C        N+   C C   Y   P     R EC    +C  + AC  +KC  PC + CG N++C  +NH  IC C   Y G+PL
Sbjct:   30 CGVNTICDDSRTGTAVCRCQPGYDHAPHGNTIDGCPINIRXXNNRHSSLSNILSSGRIDSPRSSIHNRLKSRTNIRSGNPCNP--NPCGNDAQCEPVGERPLCTCPESYSGDPYTHCEA-------DPCTINPCGINSDCESNGNRAICKCLPGFEGDP-YVR--------------CNDNPCN---KSPCGANAVCENVNARASCKCRPNYEGDPFVQCT--------LDPCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDPFERCNLNPCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNCELDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCDEDPCANNPCGTNAECKNRAN-RPICNCPSGFIGDP---------------HISCSLDPCKDN--DACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDPYIQCFRGECVSNSECSSNEACKDYSCINPCL-DSCSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTTE-------------------EICSACGANTDCEVSNDDQPICKCKTNFIGNPITGCRYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYSRCYTECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSCRE-------FNKQDLCKPDPCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGECENDNECTSNQACFDFKCKDPCTDACGINSECRALNHGAICSCRSGYVGNPL 796          

HSP 6 Score: 234.572 bits (597), Expect = 2.026e-63
Identity = 251/866 (28.98%), Postives = 355/866 (40.99%), Query Frame = 0
Query: 3193 CQPSPCGSKANCNINDENQAICSCWEGY----FGNPLTGCLPECQTDQ---------------DCPSDQSCNNLKCQ------DPC-PGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCIVR----------------GNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPC-VNNCGEGAQCQ---------VVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCEN-VCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNPPEPLETDPCS--ACGINADCDVRPNDQVICSCPKDYLGDPYIECRPE-------CLTNADCPSHQACLRNKCVDPCIGTCGVNAECSEPIDPCQP-NPCGLNSVCESNVNGLALCRCQNDYIGSPPN--CRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHN---PMCTCLEGFIGDPYNEGCIRKPEA-----------IENEVTP-CEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCE--HNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPD--CQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPL 3974
            CQ +PCG    C+ +    A+C C  GY     GN + GC    +                  D P     N LK +      +PC P  CG  A CE    +P C C E Y GDPY  C  D     P                               CG+N+DC    ++  C C PGF+GDPY +C                     R  C C+P Y G P     +C +                DPC ++ CG  A C+         +   + +C C +G  G+P++RC +        PC  +PCGANA C    +   C C+ G++GDP        ++ E            +DPC N  CG NA C ++    +C CP    GDP+  C        + DPC+   CG NA+C  R N + IC+CP  ++GDP+I C  +       C  N +C +       KC     G+   ++ C    DPC   + CG+N+ C  N N   +C C  ++ G P     R EC  +S C ++  C    C++PC   C   AEC+  N   A C   +G     F + R+     I             N   P+C C   FIG+P   GC  + E            +     P C    CG NA C+ +N    C C E+++GDP+  C  EC+ +SDC    AC+  +CK+PC   +   CG+ A C    +H A CSC   + GDP V C +     + +   DPC +            N    C+C  GY G P     +  C  +++C ++ AC +  C DPC  + CG N+ C   +H A C C  GY GNPL
Sbjct:   25 CQYNPCGVNTICDDSRTGTAVCRCQPGYDHAPHGNTIDGCPINIRXXNNRHSSLSNILSSGRIDSPRSSIHNRLKSRTNIRSGNPCNPNPCGNDAQCEPVGERPLCTCPESYSGDPYTHCEADPCTINP-------------------------------CGINSDCESNGNRAICKCLPGFEGDPYVRCNDNPCNKSPCGANAVCENVNARASCKCRPNYEGDP---FVQCTL----------------DPCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDPFERCNL-------NPCHDNPCGANADCSARSSSAVCRCIEGYIGDP-------FSNCE------------LDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYC--------DEDPCANNPCGTNAECKNRAN-RPICNCPSGFIGDPHISCSLDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRS--DPCSTVDICGINAECR-NQNDRPVCECLPNHKGDPYIQCFRGECVSNSECSSNEACKDYSCINPCLDSCSTKAECQVQNHV-AICRCPRGYTGDPFQNCRQFTTEEICSACGANTDCEVSNDDQPICKCKTNFIGNPIT-GCRYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYSRCYTECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEA-KSHKAICSCPRGFTGDPFVSCREFNKQDLCKP--DPCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGECENDNECTSNQACFDFKCKDPC-TDACGINSECRALNHGAICSCRSGYVGNPL 796          

HSP 7 Score: 231.491 bits (589), Expect = 2.285e-62
Identity = 217/762 (28.48%), Postives = 302/762 (39.63%), Query Frame = 0
Query: 3058 ICTKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQC------------------------------------------QPVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPE------CQTDQDCPSDQSCNNLKC-------------QDPCPGF-CGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDDGNC---------------VDPCP--ERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKH------------------------------------------KPMCSCPDGSTGNPYKRCQII--------------VRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDP-PYCRPECLADHECPSHKICHQEKCIDPCE----NVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNPPEPL-ETDPCSACGI-NADCDVRPNDQVICSCPKDYLGDPYIEC-RPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECSEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLK 3676
            I + +PC+ +PCG++A C  V    +C CPE   GDP   C + + C    CG N  C+    + +C+C+PGF     V        D+PC  SPCGA A C  V  +  C C P   GDPF+QC                                           P E    + C  +PCG+ A+C+    + A+C C EGY G+P + C  +      C  + +C S    +  KC             +DPC    CG  A C+   ++P C C  G+ GDP+  C +D     P +    C  N +C +        C                DPC   + CG+NA+CR QN +  C C P  KGDPY QC                      R ECV   +C  +  C    C++PC+++C   A+CQV  H                                          +P+C C     GNP   C+                V    +  C    CG NA C     +  C C   FLGDP   C  EC+   +C  ++ C   +C +PC     NVCG+ A C  K+HK IC CP    GDPF  C     + L + DPC    +     D   N + +C+CP+ Y GDP  +C R EC  + +C S+QAC   KC DPC   CG+N+EC                     +N  A+C C++ Y+G+P         +S   NH K
Sbjct:  104 IRSGNPCNPNPCGNDAQCEPVGERPLCTCPESYSGDPYTHC-EADPCTINPCGINSDCESNGNRAICKCLPGFEGDPYVRCN-----DNPCNKSPCGANAVCENVNARASCKCRPNYEGDPFVQCTLDPCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDPFERCNLNPCHDNPCGANADCSAR-SSSAVCRCIEGYIGDPFSNCELDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCDEDPCANNPCGTNAECKNRANRPICNCPSGFIGDPHISCSLD-----PCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDPYIQCF---------------------RGECVSNSECSSNEACKDYSCINPCLDSCSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTTEEICSACGANTDCEVSNDDQPICKCKTNFIGNPITGCRYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYSRCYTECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSCREFNKQDLCKPDPCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGECENDNECTSNQACFDFKCKDPCTDACGINSECRA-------------------LNHGAICSCRSGYVGNPLEAXRXSQSNSRIFNHNK 813          

HSP 8 Score: 223.787 bits (569), Expect = 7.975e-60
Identity = 224/741 (30.23%), Postives = 308/741 (41.57%), Query Frame = 0
Query: 2887 RTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQ-----ECIRGACVDP--------CATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICTK------------DPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDAC-------------------------------QPSPCGSKANCNINDE-----NQAICSCWEGYFGNPLTGCLP-ECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDD------------GNCVDPCPERCGLNADCRVQNHQ-VQCFCQPGFKGD---PYYQCIVRGNREVCSCQPGYFGGP-PNCRPECVIQEDCPYDHHCLRGQCVDPCV----NNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVC-----KIVRAQEKCHCLPGFLGDPPY--CRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFD 3537
            RT     NPCN    CG  A C+ V  + LC CPE Y G+P   C+    C   P          CG +++C  N      +C+ G   DP        C    C  N  C     +  C C+     N  G+       VQC   D C  +   I+  C+        P      + + +A+C C +            +PC  +PCG  A C A   +A+C C EG  GDP  +C + + C    CG N  C       VC+C  GF    P S  C E   DPC  +PCG  A C    N+  C CP G  GDP I C        DAC                               +  PC +   C IN E     ++ +C C   + G+P   C   EC ++ +C S+++C +  C +PC   C   A C+V+ H   CRC  GY GDP++ C      +        C  N DC   +V +D            GN +  C   C  + +C    HQ V   CQP  +         C+ R N+ +CSC   + G P   C  EC+   DC  +  C+  +C +PC     N CG GA C+   HK +CSCP G TG+P+  C+   +   +  C P PCG  A+C     +   ++  C C  G+ GDP     R EC  D+EC S++ C   KC DPC + CGIN+ C   NH  IC C S   G+P +
Sbjct:  101 RTNIRSGNPCNP-NPCGNDAQCEPVGERPLCTCPESYSGDPYTHCEAD-PCTINP----------CGINSDCESNGNRAICKCLPGFEGDPYVRCNDNPCNKSPCGANAVCENVNARASCKCRP----NYEGDPF-----VQCTL-DPCLISPCGINADCEKS------PSNSRTGISSTRAICKCREGYEGDPFERCNLNPCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNC-ELDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGD-PYSY-CDE---DPCANNPCGTNAECKNRANRPICNCPSGFIGDPHISCSLDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDPYIQCFRGECVSNSECSSNEACKDYSCINPCLDSCSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTTEEI----CSACGANTDC---EVSNDDQPICKCKTNFIGNPITGCRYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYSRCYTECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSCREFNK---QDLCKPDPCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGECENDNECTSNQACFDFKCKDPCTDACGINSECRALNHGAICSCRSGYVGNPLE 797          

HSP 9 Score: 223.016 bits (567), Expect = 1.190e-59
Identity = 245/925 (26.49%), Postives = 345/925 (37.30%), Query Frame = 0
Query: 4380 VSDPECPLHLACISE---RCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQKAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQYECLVDSDCPYTLACPNRECIDPCQCAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVA-----CNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSCLEIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQVECQQDGDCADNEKCDL-----------------------RAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPCNCGTGALCDVINH-TPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCSTFECLTNDECPPTKFCMVNQCLDPCVVNEP--CGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSV-VDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPCD--CGRGAECFLTGHRPVCRCPEGTKGNPL 5267
            +  P   +H    S    R  +PC    CG +A+C      P+C C   Y GDPYT C+                      DPC    CG N+DC +N +  +C CL G+EG+PY  C    C                  +   C ANA C   N +ASC C P ++G+ +               +C  D                PCL + PCG ++ C+   +  +  ++     C C  GY  +                       P + CN    +NPC   NPC + A C  +     C C  G  GDP+ +C                         +PCS   +PCGQ AEC +    +VC CP  + G+P   C +                     DPC    CG  A CK+  +   C CP G  G+P + C    C+ +  C  N +C+                        R+  C  +     C   A C  +N R  C C P   GD  + C          C  + +C S  AC  +  C NPCL  + C++   CQV +       +C+CP G       +C    +   C +                    CG    C+V N   PIC C   + GNP   C + EC  D +C ++Q    N    P   D  CG NA C+ R+++  C CP  + GDP+ +C T EC+ + +C   + C++ +C +PC    P  CG  A C    H A C CP G  GDP +                          +C + + Q+ C   DPC   A+C    D       +C C  G+  D    CV         C  D+EC  + AC +  CKDPC   CG  +EC    H  +C C  G  GNPL
Sbjct:   87 IDSPRSSIHNRLKSRTNIRSGNPCNPNPCGNDAQCEPVGERPLCTCPESYSGDPYTHCEA---------------------DPCTINPCGINSDCESNGNRAICKCLPGFEGDPYVRCNDNPC------------------NKSPCGANAVCENVNARASCKCRPNYEGDPFV--------------QCTLD----------------PCL-ISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGD-----------------------PFERCN----LNPCH-DNPCGANADCSARSSSAVCRCIEGYIGDPFSNCE-----------------------LDPCSN--NPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCDE---------------------DPCANNPCGTNAECKNRANRPICNCPSGFIGDPHISCSLDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTV---DICGINAECRNQNDRPVCECLPNHKGDPYIQC------FRGECVSNSECSSNEAC-KDYSCINPCL--DSCSTKAECQVQN----HVAICRCPRGYTGDPFQNCRQFTTEEICSA--------------------CGANTDCEVSNDDQPICKCKTNFIGNPITGC-RYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYSRCYT-ECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFV--------------------------SCREFNKQDLCKP-DPCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGE------CENDNECTSNQACFDFKCKDPCTDACGINSECRALNHGAICSCRSGYVGNPL 796          

HSP 10 Score: 210.69 bits (535), Expect = 1.678e-55
Identity = 226/791 (28.57%), Postives = 325/791 (41.09%), Query Frame = 0
Query: 4718 NPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQVECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEG--------------------RCQ-NPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAP-SLVGCESSSKCKADQACLNAKC-------------VSPCN---CGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRC----YDNLC-----------------VDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCSTFECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGC----------------------SPQPP-------VFEPVEA---ECRIDSDCASSL-ACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPCD------CGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVG-CTSDDECGDARACINAICKDPC--ACGPNAVCTIENHRPVCTCKDGFYGDP 5407
            NPC+   +PCG  A+C+    R +CTCP  + G+P   C                       DPC    CG  + C+S  + + C C PG +G+P VRC            DN             CN   C + A+CE  N R +C C+P   GD  V CT+ P  I + C I+ DC    +    G                    RC  NPC   NPC ++  C    +    + VC+C  G       +C   P S   C  +++C +       KC               PC    CGT A C    + PIC CP  + G+P I+C    C+++D CG +  C      ++C                  DPC   + CGINAEC  ++ +  CEC P ++GDP+++C   EC++N EC   + C    C++PC+  + C   A+C+V  H+A C+CP G  GDP   C                        QP        +  P+     EC  D +C+++   C+++ CQ  C     C ++A C   +  P    IC C   ++ D    C          C+   +C  + AC+   CK+PC       CG GA+C    H+ +C CP G  G+P + C     Q        D+C P+           PCG  A C                D S   R VC CP+GY  +       LT  V G C +D+EC   +AC +  CKDPC  ACG N+ C   NH  +C+C+ G+ G+P
Sbjct:  108 NPCNP--NPCGNDAQCEPVGERPLCTCPESYSGDPYTHCE---------------------ADPCTINPCGINSDCESNGNRAICKCLPGFEGDPYVRC-----------NDNP------------CNKSPCGANAVCENVNARASCKCRPNYEGDPFVQCTLDPCLI-SPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDPFERCNLNPCH-DNPCGANADCSARSS----SAVCRCIEGYIGDPFSNCELDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCDEDPCANNPCGTNAECKNRANRPICNCPSGFIGDPHISCSLDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDPYIQCFRGECVSNSECSSNEACKDYSCINPCL--DSCSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTTEEICSACGANTDCEVSNDDQPICKCKTNFIGNPITGCRYECETDRECSNNQHQCVNKRCQPACRD-GVCGENANCLARNNKP----ICSCPENFLGDPYSRCY-------TECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSCREFNKQ--------DLCKPD-----------PCGDGALCQ------------PGTDRSGNSRPVCTCPQGYRGD------PLTKCVRGECENDNECTSNQACFDFKCKDPCTDACGINSECRALNHGAICSCRSGYVGNP 795          

HSP 11 Score: 201.83 bits (512), Expect = 1.121e-52
Identity = 236/896 (26.34%), Postives = 352/896 (39.29%), Query Frame = 0
Query: 4213 CPFQTCGVNAEC-ETRSHLSTCICLEGFE----GNPYEGC---TQYECKRHEECPSTLAC-----------------RDFKCVDPCD---CAVGANCRVSNHKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFLFIGDFECKAPERP----ECVSDPECPLHLACISERC-------------LDPCTSQACGVNAKCT---------VTTHVPVCACELDYVGDPYTVCQKAGCQ-----SNSECPLSEACINRKC-------------QDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQYECLVDSDCPYTLACPNRECIDPCQ---CAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCK---------------NPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSCLEIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASN-HRAVCTCPIEWVGNPMRECHQYECIQHNDCPNDK-ACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQVECQQDGDCADNEKCDLRAQTCQLIC---NAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQV-IDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPCN--CGTGALCDVINHTPICYCPPKYSGNPQIA 5010
            C +  CGVN  C ++R+  + C C  G++    GN  +GC    +    RH    + L+                   + +  +PC+   C   A C     +  CTCP  ++GDPY+             CE                 DPC  NPC   + C  N +   C C  GF   GD   +  + P     C ++  C    A  S +C             LDPC    CG+NA C          +++   +C C   Y GDP+  C    C      +N++C    +    +C              DPC    CG+NA+C++     +C C  G+ G+PY  C +                     DPC    C  NAEC  + ++  C C  GF G+ +   CS  L+P  +++ C  + +C +        C+               +PC  +  CG ++ C+  +  P     C C   +  +   +C R        C ++ +C  ++ C + +CINPC   + CS+ A+C VQ+H+  C CP G TGDP+ +C +  T           E C               CG   +C+ SN  + +C C   ++GNP+  C +YEC    +C N++  C++ +C   C +  CG+ A C +  +   C CP    G+P  RC+  EC    DC DN  C L    C+  C   N   C  GA CEAK+H+  C C     GD  V C              R+   Q  C  +           PC     CQ   D       VC CP G        C+       CE+ ++C ++QAC + KC  PC   CG  + C  +NH  IC C   Y GNP  A
Sbjct:   25 CQYNPCGVNTICDDSRTGTAVCRCQPGYDHAPHGNTIDGCPINIRXXNNRHSSLSNILSSGRIDSPRSSIHNRLKSRTNIRSGNPCNPNPCGNDAQCEPVGERPLCTCPESYSGDPYTH------------CE----------------ADPCTINPCGINSDCESNGNRAICKCLPGFE--GDPYVRCNDNPCNKSPCGANAVCENVNARASCKCRPNYEGDPFVQCTLDPCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDPFERCNLNPCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNCELDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCDE---------------------DPCANNPCGTNAECKNRANRPICNCPSGFIGDPHI-SCS--LDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRP----VCECLPNHKGDPYIQCFRGE------CVSNSECSSNEACKDYSCINPCL--DSCSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTT----------EEIC-------------SACGANTDCEVSNDDQPICKCKTNFIGNPITGC-RYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYSRCY-TECINHSDCQDNRACVLF--RCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSC--------------REFNKQDLCKPD-----------PCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGE----CENDNECTSNQACFDFKCKDPCTDACGINSECRALNHGAICSCRSGYVGNPLEA 798          

HSP 12 Score: 191.045 bits (484), Expect = 3.007e-49
Identity = 259/942 (27.49%), Postives = 343/942 (36.41%), Query Frame = 0
Query: 4905 GRCQ-NPCLVRNPCNSDQTCQVI-------DTDPTRTVVCQCPIGMFVGNGG----SCIAAPSLVGCESSSKCKADQACLNAKCVSPCN---CGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCSTFECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLP-TDTILGCVKDDECPKDSA---CINRMCKDPCD-----------CGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARAC----INAICK-----------------DPCA----CGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTV-----------------------------------------ECRDNSECTPDR-ACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQNPCLLAEP--CGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPV------KTCPAGSGLILNEFEECVCPPGFVLDSQGICAPCRFDVGFIIENGRCICDYTKGFVLDLSGKKCVCPENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDP 5741
            G CQ NPC V   C+  +T   +       D  P    +  CPI +   N      S I +   +    SS     ++  N +  +PCN   CG  A C+ +   P+C CP  YSG+P   CE                      DPC I N CGIN++C    +++ C+C PG++GDP+V+C+   C                         PCG NA C      ASC+C P   GDP + C+  P +  P    C I++DC  S +                      +    +     ICKCR G+  D    C   P  D   G   D      SA   CI     DP             CG+ AEC   G   VC+CP G  G+P   C            D D CA N           PCG+NAEC    +R                  +C CP G+  + +  C +L P    C  +D CG    C      +ICK                 DPC+    CG NA C  +N RPVC C     GDP I C    C SNSEC +   C +  C   C      C   A CQ  NH  +C CP G  G+P+ +C                                            EC  + EC+ ++  C+NK+CQ  C     C + A C+  N++  C+CP  + G   + C      C+  SDC    AC+   C+NPC    P  CGV A C       I    C C  G+ GD  + C         K  P G G +        C PG   D  G              N R +C   +G+  D    KCV          G CE + EC  +  C        F+  C DPC    CG  +     +H   C C  GY G+P
Sbjct:   23 GECQYNPCGVNTICDDSRTGTAVCRCQPGYDHAPHGNTIDGCPINIRXXNNRHSSLSNILSSGRIDSPRSSIHNRLKSRTNIRSGNPCNPNPCGNDAQCEPVGERPLCTCPESYSGDPYTHCE---------------------ADPCTI-NPCGINSDCESNGNRAICKCLPGFEGDPYVRCNDNPCNK----------------------SPCGANAVCENVNARASCKCRPNYEGDPFVQCTLDPCLISP----CGINADCEKSPS----------------------NSRTGISSTRAICKCREGYEGDPFERCNLNPCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNCELDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYC------------DEDPCANN-----------PCGTNAECKNRANRP-----------------ICNCPSGFIGDPHISC-SLDP----CKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDPYIQCFRGECVSNSECSSNEACKDYSCINPCLDS---CSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTTEEICSACGANTDCEVSNDDQPICKCKTNFIGNPITGCRYECETDRECSNNQHQCVNKRCQPACR-DGVCGENANCLARNNKPICSCPENFLGDPYSRC---YTECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAI----CSCPRGFTGDPFVSCREFNKQDLCKPDPCGDGAL--------CQPG--TDRSG--------------NSRPVCTCPQGYRGDPL-TKCV---------RGECENDNECTSNQAC--------FDFKCKDPCTDA-CGINSECRALNHGAICSCRSGYVGNP 795          

HSP 13 Score: 187.578 bits (475), Expect = 4.230e-48
Identity = 221/728 (30.36%), Postives = 295/728 (40.52%), Query Frame = 0
Query:  657 CAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGE--STFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSC--QSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECL-QGKC-ICSPPFFVDTLDGNHC-KSPCHRFSCGFNAEC-TPSNPPQCLCKAGFTGNP-----LTGCEDLDECALN-------------------------------PCKQGSIC-INKLATYQ-----CECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVIC---GSNAQCIVSPSG-PTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFC--DPNRLSCTCQSGFLGDPTLVCMPPTQQAEC--SSECGTNSHCIYG---------NPNSC---------------ACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCS-----FASGKPECTCKRGYDGIPYERC-----QDVDECLFS--------------VCGKNAQCINTPGGYDCRCHSDFVGNPFEG 1278
            C  NPCG DA CE +    +C CP+  +GDP + C  +  +   C  +S C+   +   + C C  G+E +P   C D N C     CG N+VC+N+     C+C   ++G+PF  C    C  S C               ADC    + ++   I+   + C C  GYE +P  +   +++ C      PCG+ ADC     S  C C  G  GDPF    L       SN+ C +N EC  +G+  +C  P        ++C + PC    CG NAEC   +N P C C +GF G+P     L  C+D D C LN                               PC    IC IN     Q     CEC P   GDPY     G    EC ++ EC    AC    CINPC    C + A C  +NH A CRC  G+  D   NC     + IC   G+N  C VS    P C+C    +GNP  G       C +   C      C   RC   C    CG NA C    N+  C+C   FLGDP   C       EC   S+C  N  C+           NPN C               +C  G+ G+P+  C      + C    CGD A+C        + +P CTC +GY G P  +C     ++ +EC  +               CG N++C     G  C C S +VGNP E 
Sbjct:  110 CNPNPCGNDAQCEPVGERPLCTCPESYSGDPYTHCEADPCTINPCGINSDCESNGN--RAICKCLPGFEGDPYVRCND-NPCNKS-PCGANAVCENVNARASCKCRPNYEGDPFVQCTLDPCLISPCGIN------------ADCEKSPSNSR-TGISSTRAICKCREGYEGDPFERC--NLNPCH---DNPCGANADCSARSSSAVCRCIEGYIGDPFSNCELDP----CSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCDEDPCANNPCGTNAECKNRANRPICNCPSGFIGDPHISCSLDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDPYIQCFRG----ECVSNSECSSNEACKDYSCINPCLDS-CSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTTEEICSACGANTDCEVSNDDQPICKCKTNFIGNPITG---CRYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYSRCY-----TECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSCREFNKQDLCKPDPCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGECENDNECTSNQACFDFKCKDPCTDACGINSECRALNHGAICSCRSGYVGNPLEA 798          

HSP 14 Score: 186.808 bits (473), Expect = 7.898e-48
Identity = 250/871 (28.70%), Postives = 348/871 (39.95%), Query Frame = 0
Query:  633 LPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICEN-LLGSFVCKCPKGTN----GDPLSGC---------RGESTFECTQDSQCDQGESC----LSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLP--LRSACSSNSQC-------RENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTP-SNPPQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYT----NGCSGSKSVECGADDECHGQL---------ACIG----SQCINPCS-SVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCV---SLCNQV-ICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCD-PNRLS-CTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNS--CACNIGYFGNPYTGCEVTTSVED-----------------CDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERC----------QDVDECLF------------SVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQ---------CLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEK 1401
            L   Q +  F LS  G       EC  NPCG + IC++   G+ VC+C  G +    G+ + GC         R  S        + D   S     L SR   R G   NP             N CG ++ C+ +     C CP  + G+P+T C++     C+  P        C +   S+CE+        G  + C C  G+E +P  + C D         +PCG+ A C N     SC C P   GDPF    L   L S C  N+ C       R      +  C C   +  D  +  +  +PCH   CG NA+C+  S+   C C  G+ G+P + CE LD C+ NPC Q + C ++  +  C+CP G +GDPY+    + C+ +    CG + EC  +            IG    S  ++PC  +  CG N  C A    + C+C+SG++     +       C+ V ICG NA+C      P C+C     G+PY    C    C S S C    + C+   CI  C  + C   A C   N ++ C C  G+ GDP   C   T +  CS+ CG N+ C   N +   C C   + GNP TGC      +                  C    CG+NA C   + KP C+C   + G PY RC          QD   C+             +VCG  A C        C C   F G+PF  C          DLC    CG  A+C  G          C C  G++GD     V G      C+ + +C  N+ C          C DPC  A CG NS C   NH   C C+ G+ G+  +  R  Q   +
Sbjct:    8 LATYQTISFFILSTYG-------ECQYNPCGVNTICDDSRTGTAVCRCQPGYDHAPHGNTIDGCPINIRXXNNRHSSLSNILSSGRIDSPRSSIHNRLKSRTNIRSGNPCNP-------------NPCGNDAQCEPVGERPLCTCPESYSGDPYTHCEA---DPCTINP--------CGIN--SDCES-------NGNRAICKCLPGFEGDPYVR-CND----NPCNKSPCGANAVCENVNARASCKCRPNYEGDPFVQCTLDPCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDPFERCN-LNPCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNCE-LDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCDEDPCANNP---CGTNAECKNRANRPICNCPSGFIGDPHISCSLDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDPYI--QCFRGECVSNSEC-SSNEACKDYSCINPC-LDSCSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTTEEICSA-CGANTDCEVSNDDQPICKCKTNFIGNPITGCRYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYSRCYTECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSCREFNK----QDLCKPDPCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRG-----ECENDNECTSNQACFDFK------CKDPCTDA-CGINSECRALNHGAICSCRSGYVGNPLEAXRXSQSNSR 807          

HSP 15 Score: 184.496 bits (467), Expect = 4.488e-47
Identity = 239/860 (27.79%), Postives = 330/860 (38.37%), Query Frame = 0
Query:  205 CGINTLCINTH-GNFSCECLPGF----HGNPHDGC-VDI---------------------------------------DECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFAC-------EPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRF-----------------------------------------ICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSP--NGRSCIDIDECAGNPCGQDAICE-NLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGE-SCLSSRC--VCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSN-CEAPAKCV-------QITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFS-------CSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQ-CLCKAGFTGNPL 949
            CG+NT+C ++  G   C C PG+    HGN  DGC ++I                                       + C  NPCG  A+C  +     C CP   SGDPY   C+A          C    CG N+ C+ + N  IC C  GF GDP + C D N C  S    CG  A+C N +    C+C   Y GD    C        P  +   C      +          C CR+G++ +     +++ C   +NPCGAN+ C        C+CI   +G P      DPC    CGQ A C      + C C  G++ +P            CD+       CG NA C N      C C  GF GDP+I C  +D C +N                                           ICG  A C NQ     C+C    + DP     Q  R  C S+ EC  N  C + +C      + P C D+C        ++C VQN +  C+C  G+   P  N R     + C+   CG +  CE +     +CKC     G+P++GCR    +EC  D +C   +  C++ RC   CR G                   VCG N+ C        C CP  F G+P++ C +   +   C    QD    C L  C N C  P   V       +     + C+CPRG+  +P    C + ++       PCG GA C   PG+         C+CP G  GDP       +R  C ++++C  N+ C   K                CK PC   +CG N+EC   N    C C++G+ GNPL
Sbjct:   30 CGVNTICDDSRTGTAVCRCQPGYDHAPHGNTIDGCPINIRXXNNRHSSLSNILSSGRIDSPRSSIHNRLKSRTNIRSGNPCNPNPCGNDAQCEPVGERPLCTCPESYSGDPYT-HCEADP--------CTINPCGINSDCESNGNRAICKCLPGFEGDPYVRCND-NPCNKSP---CGANAVCENVNARASCKCRPNYEGDPFVQCTLDPCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDPFERCNLNPCH--DNPCGANADCSARSSSAVCRCIEGYIGDPFSNCELDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSY---------CDEDPCANNPCGTNAECKNRANRPICNCPSGFIGDPHISC-SLDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDP---YIQCFRGECVSNSECSSNEACKDYSC------INP-CLDSCSTK-----AECQVQNHVAICRCPRGYTGDPFQNCRQFTTEEICSA--CGANTDCEVSNDDQPICKCKTNFIGNPITGCR----YECETDRECSNNQHQCVNKRCQPACRDG-------------------VCGENANCLARNNKPICSCPENFLGDPYSRCYTECINHSDC----QDNRA-CVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVS-CREFNKQDLCKPDPCGDGALC--QPGTDRSGNSRPVCTCPQGYRGDPLTKC---VRGECENDNECTSNQACFDFK----------------CKDPCTD-ACGINSECRALNHGAICSCRSGYVGNPL 796          

HSP 16 Score: 173.326 bits (438), Expect = 1.451e-43
Identity = 209/740 (28.24%), Postives = 289/740 (39.05%), Query Frame = 0
Query:  114 NECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQ---------CQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVK-VRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQC-IAPLVGTPPEQPCR-DPCLEVN-CGQRASCQIVKSEAFCICEEGWAYNPKE--ISSGCLDIDECDKS--------ISP-TGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGC--FDIDECAENRFICGREALC-TNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGR---SCIDIDECAGNP------------------CGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCL-------SSR--CVCRRGYERNPA-----GDCVDLNECLLG-------------NVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSS 778
            N C   PC     C        C+C E Y GD +   + D C I    N C  N++C +     +CKC PGFEGD  V C D         CG N +C N +   SC+C P + G+P   C  +D C  +PCGI A C     N +         C+C  G  GDP++   +  + P      C+   CG NA C   S+  +C C EG+ GDP  +C    E    S   CG  A C ++     C+CP G++GD    C+        C ++ +C N A       C C  GF  +  +   +D C+  +  CG N+ C        C+C             CR DPC  V+ CG  A C+       C C      +P        C+   EC  +        I+P    C   A C        C C +G+ GDP+  C  F  +E       CG    C  +      C+C      +P +      R  C++D+EC  N          Q   V   C+ ACRD  C  N+ CL +N  P C C   F   P  R    CI+  +C  N                   CG  A CE      +C CP+G  GDP   CR  +  +  +   C  G  C        +SR  C C +GY  +P      G+C + NEC                + CG+NS C+ L     C C SG+ GNP  + +    +S
Sbjct:  108 NPCNPNPCGNDAQCEPVGERPLCTCPESYSGDPYTHCEADPCTI----NPCGINSDCESNGNRAICKCLPGFEGDPYVRCNDNP--CNKSPCGANAVCENVNARASCKCRPNYEGDPFVQCT-LDPCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDPFE---RCNLNP------CHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNC----ELDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCDEDPCANNPCGTNAECKNRAN---RPICNCPSGFIGDPHISCSLDPCKDND-ACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDPYIQCFRGECVSNSECSSNEACKDYSCINPCLDSCSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTTEEICS---ACGANTDCEVSNDDQPICKCKTNFIGNPITGC----RYECETDRECSNN----------QHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYSRCYTECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSCREFNKQDLCKPDPCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGECENDNECTSNQACFDFKCKDPCTDACGINSECRALNHGAICSCRSGYVGNPLEAXRXSQSNS 806          

HSP 17 Score: 168.318 bits (425), Expect = 6.115e-42
Identity = 229/778 (29.43%), Postives = 310/778 (39.85%), Query Frame = 0
Query:  450 DPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQC---YNGGQY-----DPSSLSCQEKRRSCQSDQECIGNAVCFNGA-CNCQEPYVGPNCE----DACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCI------CSPPFFVDTLDGNH---CKSP----------CHRFS-------CGFNAECTPSN--PPQCLCKAGFTGNPLTG----CEDLDECALNP----------------CKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSV---PCGSNANCVAENHAAWCRCKSGFAED-----SQGNCVSLCNQVICGSNAQC-----IVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDP--NRLSCTCQSGFLGDP 1151
            +PC    CG  A C+ V     C C E ++ +P            C+        CG+N+ C ++     C C  GF GDPY+ C D + C  N+  CG  A+C N     SC+C   Y G  +     DP  +S       C+         +    A C C+E Y G   E    + C D  C  N+ C  ++    C+C+ G+   P   S  ++D C+ NPCGQ+A C +   S VCKCP+G +GDP S C                                        D + C   N CG N+ CKN      C CPSGF G+P  SC          L P +D +  C L   + CEA       +G  S C C  GY  +P + +    D C  +    CG  A+C N      C C P   GDP+       R  C SNS+C  NE C    CI      CS     +    NH   C+ P          C +F+       CG N +C  SN   P C CK  F GNP+TG    CE   EC+ N                 C + + C+ +     C CP    GDPY+         EC    +C    AC+  +C NPCS      CG  A+C A++H A C C  GF  D      + N   LC    CG  A C         S P C C +G  G+P     C    C + + C    Q C   +C   C  + CG+N+ C    +   C+C+SG++G+P
Sbjct:  108 NPCNPNPCGNDAQCEPVGERPLCTCPESYSGDP---------YTHCEADPCTINPCGINSDCESNGNRAICKCLPGFEGDPYVRCND-NPC--NKSPCGANAVCENVNARASCKCRPNYEGDPFVQCTLDPCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDPFERCNLNPCHDNPCGANADCSARSSSAVCRCIEGYIGDP--FSNCELDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYC----------------------------------------DEDPC-ANNPCGTNAECKNRANRPICNCPSGFIGDPHISCS---------LDPCKDNDA-CGLN--TECEA-------SGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDI--CGINAECRNQNDRPVCECLPNHKGDPYIQC---FRGECVSNSECSSNEACKDYSCINPCLDSCSTK--AECQVQNHVAICRCPRGYTGDPFQNCRQFTTEEICSACGANTDCEVSNDDQPICKCKTNFIGNPITGCRYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYSRC-----YTECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSCREFNKQDLCKPDPCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPL--TKCVRGECENDNECTSN-QACFDFKCKDPC-TDACGINSECRALNHGAICSCRSGYVGNP 795          

HSP 18 Score: 149.828 bits (377), Expect = 4.715e-36
Identity = 256/996 (25.70%), Postives = 364/996 (36.55%), Query Frame = 0
Query:  957 ECALNPCKQGSICIN-KLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPN--RLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYGNPN-SCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCS---------FASGKPECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNL----GQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFC-SDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDAN-----DPQRGCQREEKCSTNEDCPAGRTCHI---------NFNGEQTCL-DPCQIMS-CPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQG-CLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTE----TCGPNALC-SPEFENLCQCPEGFAGVPTAAQGCVRIPPTCTTD-CPASSLC-----FNGYCMPECT--------SHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACR 1898
            EC  NPC   +IC + +  T  C C PG    P+ N   G   +     +  H  L+       N  SS    S  + +     +    +SG          + CN   CG++AQC      P C C E   G+PY   HC       A PC                    CG+N+ C+ N  R  C C  GF GDP + C          S CG N+ C   N   SC C   Y G+P+  C    +++ C    CG NA C           +S +  C C+ GY+G P+ERC +++ C  + CG NA C        CRC   ++G+PF  C        + D C+N  CG NA C        C C  GF GD                                  + +C  DPC    CG N+ C    ++  C C  GF GD +     DP   C+  + C  N +C A  T  I         +      C  DPC  +  C  N +C   +  P+C C      +K       ++G C+++S+C+   +C + S     C+  C L +C + AEC  + H   CRC  GY+G+P     C  F+             E+C                 CG    C V N        +  F+GNP I GCR   C  + +C +N+    ++  C   C++ +CGENA C    ++  C CP +F+              GD  P+ +C T C + S C                     ++ R C+  +C++PC+E     CG  A C +   + +C CP GF G P  +         C  D C   +LC      +G   P CT           +C RGE          C  D  C   + C D  C+  C TD+                                     CG    C       ICSC +  V +   A R
Sbjct:   24 ECQYNPCGVNTICDDSRTGTAVCRCQPGYDHAPHGNTIDGCP-INIRXXNNRHSSLS-------NILSSGRIDSPRSSIHNRLKSRTNIRSG----------NPCNPNPCGNDAQCEPVGERPLCTCPESYSGDPY--THCE------ADPCT----------------INPCGINSDCESNGNRAICKCLPGFEGDPYVRC---NDNPCNKSPCGANAVCENVNARASCKCRPNYEGDPFVQC----TLDPCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDPFERC-NLNPCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNC--------ELDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDP---------------------------------YSYCDEDPCANNPCGTNAECKNRANRPICNCPSGFIGDPHISCSLDP---CKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCEC---LPNHKGDPYIQCFRGECVSNSECSSNEACKDYS-----CINPC-LDSCSTKAECQVQNHVAICRCPRGYTGDP--FQNCRQFTT-----------EEICS---------------ACGANTDCEVSNDDQPICKCKTNFIGNP-ITGCR-YECETDRECSNNQH-QCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFL--------------GD--PYSRCYTECINHSDC---------------------QDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSCREFNKQDLCKPDPCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGE----------CENDNECTSNQACFDFKCKDPC-TDA-------------------------------------CGINSECRALNHGAICSCRSGYVGNPLEAXR 800          

HSP 19 Score: 145.591 bits (366), Expect = 8.879e-35
Identity = 213/747 (28.51%), Postives = 293/747 (39.22%), Query Frame = 0
Query:  810 TGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPF----QGSCLPLRSACSSNSQCRENEECLQGKCICSP-----PFFVDTLDGNHCKSPCHRFSCGFNAEC--TPSNPPQ--------CLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNC-VSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPC-LEQGQTCQGGRCITQCGQ--------------------EQCGVNAFC--DPNRLSCTCQSGFLGDPTLVCMPP--TQQAECSS---------------ECGTNSHCIYGNPNS-CACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASG-KPECTCKRGYDGIP-----YE-----------------RCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICS-TIAHSGHRFCS-------DPCQQAQCGPNSFC-----ITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKL 1459
             G    C CP  Y  +P T +CE  D C      PCG  +DC +N     C C PG  GDP+       C   +S C +N+ C       +  C C P     PF   TLD      PC    CG NA+C  +PSN           C C+ G+ G+P   C +L+ C  NPC   + C  + ++  C C  G  GDP++N               C           ++PCS+ PCG NA C +   ++ C+C  GF+ D    C    C    CG+NA+C    + P C C  G +G+P+    CSL  C     C L       G R I +C                      + CG+NA C    +R  C C     GDP + C        +ECSS                C T + C   N  + C C  GY G+P+  C   T+ E C +  CG N  C  ++  +P C CK  + G P     YE                 RCQ    C   VCG+NA C+       C C  +F+G+P+  C + E +   D       C  N  C L +C         +PN  V  C   A C+  +   +  ICS     +G  F S       D C+   CG  + C      + N +  C C  G+ GD   P   C R E C  + +C + + C  +F  +  C D C I     N +C   +   IC C SG+  N L
Sbjct:  124 VGERPLCTCPESYSGDPYT-HCE-ADPCTI---NPCGINSDCESNGNRAICKCLPGFEGDPYVRCNDNPCN--KSPCGANAVCENVN--ARASCKCRPNYEGDPFVQCTLD------PCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDPFERC-NLNPCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSN---------------CE----------LDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCDEDPCANNPCGTNAECKNRANRPICNCPSGFIGDPHIS--CSLDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDPYIQCFRGECVSNSECSSNEACKDYSCINPCLDSCSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTTEEICSA--CGANTDCEVSNDDQPICKCKTNFIGNPITGCRYECETDRECSNNQHQCVNKRCQPA--CRDGVCGENANCLARNNKPICSCPENFLGDPYSRC-YTECINHSD-------CQDNRACVLFRCK----NPCSEPNPNV--CGVGADCEAKS---HKAICSCPRGFTGDPFVSCREFNKQDLCKPDPCGDGALCQPGTDRSGNSRPVCTCPQGYRGD---PLTKCVRGE-CENDNECTSNQAC-FDFKCKDPCTDACGI-----NSECRALNHGAICSCRSGYVGNPL 796          

HSP 20 Score: 142.51 bits (358), Expect = 8.450e-34
Identity = 209/768 (27.21%), Postives = 294/768 (38.28%), Query Frame = 0
Query: 1826 CRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCN---------VIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCG-HGSCHPEDHAPKCHCQDGYQLIG---SNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPC-DGFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLECVEN------ADCDASKSCLNNKC---------------VDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPRECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQ-SCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPIT---CQGNKQCPENFLCDASFCKP---VCFADSDCEANELCHGKIC-------------------KEVCRSDSQCQSKEICQG-----------ISCSQGCRSDP--DCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIE 2519
            C  +SDC   E  G    C C PG+E       + N C  + CGA   C N      C C  N   D    C                             LDPC IS C   A C          +   +A C C   + GDP            PC    CG +  C     +  C C +GY  IG   SNC+ +D C S NPC  +A+CT+   S  C C  G  GDPY             S C  D          PC +  CG  A+C  + + P C+C   + G+P I C L  C +N       +C+AS +    KC                D C    ICG+N+ CR  N  PVC C   H GDP                    ++     C+ +  C+ ++ C    C +PC   ++C   A C  +NH  +C CP G+TG+    C +  +               + IC   C ++ DC ++   ++ + +  C  +   F+G+      C+  C   ++C N+Q  C+N +CQ  C+   CG NA C     +  C C   F+ +P     C  E I    CQ N+ C   F C     +P   VC   +DCEA    H  IC                   +++C+ D  C    +CQ             +C QG R DP   C   +  ++N+C         T+          DPC+ + CG N+ECR  NH A+CSC  G  GNP+E
Sbjct:  154 CGINSDC---ESNGNRAICKCLPGFEGDPYVRCNDNPCNKSPCGANAVCENVNARASCKCRPNYEGDPFVQCT----------------------------LDPCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDPFE-----RCNLNPCHDNPCGANADCSARSSSAVCRCIEGY--IGDPFSNCE-LDPC-SNNPCGQNAECTSRGRSSVCKCPRGFSGDPY-------------SYCDED----------PCANNPCGTNAECKNRANRPICNCPSGFIGDPHISCSLDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDPY-------------------IQCFRGECVSNSECSSNEACKDYSCINPCL--DSCSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTT---------------EEICS-ACGANTDCEVS---NDDQPICKCKTN---FIGNPITG--CRYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDP--YSRCYTECINHSDCQDNRACVL-FRCKNPCSEPNPNVCGVGADCEAKS--HKAICSCPRGFTGDPFVSCREFNKQDLCKPDP-CGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGECENDNEC---------TSNQACFDFKCKDPCTDA-CGINSECRALNHGAICSCRSGYVGNPLE 797          

HSP 21 Score: 132.494 bits (332), Expect = 1.011e-30
Identity = 188/677 (27.77%), Postives = 273/677 (40.32%), Query Frame = 0
Query: 2485 DPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHC--QPTLV-PCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSN----TQCQAGLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQN------EASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESC----HEGFCLQQCQIASDCQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCR-NPCNGFE-CEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFD---CVCRSGCTGDPFQGC--QCPTPKDSCRTKGACLN----PCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCAT---HKCEDNERCIAQRHKPKCTCKERLLIN-------------------SAGELICPQQDVQ--------CLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICTKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEES 3103
            +PC+ S CGANA C   N +A C C    EG+P   C   P L+ PC   +DC +S + S+ T ++  +    C +     EG   + CN N      C A   C  R     C           C+EG   DP  N        + CG+ A CT++     C+CPRG SGDPY  C  +        N CG+   C      K+      CNC        H    L  C+    C    EC      S C   R    G       CR +PC+  + C  N+ C+     P+C C   ++      C + EC +N +CS +++C+   CIN C +S  C   AEC++ NH A C CP G+ G+  Q C     +  + + CG N  C  ++   D   C C++   G+P  GC  +C T ++    +  C+N    P    G CG+ A C   N++ +C CPE + G+P   C T                 EC   ++C  N+ C+   C +PC+    + C     C A+ HK  C+C      +                     G L  P  D          C    +      C+ G C+N  + TS          N        KDPC+ + CG  + CRA+   AIC C  G  G+PL++    +S
Sbjct:  186 NPCNKSPCGANAVCENVNARASCKCRPNYEGDPFVQCTLDPCLISPCGINADCEKSPSNSR-TGISSTRAICKCREGY---EGDPFERCNLNPCHDNPCGANADCSARSSSAVCR----------CIEGYIGDPFSNCELDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCDEDPC----ANNPCGTNAEC------KNRANRPICNCPSGFIGDPHISCSLDPCKDNDACGLNTECEASGTRSICKC-RSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDPYIQCFRGECVSNSECSSNEACKDYSCINPCLDS--CSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTTE-EICSACGANTDC--EVSNDDQPICKCKTNFIGNPITGCRYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYSRCYT-----------------ECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSCREFNKQDLCKPDPCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGECENDNECTS----------NQACFDFKCKDPCTDA-CGINSECRALNHGAICSCRSGYVGNPLEAXRXSQS 804          

HSP 22 Score: 129.028 bits (323), Expect = 1.406e-29
Identity = 169/600 (28.17%), Postives = 235/600 (39.17%), Query Frame = 0
Query:   97 CYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTN-PCGIGAKCTNLLGNYQCQC-PAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKI-----SCVDINECQSSS-----------LYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCS-----SDFDCTNNAQCLPNGSCACRKGFQPNGVL-----CQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNP-KEISSGCLDIDECDK-------------SISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDI---DECAENRFICGREALC---TNQVGSYS--CQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSP 646
            C C +GY G   +  + N C   PC     C+    S  C C EGY GD F   ++D C      N C QNAEC +     VCKC  GF GD    C D D C  N  CG N  C N      C C  GF G+PH  C  +D C+ N  CG+  +C        C+C             C++    +V         CG NA C+  ++  +C C     GDP I      CV  +EC S+            L  C   A C  Q+    C CP GY GD    C        CS     +D + +N+ Q +    C C+  F  N +      C+   EC + ++                 QC+         + C+  C +  CG+ A+C    ++  C C E +  +P     + C++  +C               S      CGV A C        C C +GF GDP++ C +    D C  +   CG  ALC   T++ G+    C C  G + DP +   +  R  C++D EC  N  CF+             C+D C DA C  NS+C   N    C C  G+  +P
Sbjct:  256 CKCREGYEGDPFERCNLNPCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNCELDPCS----NNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYC-DEDPC-ANNPCGTNAECKNRANRPICNCPSGFIGDPHISC-SLDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTV-------DICGINAECRNQNDRPVCECLPNHKGDPYIQCFRGECVSNSECSSNEACKDYSCINPCLDSCSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTTEEICSACGANTDCEVSNDDQPI----CKCKTNFIGNPITGCRYECETDRECSNNQH-----------------QCV--------NKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYSRCYTECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSCREFNKQDLCKPD--PCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLT---KCVRGECENDNECTSNQACFDFK-----------CKDPCTDA-CGINSECRALNHGAICSCRSGYVGNP 795          

HSP 23 Score: 128.257 bits (321), Expect = 2.543e-29
Identity = 211/809 (26.08%), Postives = 293/809 (36.22%), Query Frame = 0
Query: 1356 SDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQ----REEKCSTNEDCP-----AGRTCHINFNGE---QTCLDPCQIMSC---------PTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAEC---AESEVCKRSNGQRSC------QPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCM-------------------DPCQN-EICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFE-NLCQCPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCA-RGEQCSNGM--CLKLCHTDKNCLQGE-ICVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPC---DISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGC--YQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGFCGIGAKCVVKNHSPKCSCLPRWRGNP 2104
            +DPC    CG NS C ++ ++  C C  GF GD   P   C      +  C  N  C      A   C  N+ G+   Q  LDPC I  C         P+N +  +S    IC C  G+E        D ++ C  +                      C    C + A+C +      CRC+ GY G+P         S N C  NAEC     S VCK   G          +  C+   CG  A C  R +   C CP G F+G+P I  C    C +N+ C  N  C+      +                   DPC   +ICG NA C     +  C+C P              N +GD  P+ QC                        C SN+ C     C    C +PC ++C   A C  +    +C+CP G+ G P   Q C +     TT+   S+   N  C         C  +     N +  C   C TD+ C   +  CV+K C+P CR                                     + +CG    C       ICSCP N + D    C +  +C +  DC D  AC+        +C +PC   + + C   A C    HKA CSCP  F GDP    + C  +  +  C+   CG G+           CQ G    G++                           CTC  G  GDP T+  +   +C +++EC+S+  C + +C DPC   CGI ++C   NH   CSC   + GNP
Sbjct:  146 ADPCTINPCGINSDCESNGNRAICKCLPGFEGD---PYVRCNDNPCNKSPCGANAVCENVNARASCKCRPNYEGDPFVQCTLDPCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEG-------DPFERCNLN---------------------PCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNCELDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCDEDPCANNPCGTNAECKNRANRPICNCPSG-FIGDPHIS-CSLDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLP--------------NHKGD--PYIQCFR--------------------GECVSNSECSSNEACKDYSCINPCLDSCSTKAECQVQNHVAICRCPRGYTGDP--FQNCRQF----TTEEICSACGANTDCEVSNDDQPICKCKTNFIGNPITGCRYECETDRECSNNQHQCVNKRCQPACR-------------------------------------DGVCGENANCLARNNKPICSCPENFLGDPYSRCYT--ECINHSDCQDNRACVL------FRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPF---VSCREFNKQDLCKPDPCGDGA----------LCQPGTDRSGNS------------------------RPVCTCPQGYRGDPLTKCVR--GECENDNECTSNQACFDFKCKDPCTDACGINSECRALNHGAICSCRSGYVGNP 795          

HSP 24 Score: 125.946 bits (315), Expect = 1.311e-28
Identity = 203/810 (25.06%), Postives = 303/810 (37.41%), Query Frame = 0
Query: 2467 SSKRKVTNRTGSII-AHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQP---TLVPCSSASDCPQSKTCSQGTCVAQCQLQGD--------------CLQNEVCNEGLCVQI---CNSNTQCQAGLVC-IDRQCVGGCSSNTQC---PSES-----------VCVEGKCQDPCQN------EASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNC-HRGLCAK-SCEASAECNCGESCHEGFCLQQ-CQIASDCQNGAECIEGVCISG-------------CGSNRDCPYGEMCEGGQCR---------------------NPCNGFE-CEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFD---CVCRSGCTGDPFQGC--QCPTPKDSCRTKGACLN----PCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCAT---HKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICTKDPCSISPCGDEAIC-----RAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPF 3179
            S +  + NR  S       +PC+ + CG +A+C     + LC+CPE   G+P  HC+    T+ PC   SDC  +   ++  C      +GD              C  N VC E +  +    C  N +    + C +D   +  C  N  C   PS S            C EG   DP +         + CG  A C+ ++    C+C  G  GDP+ +C  +      + N CG    C  RG  +   C      +    C E  C    C   ++C+N A      C SG             C  N  C     CE    R                     +PC+  + C  N+ C+     P+C C   ++      C + EC +N +CS +++C+   CIN C +  SC   AEC++ NH A C CP G+ G+  Q C     +  + + CG N  C  ++   D   C C++   G+P  GC  +C T ++    +  C+N    P    G CG+ A C   N++ +C CPE + G+P   C T                 EC   ++C  N+ C+   C +PC+    + C     C A+ HK  C+C                                          +G +     SC+  N Q L       C   PCGD A+C     R+     +C CP+G RGDPL  CV+ E      C  N AC +   +                        DPCT + CG  + C  + +   C C  G  G+P 
Sbjct:   89 SPRSSIHNRLKSRTNIRSGNPCNPNPCGNDAQCEPVGERPLCTCPESYSGDPYTHCEADPCTINPCGINSDCESNG--NRAICKCLPGFEGDPYVRCNDNPCNKSPCGANAVC-ENVNARASCKCRPNYEGDPFVQCTLDPCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDPFERCNLNPCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNCELDPC----SNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCDEDPCANNPCGTNAECKNRANRPICNCPSGFIGDPHISCSLDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDPYIQCFRGECVSNSECSSNEACKDYSCINPCLD--SCSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTTE-EICSACGANTDC--EVSNDDQPICKCKTNFIGNPITGCRYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYSRCYT-----------------ECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCP-----------------------------------------RGFTGDPFVSCREFNKQDL-------CKPDPCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGECENDNECTSNQACFDFKCK------------------------DPCTDA-CGINSECRALNHGAICSCRSGYVGNPL 796          

HSP 25 Score: 119.398 bits (298), Expect = 1.220e-26
Identity = 197/756 (26.06%), Postives = 285/756 (37.70%), Query Frame = 0
Query: 1495 CDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQ---------------PACSYLECGVGAVCV---------VRNHVGKCICPQGLFVGNP----QIEGCRKVSCVENEDCP-----------DNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQ-------CPPGQICKSGICAA--------GCSSNTHCEEGRVCITGKCQ---------------DPCT--ETCGPNALCSPEFEN-LCQCPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGY--EMTQSGCSDLNECKNNICGAGKTC-ANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDC-NDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPE--DHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGFCGIGAKC-----VVKNHSPKCSCLPRWRGNPKIKCELLECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPRE 2167
            C +  C   ++C S G+R  C+CLPG+ G+P  R      +++ C +NA      VC+  N + SC+                 C    CG+ A C          + +    C C +G + G+P     +  C    C  N DC            +    D  S   +DPC N  CG+NA CT  G    C+CP  F  S  P   C++    D C    C T     ++       CP G I    I  +         C  NT CE        KC+               DPC+  + CG NA C  + +  +C+C     G P                      CF G    EC S+ +C+  E C +  C+  C                    C T ++C++         C C  GY  +  Q+      E   + CGA   C  +     IC C TN + +    CR   +C +D++C N+   C+       K+C   C    C   A C    +K  CSCP  F GDP                    +  C+ E  +H+    CQD    +   C++     + N C   A C  +     C+C  G  GDP+           S  E +    C+     DPC    G GA C        N  P C+C   +RG+P  KC   EC  + +C ++++C + KC D C  +  CG+NS CR  NHG +CSC SG+ G+P E
Sbjct:  149 CTINPCGINSDCESNGNRAICKCLPGFEGDPYVRCNDNPCNKSPCGANA------VCENVNARASCKCRPNYEGDPFVQCTLDPCLISPCGINADCEKSPSNSRTGISSTRAICKCREG-YEGDPFERCNLNPCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNCELDPCSNNPCGQNAECTSRGRSSVCKCPRGF--SGDPYSYCDE----DPCANNPCGTNAECKNRANRPICNCPSGFIGDPHISCSLDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPNHKGDPYIQ-------------------CFRG----ECVSNSECSSNEACKDYSCINPCLD-----------------SCSTKAECQVQNHVAI---CRCPRGYTGDPFQNCRQFTTEEICSACGANTDCEVSNDDQPICKCKTNFIGNPITGCRY--ECETDRECSNNQHQCVN------KRCQPACRDGVCGENANCLARNNKPICSCPENFLGDP--------------------YSRCYTECINHS---DCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFV----------SCREFNKQDLCK----PDPC----GDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGECENDNECTSNQACFDFKCKDPC--TDACGINSECRALNHGAICSCRSGYVGNPLE 797          

HSP 26 Score: 115.931 bits (289), Expect = 1.615e-25
Identity = 216/843 (25.62%), Postives = 308/843 (36.54%), Query Frame = 0
Query: 2212 DPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQD-PCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQG-CRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQP---TLVPCSSASDCPQSKTCSQGTCVAQCQLQGD---------CLQNEVCNEGLCVQICNSNTQCQAGLVCIDRQCVGGCSSNTQCPSESVCVEGKC----QDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCRNPCNGF-------ECEPNSFCQV-NGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDK-SCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVV---------DRNDCLL-----------PNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAIC-----KVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLIN 3002
            +PC  PN CG +A C     + +C+CP  ++G+    C   P T                  ++ C  ++DC  N      KCL   G + D ++                            +C D PC  + CG NA+C+ +  +A C C+  +     P V CT +P        C  N  C+ S         S+          ICK  CR   +    E C    C    C ++ DC+A  +    +CI        +N          DPCS + CG NAEC ++   ++C CP G  G+P  +C        PC + ++C      ++  C       GD         C  N+ C  GL       NT+C+A           G  S  +C S              DPC     +CG  A C  QN +  C+C     GDPY                    + C RG C     +++EC+  E+C +  C+  C     C   AEC     ++ C     CP G   +  Q    C  F        C  N+ C+V N   P+C C   +      GC + EC T+ +CS ++  C   RC   C +   CG+NA C   N++  C CP  F G+    C           D   C+L           PN CG  A C  +     C C  G TGDPF  C+    +D C+              CG  A+C     +  N + +C CP+ Y G+P   C                   EC    EC+ NQ C    C DPC T  C  N  C A  H   C+C+   + N
Sbjct:  108 NPCN-PNPCGNDAQCEPVGERPLCTCPESYSGDPYTHCEADPCT------------------INPCGINSDCESNGNRAICKCLP--GFEGDPYV----------------------------RCNDNPCNKSPCGANAVCENVNARASCKCRPNY--EGDPFVQCTLDPCLIS---PCGINADCEKS--------PSNSRTGISSTRAICK--CREGYEGDPFERCNLNPCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNCE-------LDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCDEDPCANNPCGTNAECKNRA--NRPICNCPSGFIGDPHISCSLDPCKDNDAC--GL-------NTECEA----------SGTRSICKCRSGYSGSPYSSSGCRSDPCST-VDICGINAECRNQNDRPVCECLPNHKGDPY--------------------IQCFRGECV----SNSECSSNEACKDYSCINPC--LDSCSTKAECQVQNHVAIC----RCPRGYTGDPFQ---NCRQFTTEEICSACGANTDCEVSNDDQPICKCKTNFIGNPITGC-RYECETDRECSNNQHQCVNKRCQPACRDG-VCGENANCLARNNKPICSCPENFLGDPYSRCYTECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSCREFNKQDLCKPD-----------PCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKC----------------VRGECENDNECTSNQACFDFKCKDPC-TDACGINSECRALNHGAICSCRSGYVGN 794          

HSP 27 Score: 96.6709 bits (239), Expect = 1.158e-19
Identity = 127/492 (25.81%), Postives = 176/492 (35.77%), Query Frame = 0
Query:   95 SQCYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCK--PGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPH-----DGCVDIDECRTN--------------PCGIGAKCTNLLGNYQCQCPAGLSGDPYQ-----------GACQAQVAPSVS-------------------------------------------QQGCNAQSCGQNALCQRSSNGLICTCREGFTGDP----KISCVDINECQSSS---LYQ------------CGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGS--------CACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKE 484
            S C C  G+ G      D + C   PC     C N      C+C  G+ GD      +D C+     + C  N EC       +CKC+            CR  D C T  +CGIN  C N +    CECLP   G+P+       CV   EC +N               C   A+C        C+CP G +GDP+Q            AC A     VS                                           Q  C    CG+NA C   +N  IC+C E F GDP       C++ ++CQ +    L++            CGVGA C  +S    C CP G+ GD   +C     +  C  D  C + A C P           C C +G++ + +      EC++ +N C +N  C +                     C+DPC +  CG  + C+ +   A C C  G+  NP E
Sbjct:  332 SVCKCPRGFSGDPYSYCDEDPCANNPCGTNAECKNRANRPICNCPSGFIGDPHISCSLDPCKD---NDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRS-DPCSTVDICGINAECRNQNDRPVCECLPNHKGDPYIQCFRGECVSNSECSSNEACKDYSCINPCLDSCSTKAECQVQNHVAICRCPRGYTGDPFQNCRQFTTEEICSACGANTDCEVSNDDQPICKCKTNFIGNPITGCRYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYSRCYTECINHSDCQDNRACVLFRCKNPCSEPNPNVCGVGADCEAKSHKAICSCPRGFTGDPFVSCREFNKQDLCKPD-PCGDGALCQPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGECEN-DNECTSNQACFDF-------------------KCKDPCTDA-CGINSECRALNHGAICSCRSGYVGNPLE 797          

HSP 28 Score: 90.1225 bits (222), Expect = 1.158e-17
Identity = 216/869 (24.86%), Postives = 306/869 (35.21%), Query Frame = 0
Query: 1231 YDGIPYERCQDVDECLFSVCGKNAQCINTPGGYD-CRCHSDF----VGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAAT-------CQTNTDCGYNEICSTI----------AHSGHRFC---SDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQ----REEKCSTNEDCP-----AGRTCHINFNGE---QTCLDPCQIMSC---------PTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVY----QGCLADSDCAQGHS-----CNEVSFG--MKNC-VPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAEC---AESEVCK------------------------------RSNGQRSC-------------------QPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGI-------CAAGCSSNTHCEEGR-VCITGKCQDPCTE-TCGPNALC-SPEFENLCQCPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPG---CRTDSDCRLGEVCGAGGQCSCQPGYEMTQ-SGCSDLNE---CKNNICGAGKTCANTPGSY-------ICSCPTNQVPDE-----SGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDP 1960
            Y  I +       EC ++ CG N  C ++  G   CRC   +     GN  +GC              N +   N   +L   L  S  + D P   +     + T       C  N  CG +  C  +          ++SG  +    +DPC    CG NS C ++ ++  C C  GF G   DP   C      +  C  N  C      A   C  N+ G+   Q  LDPC I  C         P+N +  +S    IC C  G+E +     C++       C A++DC+   S     C E   G    NC +  C    C   AEC S G    C+C  G+SG+P         + N C +NAEC   A   +C                                ++G RS                     P  +   CG+ A C  +N    C C      G+P I+ C +  CV N +C  NE C    Y+C++PC +  C   A C V  H   C+CP  +   P     C +    ++C      T C  S+   P   CK+         C   C ++  C   +  C+  +CQ  C +  CG NA C +   + +C CPE F G P +                         C  EC +H  C     C    C   C                 EP    C   +DC   E       CSC  G+       C + N+   CK + CG G  C   PG+        +C+CP     D       G C + ++C+S+Q C D             KC DPC    C   + C  + H A CSC   + G+P
Sbjct:   11 YQTISFFILSTYGECQYNPCGVNTICDDSRTGTAVCRCQPGYDHAPHGNTIDGCP------------INIRXXNNRHSSLSNIL--SSGRIDSPRSSIHNRLKSRTNIRSGNPCNPNP-CGNDAQCEPVGERPLCTCPESYSGDPYTHCEADPCTINPCGINSDCESNGNRAICKCLPGFEG---DPYVRCNDNPCNKSPCGANAVCENVNARASCKCRPNYEGDPFVQCTLDPCLISPCGINADCEKSPSNSRTGISSTRAICKCREGYEGDPFE-RCNLNPCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNCELDPCSNNPCGQNAECTSRGRSSVCKCPRGFSGDPYSYCDEDPCANNPCGTNAECKNRANRPICNCPSGFIGDPHISCSLDPCKDNDACGLNTECEASGTRSICKCRSGYSGSPYSSSGCRSDPCSTVDICGINAECRNQNDRPVCECLPN-HKGDPYIQ-CFRGECVSNSECSSNEACK--DYSCINPCLDS-CSTKAECQVQNHVAICRCPRGYTGDPFQN--CRQFTTEEICSACGANTDCEVSNDDQPICKCKTNFIGNPITGCRYECETDRECSNNQHQCVNKRCQPACRDGVCGENANCLARNNKPICSCPENFLGDPYS------------------------RCYTECINHSDCQDNRACVLFRCKNPCS----------------EPNPNVCGVGADC---EAKSHKAICSCPRGFTGDPFVSCREFNKQDLCKPDPCGDGALC--QPGTDRSGNSRPVCTCPQGYRGDPLTKCVRGECENDNECTSNQACFDF------------KCKDPC-TDACGINSECRALNHGAICSCRSGYVGNP 795          

HSP 29 Score: 59.6918 bits (143), Expect = 2.519e-8
Identity = 80/304 (26.32%), Postives = 104/304 (34.21%), Query Frame = 0
Query: 5443 PCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKTCPAGSGLILNEFEECVCPP-GFVLDSQGICAPCRFDVGFIIENGRCICDYTKGFVLDLSGKKCVCPENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVC 5745
            PCG DA C+ V  + +CTCP    G+PY  C                       DPC I + C   + C    ++  C C PG+EG     C                         NPC  + PCG NA C  ++       +C C P YEGD  +QCT                + C+  P G   D +   +P     G  I + R IC   +G+  D                                 PFE C        +PC   PCG  A  +       CRCIEGY GDP + C
Sbjct:  114 PCGNDAQCEPVGERPLCTCPESYSGDPYTHCEA---------------------DPCTI-NPCGINSDCESNGNRAICKCLPGFEGDPYVRCN-----------------------DNPCNKS-PCGANAVCENVNAR----ASCKCRPNYEGDPFVQCT---------------LDPCLISPCGINADCEK--SPSNSRTG--ISSTRAICKCREGYEGD---------------------------------PFERCNL------NPCHDNPCGANADCSARSSSAVCRCIEGYIGDPFSNC 309          
BLAST of GH13743 vs. L. salmonis genes
Match: EMLSAG00000003435 (supercontig:LSalAtl2s:LSalAtl2s188:581193:593418:1 gene:EMLSAG00000003435 transcript:EMLSAT00000003435 description:"snap_masked-LSalAtl2s188-processed-gene-6.23")

HSP 1 Score: 177.948 bits (450), Expect = 2.355e-44
Identity = 238/816 (29.17%), Postives = 343/816 (42.03%), Query Frame = 0
Query:   87 CQHGACLDS----QCYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQG-ACQAQVAPSVSQQGCNAQSCGQN-ALCQRSSN--GLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGS---CACRKGFQPNGVLC-QDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSP-GSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQC---YNGGQYDPSSLSCQ--EKRRSCQSDQECIGNAVCFN----GACNCQEPYVGPNCE---DACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSC-IDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSS----RCVCRRGYERNPAGDCVDLNECLLGNVCGVNSV-CKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISY-CACPRGYEMNPRTKNCEDIDE-CQAIGHTPCGSGADCLNNP-GSFSCSCPPGQGG 868
            C +G C D      C C+ G+ G  C+ P  NECK  PC+  G C + +  + C C  GY G      D++EC      + C+  A C N    YVC+C+PG+EG  + E  +++EC +N  C     C+    ++SC C  GF GN  +   +ID+CR  PC     C + +  ++C C A     PY G  C++++ P      CN  SC  N A+C+ + +     C+C  GF G  +   VDI+EC +   Y C  GA C+N    Y C+C  G+ G        + +    SS   C N   CL   +   C C  GF   G LC +DI+EC S  NPC   +IC      Y C+C     GT  +    D C   +C     C    +   C+C  G++    +       I+ CDK+      C  N  C +     ++C C+ G+ G        +D C +    C     C     SY+C C   + G   D   +SC+   K RS      C+    C +      C CQ+ + G  C+   D C  + C   + C    G   CQCL GF+    G +C  +IDEC  NPC  + +C +L+  F C CP GT G        E       +  C  G +C+       C CR G+         D+NECL        +  C  L  +Y C+C   + G                    +  E +    + S CE    C  +  G  + C+C  GY      +NCE     CQ+    PC  G  CL +  G F+C CPPG  G
Sbjct:  186 CYNGKCEDGFGIYTCICDPGFSGVNCETP-INECKSSPCENNGLCIDLIAGYKCDCPSGYYGPRCT-SDVNECS----PDPCLNGATCENEFNDYVCRCQPGYEGK-RCE-YEVNECKSNP-CQHGGKCLTHFNSYSCICPSGFTGNNCE--SNIDDCRLFPCKNSGLCIDQVDGFKCICSA-----PYTGKTCESEMNP------CNEHSCAANGAVCKPTPDYKDYFCSCPLGFKG--RYCSVDIDECLT---YPCHNGASCVNTEGSYECKCEEGFEGRDCL----LNIDDCASS--PCVNGGTCLDETAGFKCLCVDGF--GGNLCEEDINECAS--NPCKNGAICHEYVNSYTCECKIGFSGTNCQTNDED-CTASSCMNGGKCIDGVNNYTCVCPRGYSGRNCQTR-----INPCDKN-----PCQNNGTCVDGGYNDYSCHCSSGWTGRNCDRL--VDWCQQGASPC-ENGRCYQSGTSYNCVCEDGWTGKVCDVRKVSCRIAAKLRSVDVSDLCLNGGRCRDEWNSHVCECQDGFYGSXCQYKKDECGSSPCQNGASCKSMIGTYSCQCLRGFQ----GHNCEFNIDECDPNPCQNEGVCHDLIDGFQCTCPYGTVGKLC-----EFNINECLEGTCHHGGTCIDKIGGYECQCRPGFVGQRCEG--DINECLTSRCSPYGTQDCIQLTNAYKCQCKPDYMG--------------------KYCETKKNFCESSPCENGGGCTNLIDGSGHKCSCLYGYS----GQNCEFYGSVCQS---NPCRHGGTCLEHSGGGFTCVCPPGTTG 912          

HSP 2 Score: 169.474 bits (428), Expect = 8.979e-42
Identity = 266/976 (27.25%), Postives = 401/976 (41.09%), Query Frame = 0
Query:  100 NDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVEC-RDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISC-VDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGD------GRFACEPVKVRTTCSSDFD--------------------------CTNNAQCLPNG---SCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQR-ASCQIV--KSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCF----NGACNCQEPYVGPNCE---DACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSC-IDIDECAGNPCGQDAIC-ENLLGSFVCKCPKGTNG---DPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGY-------ERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNP---------------FTSCQSCSGS-SCSCLPPYQDIEGRCQLADC--SNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCE-DIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQG---SCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHC---KSPCHRFSCGFNAECT---PSNPPQCLCKAGFTGNPLTGCEDLDE-CALNPCKQGSICI-NKLATYQCECPPGTTG 986
            + GYGG  C++ D +ECK  PC   G CT+ + ++ C C EG+ G     K I++C+       C+    C N    Y C C PGFEG   + C R+ ++C        N  C +    F+C+C PG+ G   +   +ID+C  +PC  G +C      ++C CP G  G      C+ Q      +  C +  C  N  C+       C C  GF+G   ++C   INEC+SS    C    +CI+   GY+C+CP+GY G          + +P     TC ++F+                          C +  +CL +    SC C  GF  N     +ID+C+    PC  + +C++    ++C C AP  G   E    +PC E +C    A C+      + FC C  G+      +     DIDEC      T  C   A C N+ GS+ C C +GF G   +   +ID+CA +  + G    C ++   + C C +G         C+E    C S+  C   A+C     +  C C+  + G NC+   + C  ++C    +C+       C C  G+    +GR+C   I+ C  NPC  +  C +     + C C  G  G   D L     +    C ++ +C Q  S  S  CVC  G+        +        L    + ++C     C++   S+ CEC  GF G+                  SC+S  G+ SC CL  +Q       + +C  + C+    C  +  G   C CP G       K CE +I+EC       C  G  C++  G + C C PG  G   +G    CL  R +      C +       KC C P +      G +C   K+ C    C     CT     +  +C C  G++G     CE     C  NPC+ G  C+ +    + C CPPGTTG
Sbjct:   15 DKGYGGDNCEL-DEDECKSFPCQNGGICTDDVNNYKCQCVEGFTGVNCE-KTINDCE----RYPCLNGGTCRNSIIAYKCDCLPGFEG---LNCERNKNDCKGEPC--KNGECFDGTDAFTCKCYPGYTGQLCE--HEIDQCEPSPCKHGGRCERHANGFKCNCPLGTWGQ----RCEEQ------KNECYSNPC-YNGKCEDGFGIYTCICDPGFSG---VNCETPINECKSSP---CENNGLCIDLIAGYKCDCPSGYYGPRCTSDVNECSPDPCLNGATCENEFNDYVCRCQPGYEGKRCEYEVNECKSNPCQHGGKCLTHFNSYSCICPSGFTGNNCE-SNIDDCRLF--PCKNSGLCIDQVDGFKCICSAPYTGKTCESE-MNPCNEHSCAANGAVCKPTPDYKDYFCSCPLGFKGRYCSV-----DIDEC-----LTYPCHNGASCVNTEGSYECKCEEGFEGRDCL--LNIDDCASSPCVNG--GTCLDETAGFKCLCVDG----FGGNLCEEDINECASNP-CKNGAICHEYVNSYTCECKIGFSGTNCQTNDEDCTASSCMNGGKCIDGVNNYTCVCPRGY----SGRNCQTRINPCDKNPCQNNGTCVDGGYNDYSCHCSSGWTGRNCDRLVDWCQQGASPC-ENGRCYQ--SGTSYNCVCEDGWTGKVCDVRKVSCRIAAKLRSVDVSDLCLNGGRCRDEWNSHVCECQDGFYGSXCQYKKDECGSSPCQNGASCKSMIGTYSCQCLRGFQGHNCEFNIDECDPNPCQNEGVCHDLIDGFQ-CTCPYG----TVGKLCEFNINECL---EGTCHHGGTCIDKIGGYECQCRPGFVGQRCEGDINECLTSRCSPYGTQDCIQLTNAY--KCQCKPDYM-----GKYCETKKNFCESSPCENGGGCTNLIDGSGHKCSCLYGYSG---QNCEFYGSVCQSNPCRHGGTCLEHSGGGFTCVCPPGTTG 912          

HSP 3 Score: 145.976 bits (367), Expect = 1.560e-34
Identity = 266/997 (26.68%), Postives = 390/997 (39.12%), Query Frame = 0
Query:  184 GFEGDGKVECR-DIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQC---LPNGSCACRKGFQPNGVLCQD-IDECQSTENPCGANSICLNVPGDYECQCIAPLVG---TPPEQPCR-DPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCE---DACRDATCFPNSQC---LVQNGLPFCQCLPGFKLSPNGRSC-IDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSS----RCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQG-NPFTSCQSCSGSSC-------------SCLPPYQDIEGRCQLA----DCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCED-IDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGG---DPFQGSC---LPLRSA-----CSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPS-NPPQCLCKAGFTGNPLTGCE-DLDECALNPCKQGSICINKLATYQCECPPGTTG---DPYTNGC------SGSKSVECGADDECHGQLACIGSQC---INPCSSVPCG--SNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQC--IVSPSGPTCQCFEGMVGN--PYPGGHCSLLSCSSASPCLEQ 1110
            G +G G   C  D DEC +   C    +C +   N+ C+C+ GF G   +    I++C   PC  G  C N +  Y+C C  G  G          +    ++  C  + C +N  C   ++   C C  G+TG  ++   +I++C+ S    C  G  C   + G++C CP G  G     CE  K     +  +    N +C       +C C  GF  +GV C+  I+EC+S+  PC  N +C+++   Y+C C +   G   T     C  DPCL       A+C+   ++  C C+ G+     E      +++EC      +  C     C     S++C+C  GF G+      +ID+C    F C    LC +QV  + C                                        C  PY G  CE   + C + +C  N             FC C  GFK    GR C +DIDEC   PC   A C N  GS+ CKC +G  G            +    S C  G +CL      +C+C  G+  N   +  D+NEC   N C   ++C     SY CEC  GF G N  T+ + C+ SSC             +C+ P       CQ      D + C+    CV        C C  G+      +NC+  +D CQ  G +PC +G  C  +  S++C C  G  G   D  + SC     LRS      C +  +CR  +E     C C   F+       + K  C    C   A C        C C  GF G+    CE ++DEC  NPC+   +C + +  +QC CP GT G   +   N C       G   ++     EC  +   +G +C   IN C +  C      +C+   +A  C+CK  +         + C    C +   C  ++  SG  C C  G  G    + G  C    C     CLE 
Sbjct:   14 GDKGYGGDNCELDEDECKS-FPCQNGGICTDDVNNYKCQCVEGFTGVNCE--KTINDCERYPCLNGGTCRNSIIAYKCDCLPGFEG----------LNCERNKNDCKGEPC-KNGECFDGTDAFTCKCYPGYTG--QLCEHEIDQCEPSP---CKHGGRCERHANGFKCNCPLGTWGQ---RCEEQKNECYSNPCY----NGKCEDGFGIYTCICDPGF--SGVNCETPINECKSS--PCENNGLCIDLIAGYKCDCPSGYYGPRCTSDVNECSPDPCL-----NGATCENEFNDYVCRCQPGYEGKRCE-----YEVNEC-----KSNPCQHGGKCLTHFNSYSCICPSGFTGNNCES--NIDDC--RLFPCKNSGLCIDQVDGFKCI---------------------------------------CSAPYTGKTCESEMNPCNEHSCAANGAVCKPTPDYKDYFCSCPLGFK----GRYCSVDIDECLTYPCHNGASCVNTEGSYECKCEEGFEGRDCL-----LNIDDCASSPCVNGGTCLDETAGFKCLCVDGFGGNLCEE--DINEC-ASNPCKNGAICHEYVNSYTCECKIGFSGTNCQTNDEDCTASSCMNGGKCIDGVNNYTCVCPRGYSGRNCQTRINPCDKNPCQNNGTCVDGGYNDYSCHCSSGW----TGRNCDRLVDWCQQ-GASPCENGR-CYQSGTSYNCVCEDGWTGKVCDVRKVSCRIAAKLRSVDVSDLCLNGGRCR--DEWNSHVCECQDGFYGSXC--QYKKDECGSSPCQNGASCKSMIGTYSCQCLRGFQGH---NCEFNIDECDPNPCQNEGVCHDLIDGFQCTCPYGTVGKLCEFNINECLEGTCHHGGTCIDKIGGYECQCRPGFVGQRCEGDINECLTSRCSPYGTQDCIQLTNAYKCQCKPDYMGKYCETKKNFCESSPCENGGGCTNLIDGSGHKCSCLYGYSGQNCEFYGSVCQSNPCRHGGTCLEH 897          

HSP 4 Score: 75.8702 bits (185), Expect = 3.271e-13
Identity = 241/953 (25.29%), Postives = 349/953 (36.62%), Query Frame = 0
Query:  652 IDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSS----RCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCED-IDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQ----GKCICSPPFFVD--TLDGNHCK-SPCHRFSCGFNAECTPSNPPQCLCKAGFTGNPLTGCE-DLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQ---LACI------GSQC---INPCSSVPCGSNANC---VAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSL-LSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSE-CGTNSHCI-YGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQD-VDECLFSVCGKNAQCINTPGGYD---CRCHSDFVG--------------NPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTG-------DANDPQRGCQREEKCSTNED-----CP---AGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNK--------LTGSCDVYQGCLADSDCAQ---GHSCN-EVSFGMKNCVPA---CDLVNCPSGAECVS--EGHRGYCRCLPGYSG 1523
            +D DEC   PC    IC + + ++ C+C +G      +G   E T    +   C  G +C +S    +C C  G+E     +C        G  C  N  C +   ++ C+C  G+ G      Q C      C P              S C+   +C +   G   C CP G       + CE+  +EC +    PC +G  C +  G ++C C PG  G     +C    + C S S C  N  C+      KC C   ++    T D N C   PC     G   E    N   C C+ G+ G     CE +++EC  NPC+ G  C+    +Y C CP G TG+   +     +   C     C  Q     CI      G  C   +NPC+   C +N        +    +C C  GF        +  C    C + A C+ +     C+C EG     + G  C L +   ++SPC+       GG C+ +                  C C  GF G+     +      EC+S  C   + C  Y N  +C C IG+ G   T C+  T+ EDC +  C +   C        C C RGY G     CQ  ++ C  + C  N  C++  GGY+   C C S + G              +P E     ++ T  + +C +   G         C  A+  +  D +DL   C +   C+   +    E       S  ++  D C  + C   + C +     SC C  GF G       D  DP   CQ E  C    D     CP    G+ C  N N        C   +C     C+   G   C C  GF   +        LT  C  Y       DC Q    + C  +  +  K C      C+   C +G  C +  +G    C CL GYSG
Sbjct:   25 LDEDECKSFPCQNGGICTDDVNNYKCQCVEG-----FTGVNCEKTINDCERYPCLNGGTCRNSIIAYKCDCLPGFE---GLNCERNKNDCKGEPC-KNGECFDGTDAFTCKCYPGYTG------QLCEHEIDQCEP--------------SPCKHGGRCERHANGFK-CNCPLG----TWGQRCEEQKNECYS---NPCYNGK-CEDGFGIYTCICDPGFSGV----NCETPINECKS-SPCENNGLCIDLIAGYKCDCPSGYYGPRCTSDVNECSPDPCLN---GATCE-NEFNDYVCRCQPGYEGKR---CEYEVNECKSNPCQHGGKCLTHFNSYSCICPSGFTGNNCESNIDDCRLFPCKNSGLCIDQVDGFKCICSAPYTGKTCESEMNPCNEHSCAANGAVCKPTPDYKDYFCSCPLGFKGRYCSVDIDECLTYPCHNGASCVNTEGSYECKCEEG-----FEGRDCLLNIDDCASSPCV------NGGTCLDETAG-------------FKCLCVDGFGGN-----LCEEDINECASNPCKNGAICHEYVNSYTCECKIGFSG---TNCQ--TNDEDCTASSCMNGGKCIDGVNNYTCVCPRGYSG---RNCQTRINPCDKNPCQNNGTCVD--GGYNDYSCHCSSGWTGRNCDRLVDWCQQGASPCENGRCYQSGTSYNCVCEDGWTGKVCDVRKVSCRIAAKLRSVDVSDL---CLNGGRCRDEWNSHVCECQDGFYGSXCQYKKDECGSSPCQNGASCKSMIGTYSCQCLRGFQGHNCEFNIDECDPNP-CQNEGVCHDLIDGFQCTCPYGTVGKLCEFNIN-------ECLEGTCHHGGTCIDKIGGYECQCRPGFVGQRCEGDINECLTSRCSPY----GTQDCIQLTNAYKCQCKPDYMGKYCETKKNFCESSPCENGGGCTNLIDGSGHKCSCLYGYSG 873          

HSP 5 Score: 73.559 bits (179), Expect = 1.841e-12
Identity = 235/977 (24.05%), Postives = 340/977 (34.80%), Query Frame = 0
Query: 2802 ESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGG----------NPD-----VLCKTQFG---CKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICTKDPCSISPCG-DEAICRAV--EGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQT-DQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQN-HQVQCFCQPGFKGDPYYQCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQ------------------EKCIDPC-ENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNPPEPLETDPCSACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQAC--LRNKCVDPC---IGTCGVNAECSEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGS--PPNCRPECTEDSACPNHLKCVREKCVDPC--------PGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLR 3721
            E + C     C  + +  +C CP G +G   Q C   +N+C   N C  N +C +  G + C+C  G     F G  C TP + C++     +PC   G C    I  +  ++  C+CP  Y G          +PD       C+ +F    C+ +P  E +    E                  V+ C ++ C+   +C+   +   C C      N+    I   +   C     C   +      C  P  G +C                   +PC+   C  + A+C+      +  C CP G +G      V  + C T  C    +C    G   C+C  GF  +      C+   DD C  SPC     CL      KC+C  G  G+       + E   + C  +PC + A C+    N   C C  G+ G         CQT D+DC +    N  KC D    +              TC C  GY G   R C     P         C +N  C +   C DG   D     C  ++    +N  ++  +CQ G       +C   G    C C+ G+ G   + R     +  C            D C+N    G +C+   +  +C C DG  G+    CQ       K  C  SPC   A CK +     C CL GF G       +    + C +  +CH                   E  I+ C E  C     C  K     C C     G    RC  +  E L T  CS  G   DC ++  +   C C  DY+G  Y E +     ++ C +   C  L +     C    G  G N E    +  CQ NPC     C  +  G   C C     GS    + R EC        +  C +  C+D          P   G+N  C  ++ SS    +FQG  +A    LR
Sbjct:  144 EPSPCKHGGRCERHANGFKCNCPLGTWG---QRCEEQKNECY-SNPC-YNGKCEDGFGIYTCICDPG-----FSGVNCETPINECKS-----SPCENNGLC----IDLIAGYK--CDCPSGYYGPRCTSDVNECSPDPCLNGATCENEFNDYVCRCQPGYEGKRCEYE------------------VNECKSNPCQHGGKCLTHFNSYSCICPSGFTGNNCESNIDDCRLFPCKNSGLCIDQVDGFKCICSAPYTGKTCES---------------EMNPCNEHSCAANGAVCKPTPDYKDYFCSCPLGFKGRYCS--VDIDECLTYPCHNGASCVNTEGSYECKCEEGFEGR-----DCLLNIDD-CASSPCVNGGTCLDETAGFKCLCVDGFGGN-------LCEEDINECASNPCKNGAICH-EYVNSYTCECKIGFSG-------TNCQTNDEDCTASSCMNGGKCIDGVNNY--------------TCVCPRGYSG---RNCQTRINP---------CDKNP-CQNNGTCVDGGYND---YSCHCSSGWTGRNCDRLVDWCQQGASPCENGRCYQSGTSYNCVCEDGWTGKVCDVR-----KVSCRIAAKLRSVDVSDLCLN----GGRCRDEWNSHVCECQDGFYGS---XCQY-----KKDECGSSPCQNGASCKSMIGTYSCQCLRGFQGHNCEFNIDECDPNPCQNEGVCHDLIDGFQCTCPYGTVGKLCEFNINECLEGTCHHGGTCIDKIGGYECQCRPGFVG---QRCEGDINECL-TSRCSPYGT-QDC-IQLTNAYKCQCKPDYMG-KYCETKKNFCESSPCENGGGCTNLIDGSGHKCSCLYGYSGQNCEFYGSV--CQSNPCRHGGTCLEHSGGGFTCVCPPGTTGSFCEQDTRNECA-------YNPCQKGYCIDKIGDYDCFCNPRFVGKN--CDISDPSSPGGIYFQG--IAEEIDLR 976          

HSP 6 Score: 61.2326 bits (147), Expect = 9.203e-9
Identity = 215/886 (24.27%), Postives = 309/886 (34.88%), Query Frame = 0
Query: 2438 QGISCSQGCRSDPDCTADKACHNNQCIGRSSKRK---VTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNS------NTQCQAGLVCIDRQCVGG----CSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASD------CQNGAECIEGVCISGCGSNRDCPY-GEMCEGGQCRNPCNGFECEPN-SFCQV--NGRNPLCLCDRGYQ-RLAS--------------GGCAKTECTTNGQCSRDKSCEGGRCINLCSE--SNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFG-CKARP-----------------EVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPST----LSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICTKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKE------------------------------------ESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFA--NCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDACQPSPCGSKANC-NINDENQAICSCWEGYFG 3222
            +G++C    R+  DC  +  C N +C   +           TG +  H  D C  S C     C    +   C+CP G  G   + C+     C S + C   K C  G  +  C          +C+ G     C +      ++ C+   +CID   + G    C S    P  +  V     DPC N A       TC  + +   C+C  G  G   + C      C S  N C  G  C     + SC           C  GF    C+   D      C+N   CI+ V    C  +   PY G+ CE     NPCN   C  N + C+   + ++  C C  G++ R  S                C  TE +   +C  ++  EG  C+    +  S+ C     C       +C+C  GF GN  +E   D N+C   N C   A C   +  + C C+ G     F G  C T  + C T  +C+N        G + I  V N+   C CP  Y G     C+T+   C   P                    +  TGR C R     L   C +GA   PC      +N RC        C C++          +C  + V C    +  S     L    G C++      C     CQ   + + C   KD C  SPC + A C+++ G   C+C  G +G   +  + E                                      C    C     C +  G   C+C PGFV +        E   + C  S C  +   +C+ + N  KC C P   G          ET K+ C+ SPC +   C N+ D +   CSC  GY G
Sbjct:   95 EGLNCE---RNKNDCKGE-PCKNGECFDGTDAFTCKCYPGYTGQLCEHEIDQCEPSPCKHGGRCERHANGFKCNCPLGTWG---QRCEEQKNECYS-NPCYNGK-CEDGFGIYTC----------ICDPGFSGVNCETPINECKSSPCENNGLCIDL--IAGYKCDCPSGYYGPRCTSDVNECSPDPCLNGA-------TCENEFNDYVCRCQPGYEG---KRCEYEVNECKS--NPCQHGGKCLTHFNSYSC----------ICPSGFTGNNCESNIDDCRLFPCKNSGLCIDQVDGFKCICSA--PYTGKTCESEM--NPCNEHSCAANGAVCKPTPDYKDYFCSCPLGFKGRYCSVDIDECLTYPCHNGASCVNTEGSY--ECKCEEGFEGRDCLLNIDDCASSPCVNGGTCLDETAGFKCLCVDGFGGNLCEE---DINECA-SNPCKNGAICHEYVNSYTCECKIG-----FSGTNCQTNDEDC-TASSCMN--------GGKCIDGVNNY--TCVCPRGYSGRN---CQTRINPCDKNPCQNNGTCVDGGYNDYSCHCSSGWTGRNCDR-----LVDWCQQGA--SPC------ENGRCYQSGTSYNCVCEDGWTGK-----VCDVRKVSCRIAAKLRSVDVSDLCLNGGRCRDEWNSHVC----ECQDGFYGSXCQYKKDECGSSPCQNGASCKSMIGTYSCQCLRGFQGHNCEFNIDECDPNPCQNEGVCHDLIDGFQCTCPYGTVGKLCEFNINECLEGTCHHGGTCIDKIGGYECQCRPGFVGQR------CEGDINECLTSRCSPYGTQDCIQLTNAYKCQCKPDYMG-------KYCETKKNFCESSPCENGGGCTNLIDGSGHKCSCLYGYSG 873          
BLAST of GH13743 vs. L. salmonis genes
Match: EMLSAG00000000097 (supercontig:LSalAtl2s:LSalAtl2s1016:54227:61159:-1 gene:EMLSAG00000000097 transcript:EMLSAT00000000097 description:"maker-LSalAtl2s1016-augustus-gene-0.10")

HSP 1 Score: 166.392 bits (420), Expect = 1.369e-40
Identity = 187/623 (30.02%), Postives = 273/623 (43.82%), Query Frame = 0
Query:  127 CTNTLGSFFCSCNEGYE--GDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLT-NQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNN----AQCL---PNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVN--------CGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYI--GCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKL-SPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQ-----CDQGESCLSSRCVCRRGYE 723
            C ++    FC C +GYE   D   C DI+EC   ++   C+   +C N+P    CKC  G+EGD   +C DI+EC T + +C  N  CINT G+  C C  GF       C D DEC  +  G    C NL G +QC C  G   +     C  +   ++        +CG    C  +     C C  GF    + SC+DINEC +S+L  CG G+ C N    Y C+C +GY          +   +TC    +C  N     +C+   P  SC+C  G+     +C+D DEC   +NPCG    C N PG ++C C       P  +     C ++N        CG    C        C+C +G+ ++  + S+ C+D DEC  S         ++ C N+ G F C+C  GF     +   C DI+ECA N   C +  +C N +GS+ C+CY G + D        +R +C    EC  +          + P  G  C+  C +          +  GL  C+C PG+ + S + R C+D +EC  N  G    C N LG   C C  G   D  +  +      C+ ++      C   ES L  RC+C  G++
Sbjct:  549 CIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQ--CLN--KCMNVPGSAYCKCDSGYEGD---DCSDINECETQDLICDHN--CINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIG-----IANCGIYGDCINTPGSFYCECHPGFEL-MEDSCMDINECTNSTL--CGSGS-CNNLEGTYECKCDSGY----------IFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLH-DNPCGVGGKCNNKPGSFDCDC------APGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQND-SNICIDFDECLSSPC------FHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYKKD--------ERGNCFLKDECRLS----------RRPNGG--CQQLCIN----------IPGGLK-CECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFK 1096          

HSP 2 Score: 150.599 bits (379), Expect = 8.233e-36
Identity = 200/754 (26.53%), Postives = 299/754 (39.66%), Query Frame = 0
Query:  178 VCKCKPGFEGDGKVECRDIDECLTN-QVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTN----PCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKI-SCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDG----------RFACEPVKVRT------TCSSDFDCTNNAQC-------LPNG-------------SCACRKGFQPN--GVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVN-------CGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKC----------------------------------GVNAICSNSPGSFNCVCAKGF---NGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQG--ESCLS----SRCVCRRGY--ERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISY-CACPRGYEMNPRTKNCEDI 834
             C+C  GF  +   EC D+DEC+ + ++C  + +C N  G + C+C  GF       CVDI+EC  N    PC    +C N+ G YQC+C     G P            +S + C   + G +  C  S N + C C +G+  D    +CVDINEC +  + QC     C+N      C+C +GY GD              C+   + T      TC + FD  +  +C       + NG              C C+ GF  N   + C D +EC      CG    C+N PG + C+C       P  +   D C+++N       CG   SC  ++    C C+ G+ ++    +S CLDI+EC ++    G+C                                  GV   C+N PGSF+C CA G+   NG     C DI+E +  +  CG    C N  GS+ C C+ G  +D      Q     C    EC+ ++ CF+  C                        +CL + G    + LP         +C DI+ECA N      +C N+LGS  C+C +G   D    C  +   EC    + + G  + C++     +C C  GY  +      CVD NEC + N  G    C N  G + C C  GF+ +     +     +CS                 +N      C     G+ + C CP G+++    + C+ I
Sbjct:  432 TCECHDGFFLNDDGECEDVDECVDDPELC--DHICTNKPGTYMCDCRLGFTSQG-TACVDINECLLNNGHGPCQ--DECKNVDGGYQCEC----GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDI-QCL--NKCMNVPGSAYCKCDSGYEGDDCSDINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCEC------HPGFELMEDSCMDINECTNSTLCGS-GSCNNLEGTYECKCDSGYIFH----NSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNG----XCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHD------QNDSNICIDFDECL-SSPCFHSEC-----------------KNTLGGFECLCETGFALSEILP--------NTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGNCFLKD--ECRLSRRPNGGCQQLCINIPGGLKCECNPGYIVDSQDPRLCVDKNECTINN-GGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSV----------------NNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPI 1107          

HSP 3 Score: 127.487 bits (319), Expect = 8.391e-29
Identity = 175/599 (29.22%), Postives = 239/599 (39.90%), Query Frame = 0
Query:   45 DVLQLFEISKLCDGVPDCYRGSDEANSQIKCTKDCLYTTGRHCQHGACLDSQCYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYE-GDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFE-GDGKVECRDIDECLTNQV-CGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDEC-RTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGY---NGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGF---QPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVN--------CGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGF---NGDPYIGCFDIDECAENRFICGREALCTNQVGSYSC--------------------------------------------QCYNGGQYDPSSLSCQ 578
            D  +L E  K C  + +C  G       I+C   C+   G          + C C+ GY G  C   D NEC+ +       C NT GS  C+C  G++  D   C D DEC   E+ N   +   C NL   + C CKPGF      + C D +EC      CGI   CINT G+F CEC PGF     D C+DI+EC  +  CG G+ C NL G Y+C+C +G              +  +    C    CG    C   S G  C+C  G+  D    C D +EC   +   CGVG  C N+   + C+C  GY   NG      E    +  C    DC NN        C C +GF   Q +  +C D DEC S+  PC  +S C N  G +EC C     G    +   + C ++N        C Q   C  +    +C C EG+    K+    C   DEC  S  P G C    +C N PG   C C  G+   + DP + C D +EC  N   C  +  C N++G ++C                                             C +G +    + +C+
Sbjct:  562 DGYELDEDWKTCVDINECVTG------DIQCLNKCMNVPGS---------AYCKCDSGYEGDDCS--DINECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDEC---EMDNGGCEQV-CNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFEL-MEDSCMDINECTNSTLCGSGS-CNNLEGTYECKCDSGYI---------FHNSTCLDINECIRNPCGHGE-CINESPGYSCSCHSGYV-DVDNVCRDYDECLHDN--PCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSF---ECVCHQGFIHDQNDSNICIDFDECLSS--PC-FHSECKNTLGGFECLC---ETGFALSEILPNTCEDINECALNNGDCSQ--VCVNILGSHYCRCYEGYK---KDERGNCFLKDECRLSRRPNGGC--QQLCINIPGGLKCECNPGYIVDSQDPRL-CVDKNECTINNGGC--QHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCK 1105          

HSP 4 Score: 125.946 bits (315), Expect = 2.747e-28
Identity = 197/750 (26.27%), Postives = 277/750 (36.93%), Query Frame = 0
Query:  468 SEAFCICEEGWAYNPKE------------------ISSGCLDIDE-----CDKSISPTGKCGVNAICSNSPG-SFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEP--------------YVGPNCEDACRDATCFPNSQCLVQNG-----------LPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFEC-TQDSQCDQG--ESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNP--------------------FTSCQSCSGS-SCSCLPPYQDIEGRCQ------------LADCSNCEAPAKCVQITGGISY----------------------------CACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQG----KCICSPPFFVDTLDGNHC-------KSPCHRFSCGFNAECTPS-NPPQCLCKAGFTGNPL--TGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQG--NCVSL--CNQVICGSNAQCIVSPSGPTCQCFEGM 1086
            +E    C+EG+A++P +                  ++   L+I +     CD  +    +C    IC    G +  C C  GF  +    C D+DEC ++  +C  + +CTN+ G+Y C C          L    +  +C    EC+ N    NG   CQ+                 G    D   + TC  +  C V NG             FC C  G++L  + ++C+DI+EC          C N+ GS  CKC  G  GD  S        EC TQD  CD     +  S+ C C+ G++     +C D +EC + N  G   VC NL G++ C C  GF  N                     +  C +  GS  C C P ++ +E  C                C+N E   +C   +G I +                            C+C  GY        C D DEC  +   PCG G  C N PGSF C C PG   +   G C  +         C  + +C+      +C+C   F  D  D N C        SPC      F++EC  +    +CLC+ GF  + +    CED++ECALN      +C+N L ++ C C  G   D   N         C   DEC       G  C   C ++P G             C C  G+  DSQ    CV    C     G    CI    G TC C  G 
Sbjct:  359 AEVLYKCDEGYAFDPSKPDTLFCSERRWIGKRPLCVAKSTLEIADPSRPSCDPDVQEKKRC--EHICYLDKGVTPTCECHDGFFLNDDGECEDVDECVDDPELC--DHICTNKPGTYMCDC---------RLGFTSQGTACVDINECLLN----NGHGPCQDECKNVDGGYQCECGGLPGTQLSDK-DNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGDDCSDIN-----ECETQDLICDHNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDN-GGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYECKCDSGYIFHNSTCLDINECIRNPCGHGECINESPGYSCSCHSGYVDVDNV--CRDYDEC--LHDNPCGVGGKCNNKPGSFDCDCAPGY--EFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPC------FHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDERGN---------CFLKDECRLSRRPNGG-CQQLCINIPGGLK-----------CECNPGYIVDSQDPRLCVDKNECTINNGGCQHACINKLGGHTCSCHLGF 1051          

HSP 5 Score: 119.013 bits (297), Expect = 3.666e-26
Identity = 182/616 (29.55%), Postives = 244/616 (39.61%), Query Frame = 0
Query:  351 CECPAGYNGDGRFACEPVK--VRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCL-----EVNCGQ-RASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQ---ECIGNAVCFNGACNCQEPYVGPNCEDACRD--------ATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSS---RCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGN------------------PFTSCQSCSGS-SCSCLPPYQDIEGRCQL-ADCSNCEAP----AKCVQITGGISYCACPRGYEMNPRTKN-CEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQ--------GKCICSPPFFVDTLD 911
            CEC  G+  +    CE V   V      D  CTN         C CR GF   G  C DI+EC            C NV G Y+C+C   L GT         C+     +VN G     C    ++ FC+C +G  Y   E    C+DI+EC      TG       C N PGS  C C  G+ GD    C DI+EC     IC     C N  GS  C C  G  +D    +    +  C+ D    E + N +     C C+  +        C D        A C     C+   G  +C+C PGF+L  +  SC+DI+EC  +       C NL G++ CKC  G               EC ++  C  GE    S    C C  GY  +    C D +ECL  N CGV   C N PGS+DC+C  G++                    P   C +  GS  C C   +   +    +  D   C +     ++C    GG   C C  G+ ++    N CEDI+EC A+ +  C     C+N  GS  C C  G   D  +G+C  L+  C  +   R N  C Q         KC C+P + VD+ D
Sbjct:  433 CECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTY---MCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCEC-GGLPGTQLSDKDNHTCISDEACQVNNGGCSHECIHSYNQIFCLCPDG--YELDEDWKTCVDINEC-----VTGDIQCLNKCMNVPGSAYCKCDSGYEGD---DCSDINECETQDLICDHN--CINTEGSAHCTCKAG--FDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCECHPGFELMED--SCMDINECTNSTLCGSGSCNNLEGTYECKCDSGY---IFHNSTCLDINECIRNP-CGHGECINESPGYSCSCHSGY-VDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNICIDFDECLSSPCFHSECKNTLGGFE-CLCETGFALSEILPNTCEDINEC-ALNNGDCSQV--CVNILGSHYCRCYEGYKKDE-RGNCF-LKDECRLSR--RPNGGCQQLCINIPGGLKCECNPGYIVDSQD 1015          

HSP 6 Score: 87.4261 bits (215), Expect = 1.363e-16
Identity = 110/388 (28.35%), Postives = 157/388 (40.46%), Query Frame = 0
Query:   87 CQHGACLDSQ----CYCNDGYGGKGCDMPDTNECKY-RPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGF---EGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPH--DGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGF---TGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRT-----------------------TCSSDFDCTNNAQ-CLPNG-------------------------------SCACRKGFQPNGVLCQ 406
            C HG C++      C C+ GY        D +EC +  PC V G C N  GSF C C  GYE     C DI+E  + +  + C  + +C N    + C C  GF   + D  + C D DECL++     ++ C NT G F C C  GF  +    + C DI+EC  N       C N+LG++ C+C  G   D  +G C  +    +S++     + G   LC     GL C C  G+   + DP++ CVD NEC   ++   G    CIN+  G+ C C  G+  D +   + VK +                         C S F    +A+ C P G                                  CRKGF P G + +
Sbjct:  782 CGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEFKNGXCHDINEXSLEK--DPCGPHGDCVNNDGSFECVCHQGFIHDQNDSNI-CIDFDECLSSPC--FHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQVCVNILGSHYCRCYEGYKKDE-RGNCFLKDECRLSRR----PNGGCQQLCINIPGGLKCECNPGYIVDSQDPRL-CVDKNEC---TINNGGCQHACINKLGGHTCSCHLGFKPDEKNPEKCVKAKACSVNNGGCSHICKSTESGLHHRCMCPSGFKLKTDARTCKPIGGICSSAPRPSNGYYRCNKKKVSGYFVKGTKCKLKCRKGFMPTGHITR 1155          

HSP 7 Score: 68.1662 bits (165), Expect = 9.042e-11
Identity = 63/204 (30.88%), Postives = 79/204 (38.73%), Query Frame = 0
Query: 1843 QCSCQPGYEMTQSG--CSDLNECKNNI--CGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADS---LSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGM 2039
            QC C+PG+ +      C+D NEC   I  CG    C NTPGS+ C C         G     D C    +C ++  C + S   L G  +C   CD  Y    +TC  I                             C    CGHG C  E     C C  GY  + + C+D DEC   NPC    KC N+ GS+ C C  G 
Sbjct:  675 QCGCKPGFHLNTDNLTCTDENECTIGIANCGIYGDCINTPGSFYCEC-------HPGFELMEDSCMDINECTNSTLCGSGSCNNLEGTYEC--KCDSGYIFHNSTCLDINE---------------------------CIRNPCGHGECINESPGYSCSCHSGYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGY 842          

HSP 8 Score: 67.0106 bits (162), Expect = 1.697e-10
Identity = 161/666 (24.17%), Postives = 228/666 (34.23%), Query Frame = 0
Query:  936 PQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDP---------YTNGCSGS-----KSVECGADDECHG----QLA------CIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNA---QCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCD---------------------------PNRLSCTCQSGF-LGDPTLVCMPPTQQAECS---SECGTNSHCIYGNPNS--CACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQ-CGPNAICN----LGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCP-TNEKCMVSDGMPICLCNSGFEKNKLTGSC--DVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMI 1533
            P C C  GF  N    CED+DEC  +P     IC NK  TY C+C  G T              N   G      K+V+ G   EC G    QL+      CI  +    C     G +  C+   +  +C C  G+  D         N+ + G      +C+  P    C+C  G  G+           CS  + C  Q   C    CI   G   C   A  D                                C C+ GF L    L C   T + EC+   + CG    CI   P S  C C+ G+     +  ++    E  +S  CG  + C+   G  EC C  GY       C D++EC+ + CG + +CIN   GY C CHS        G V ++ V  D D C +   CG    CN       C CA G++                   N  C             H       ++  CGP+  C+ ++    C+C  GF  D ND                                C+D  + +S P  + +C  + G   CLC +GF  +++  +   D+ +  L + DC+Q                            CV+     YCRC  GY    D+R  C +
Sbjct:  431 PTCECHDGFFLNDDGECEDVDECVDDPELCDHICTNKPGTYMCDCRLGFTSQGTACVDINECLLNNGHGPCQDECKNVDGGYQCECGGLPGTQLSDKDNHTCISDEA---CQVNNGGCSHECIHSYNQIFCLCPDGYELDEDWKTCVDINECVTGDIQCLNKCMNVPGSAYCKCDSGYEGD----------DCSDINECETQDLICD-HNCINTEGSAHCTCKAGFDLMDETECFDKDECEMDNGGCEQVCNNLEGTFQCGCKPGFHLNTDNLTC---TDENECTIGIANCGIYGDCI-NTPGSFYCECHPGFELMEDSCMDIN---ECTNSTLCGSGS-CNNLEGTYECKCDSGYI-FHNSTCLDINECIRNPCG-HGECINESPGYSCSCHS--------GYVDVDNVCRDYDECLHDNPCGVGGKCNNKPGSFDCDCAPGYEF-----------------KNGXC-------------HDINEXSLEKDPCGPHGDCVNNDGSFECVCHQGFIHDQND-----------------------------SNICIDFDECLSSPCFHSECKNTLGGFECLCETGFALSEILPNTCEDINECALNNGDCSQ---------------------------VCVNILGSHYCRCYEGYK--KDERGNCFL 976          
BLAST of GH13743 vs. L. salmonis genes
Match: EMLSAG00000001427 (supercontig:LSalAtl2s:LSalAtl2s1244:154428:157540:-1 gene:EMLSAG00000001427 transcript:EMLSAT00000001427 description:"maker-LSalAtl2s1244-augustus-gene-0.37")

HSP 1 Score: 135.961 bits (341), Expect = 6.852e-32
Identity = 187/594 (31.48%), Postives = 238/594 (40.07%), Query Frame = 0
Query: 3184 PVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNP--LTGCLPECQTDQDCPSDQSCNNLKCQ---DPC-PGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRP--LPQCQRNQDCPSFKVCDDGNCV---DPC-PERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCV---DPC-VNNCGEGAQCQVVKH-KPMCSCPDGSTGNPY---------------------KRCQIIVRPPPKQPCFPSPCGANAVCKI-VRAQEKCHCLPGFLGDPPY---CRPECLADHECPSHKICHQEKCI---DPCE-NVCGINALCHTK-NHKVICVCPSNM--QGDPFDRCSPN-PPEP--------------LETDPC--SACGINADCDVRPNDQVICSCPKDYLGDP--YIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECSEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPP---NCRPECTEDSACPNHLKCVREKCV---DPC-PGICGRNAECKHTNMS 3702
            P   T  D C PSPCG   NC  N +   +C C  G    P  + GC PEC  D +C +   C N +C    DPC P  CG G +           C+E   G+P  QC    VPKP       P+C  + DC + +VC +  C    DPC P  CG    CR   +           G+P  QC    N+ +   +P    G   C PEC +  +C     CL  +C    DPC  + CG G  C+   +  P+C C  G    P                      K  + + +P    PC PSPCG N  CK  +     CHCL  F+  P     C  EC  D +C S  IC+  KCI   DPC+ + CG    C+   N   IC C   +  + D    C P    +P               + DPC  S CG  A+C V  +   IC C K  +  P     C PEC+ ++DC S   C    C+               P DPC P+PCG  ++CE N  G   C C+   I  P     C PEC  D  C     C   KCV   DPC P  CG  A C  T  S
Sbjct:   76 PQTRTIIDPCSPSPCGPGTNCKTNADGNPVCHCNPGLIPKPDTINGCGPECTIDPECRNGLVCINQRCTNRPDPCNPSPCGPGTT-----------CKENGNGNPVCQCQSGLVPKPDTITGCGPECIIDPDCRNGQVCINQRCTKKPDPCDPSPCGPGTTCRENQN-----------GNPVCQC----NKGLVP-KPDTITG---CGPECFVDAECHGGFVCLNQKCSQKQDPCEPSPCGPGTICKKSNNGNPVCHCRAGLIPKPDTITGCGPECVTDRDCHSGLICKSSKCVEKP---DPCVPSPCGPNTSCKANINGNPVCHCLSDFIPKPDTITGCGYECERDSDCQSSYICNDFKCIVKPDPCDPSPCGPGTSCYPNFNGNPICKCLLGLVPKPDTITGCGPECKRDPDCNRGYICQTGKCIEKPDPCNPSPCGPGAECMVNTSGNPICRCQKGLVPKPDTITGCGPECVIDSDCDSGYICKTQTCI-------------VRP-DPCDPSPCGDGAICEENAYGNPTCHCKLGLIPKPDPFIRCGPECVIDRDCNQGYICNNTKCVIEPDPCQPSPCGIGALCTKTGRS 622          

HSP 2 Score: 128.642 bits (322), Expect = 1.210e-29
Identity = 178/610 (29.18%), Postives = 236/610 (38.69%), Query Frame = 0
Query: 3550 DPCSA--CGINADCDVRPNDQVICSCPKDYLGDPYI--ECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECSEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSP---PNCRPECTEDSACPNHLKCVREKCV---DPC-PGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGS-CRCIEDYVGDP--FVSCRPECVVNSDCPYGLACLSHKC---KDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQV------ECHKPP---SGIVTEEII-----DPCANRECGPYSQ-KVERNGICTCSCLPGYVGAP---PDCQPICVVNSDCPAHLACINNDCV---DPCFQNVCGSNTHCYVK-SHQAKCECFPGYDGNPLIGCNKGPTGTITAE--------------ERDPCET--CGQHAIC--HIHNNIAACKCEDNYIDKPP---NCRRECVLHEDCPKHLACIQYKCA---SPC-INQCGKNADCSVINHDP--ICRCLPQYFGDPLVKCEPPKVSQPIDP 4093
            DPCS   CG   +C    +   +C C    +  P     C PEC  + +C +   C              +N  C+   DPC P+PCG  + C+ N NG  +C+CQ+  +  P     C PEC  D  C N   C+ ++C    DPC P  CG    C+     +  C               + N  L+     I G          C  GF+    N+ C +K +       PCEP+PCG    C + N     C C    +  P     C PECV + DC  GL C S KC    DPC  +  CG N  C  N N +  C CL+D++  P        EC +     S  +  +       DPC    CGP +      NG   C CL G V  P     C P C  + DC     C    C+   DPC  + CG    C V  S    C C  G    P      GP   I ++                DPC+   CG  AIC  + + N   C C+   I KP     C  ECV+  DC +   C   KC     PC  + CG  A C+         C C  +YFGDP V+C+   V   ++P
Sbjct:   83 DPCSPSPCGPGTNCKTNADGNPVCHCNPGLIPKPDTINGCGPECTIDPECRNGLVC--------------INQRCTNRPDPCNPSPCGPGTTCKENGNGNPVCQCQSGLVPKPDTITGCGPECIIDPDCRNGQVCINQRCTKKPDPCDPSPCGPGTTCRENQNGNPVC---------------QCNKGLVPKPDTITGCGPECFVDAECHGGFVC--LNQKCSQKQD-------PCEPSPCGPGTICKKSNNGNPVCHCRAGLIPKPDTITGCGPECVTDRDCHSGLICKSSKCVEKPDPCVPS-PCGPNTSCKANINGNPVCHCLSDFIPKPDTITGCGYECERDSDCQSSYICNDFKCIVKPDPCDPSPCGPGTSCYPNFNGNPICKCLLGLVPKPDTITGCGPECKRDPDCNRGYICQTGKCIEKPDPCNPSPCGPGAECMVNTSGNPICRCQKGLVPKPDTITGCGPECVIDSDCDSGYICKTQTCIVRPDPCDPSPCGDGAICEENAYGN-PTCHCKLGLIPKPDPFIRCGPECVIDRDCNQGYICNNTKCVIEPDPCQPSPCGIGALCTKTGRSLGFYCDCPEKYFGDPNVECKKIVVIGSVNP 652          

HSP 3 Score: 119.398 bits (298), Expect = 9.293e-27
Identity = 149/512 (29.10%), Postives = 202/512 (39.45%), Query Frame = 0
Query: 3447 PCFPSPCGANAVCKI-VRAQEKCHCLPGFLGDPPY---CRPECLADHECPSHKICHQEKCI---DPCE-NVCGINALCH-TKNHKVICVCPSNM--QGDPFDRCSP---------------NPPEPLETDPC--SACGINADCDVRPNDQVICSCPKDYLGDP--YIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECSEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSP---PNCRPECTEDSACPNHLKCVREKCV---DPC-PGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHV---------------------------MRHNPMCTCLEGFIGDPY---------------NEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSG--SCRCIEDYV--GDPFVSCRPECVVNSDCPYGLACLSHKC---KDPCEHNQACGINAVCNVNNNHHA-RCSCLNDYVGDPQVECHK 3871
            PC PSPCG    CK        C C  G +  P     C PEC+ D +C + ++C  ++C    DPC+ + CG    C   +N   +C C   +  + D    C P               N     + DPC  S CG    C    N   +C C    +  P     C PEC+T+ DC S   C  +KCV              E  DPC P+PCG N+ C++N+NG  +C C +D+I  P     C  EC  DS C +   C   KC+   DPC P  CG    C      +  C    G  +    ++         D     G++                              NP+C C +G +  P                + G I K +       PC+P+PCG  A C E+N  G  +C C    +   DPF+ C PECV++ DC  G  C + KC    DPC+ +  CGI A+C          C C   Y GDP VEC K
Sbjct:  149 PCNPSPCGPGTTCKENGNGNPVCQCQSGLVPKPDTITGCGPECIIDPDCRNGQVCINQRCTKKPDPCDPSPCGPGTTCRENQNGNPVCQCNKGLVPKPDTITGCGPECFVDAECHGGFVCLNQKCSQKQDPCEPSPCGPGTICKKSNNGNPVCHCRAGLIPKPDTITGCGPECVTDRDCHSGLICKSSKCV--------------EKPDPCVPSPCGPNTSCKANINGNPVCHCLSDFIPKPDTITGCGYECERDSDCQSSYICNDFKCIVKPDPCDPSPCGPGTSCYPNFNGNPICKCLLGL-VPKPDTITGCGPECKRDPDCNRGYICQTGKCIEKPDPCNPSPCGPGAECMVNTSGNPICRCQKGLVPKPDTITGCGPECVIDSDCDSGYICKTQTCIVRPDPCDPSPCGDGAIC-EENAYGNPTCHCKLGLIPKPDPFIRCGPECVIDRDCNQGYICNNTKCVIEPDPCQPS-PCGIGALCTKTGRSLGFYCDCPEKYFGDPNVECKK 643          

HSP 4 Score: 117.087 bits (292), Expect = 4.717e-26
Identity = 188/661 (28.44%), Postives = 254/661 (38.43%), Query Frame = 0
Query: 3918 CQPICVVNSDCPAHLACINNDC--------------VDPCFQNVCGSNTHCYVKSH-QAKCECFPGYDGNPLIGCNKGPTGTITAEER--------------DPC--ETCGQHAICHIHNN-IAACKCEDNYIDKP---PNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQPIDPCLPNPCGENTEHRK-AGSNCICTCLPGFYGDP--YTGCNYECLIHDDCPYNRACASNHRCS---NPCIGN-CGVQAICNVIEH-NAICSCPEEL--EGDPFIRCIPAGCRSDSECPSTEACIDRECR---DPCPFQTCGVNAECETRSHLS-TCICLEGFEGNP--YEGCTQYECKRHEECPSTLACRDFKCV---DPCD---CAVGANCRVSNHKTTCTCPPGFTGDPYSR---DDPPRPPILT---VGCEGNHECPDSHACINSRCV---DPCISNPCKNGATCTVNKH-EIFCACPNGFLFIGDFECKAPERPECVSDPECPLHLACISERCL---DPCTSQACGVNAKCTVTTHV-PVCACELDYV--GDPYTVCQKAGCQSNSECPLSEACINRKC---QDPCPFEECGRNADCS-TNRHVPM-CSCLTGYEGNPYEECRQYECL 4500
            C  + V + DCP    C  + C              +DPC  + CG  T+C   +     C C PG    P      GP  TI  E R              DPC    CG    C  + N    C+C+   + KP     C  EC++  DC     CI  +C                                          ++  DPC P+PCG  T  R+    N +C C  G    P   TGC  EC +  +C     C  N +CS   +PC  + CG   IC    + N +C C   L  + D    C P  C +D +C S   C   +C    DPC    CG N  C+   + +  C CL  F   P    GC  YEC+R  +C S+  C DFKC+   DPCD   C  G +C            P F G+P  +      P+P  +T     C+ + +C   + C   +C+   DPC  +PC  GA C VN      C C  G +   D        PECV D +C     C ++ C+   DPC    CG  A C    +  P C C+L  +   DP+  C    C  + +C     C N KC    DPC    CG  A C+ T R +   C C   Y G+P  EC++   +
Sbjct:   46 CWSVGVRDIDCPGAAPCCFDGCGNHCLLTLPQTRTIIDPCSPSPCGPGTNCKTNADGNPVCHCNPGLIPKPDTINGCGPECTIDPECRNGLVCINQRCTNRPDPCNPSPCGPGTTCKENGNGNPVCQCQSGLVPKPDTITGCGPECIIDPDCRNGQVCINQRC------------------------------------------TKKPDPCDPSPCGPGTTCRENQNGNPVCQCNKGLVPKPDTITGCGPECFVDAECHGGFVCL-NQKCSQKQDPCEPSPCGPGTICKKSNNGNPVCHCRAGLIPKPDTITGCGPE-CVTDRDCHSGLICKSSKCVEKPDPCVPSPCGPNTSCKANINGNPVCHCLSDFIPKPDTITGC-GYECERDSDCQSSYICNDFKCIVKPDPCDPSPCGPGTSCY-----------PNFNGNPICKCLLGLVPKPDTITGCGPECKRDPDCNRGYICQTGKCIEKPDPCNPSPCGPGAECMVNTSGNPICRCQKGLVPKPDTITGC--GPECVIDSDCDSGYICKTQTCIVRPDPCDPSPCGDGAICEENAYGNPTCHCKLGLIPKPDPFIRCGPE-CVIDRDCNQGYICNNTKCVIEPDPCQPSPCGIGALCTKTGRSLGFYCDCPEKYFGDPNVECKKIVVI 647          

HSP 5 Score: 103.99 bits (258), Expect = 6.078e-22
Identity = 169/601 (28.12%), Postives = 234/601 (38.94%), Query Frame = 0
Query: 1687 QCPPGQICKSGI---CAAGCSSNTHCEEGRVCITGKCQ---DPCTET-CGPNALCSPEFEN--LCQCPEGFAGVPTAAQGCVRIPPTCTTD--CPASSLCFNGYCM--PECTSHGQCARGEQC-SNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKNNICGAGKTCANTP-GSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCL---DPCDISYCTPLATCNV-IQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYT-QGCKPKAQCYSNSECSSDTRCQNGRCV---DPCD-GFCGIGAKCVVKNH-SPKCSCLPRWRGNP-KIKCELLECVENADCDASKSCLNNKCV---DACQLSGICGLNSRCRMSNHG-PVCSCNSGHTGDPRECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSRSEC---KDPCQQPNACGVNALCASKNHQQ--VCSCPPGFTGNSKVECVRI 2252
             C PG I K      C   C+ +  C  G VCI  +C    DPC  + CGP   C        +CQC  G    P    GC    P C  D  C    +C N  C   P+      C  G  C  N     +C  +K  +     +   C P C  D++C  G VC             + Q      + C+ + CG G  C  +  G+ +C C    +P          +C +D+DC+  L C +       KC+   DPC  S C P  +C   I     C C   F   P     GC        G+ C   S    D      C D   ++  +  D   C  G  C+      N  G+  C C  G+V  P T  GC P  +C  + +C+    CQ G+C+   DPC+   CG GA+C+V    +P C C       P  I     ECV ++DCD+   C    C+   D C  S  CG  + C  + +G P C C  G    P               D F+   P    C++D +CN   +C+ ++C    DPCQ P+ CG+ ALC          C CP  + G+  VEC +I
Sbjct:  107 HCNPGLIPKPDTINGCGPECTIDPECRNGLVCINQRCTNRPDPCNPSPCGPGTTCKENGNGNPVCQCQSGLVPKPDTITGCG---PECIIDPDCRNGQVCINQRCTKKPDPCDPSPCGPGTTCRENQNGNPVCQCNKGLVPKPDTITG-CGPECFVDAECHGGFVC-------------LNQKCSQKQDPCEPSPCGPGTICKKSNNGNPVCHCRAGLIPKPDTITGCGPECVTDRDCHSGLICKS------SKCVEKPDPCVPSPCGPNTSCKANINGNPVCHCLSDFIPKPDT-ITGC--------GYECERDS----DCQSSYICNDFKCIVKPDPCDPSPCGPGTSCY-----PNFNGNPICKCLLGLVPKPDTITGCGP--ECKRDPDCNRGYICQTGKCIEKPDPCNPSPCGPGAECMVNTSGNPICRCQKGLVPKPDTITGCGPECVIDSDCDSGYICKTQTCIVRPDPCDPS-PCGDGAICEENAYGNPTCHCKLGLIPKP---------------DPFIRCGPE---CVIDRDCNQGYICNNTKCVIEPDPCQ-PSPCGIGALCTKTGRSLGFYCDCPEKYFGDPNVECKKI 644          

HSP 6 Score: 100.908 bits (250), Expect = 5.047e-21
Identity = 164/576 (28.47%), Postives = 218/576 (37.85%), Query Frame = 0
Query: 1994 HCQDGYQLIGSNCQDIDECASGNPCHNSAKCT-NEQGSYQCTCHDGMVGDPYT-QGCKPKAQCYSNSECSSDTRCQNGRCV---DPCD-GFCGIGAKCVV-KNHSPKCSCLPRWRGNP-KIKCELLECVENADCDASKSCLNNKCV---DACQLSGICGLNSRCRMSNHG-PVCSCNSGHTGDPRECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSRSEC---KDPCQQPNACGVNALC-ASKNHQQVCSCPPGFTGNSKV------ECVRIPSTCILDSNCPGSMQCHKSICMHQ--------CQSHNDCAINERCDEG-KCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQC---QDPCKAAQCGPNALCQV-IERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSK-----EICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQAL---CSCPEGMEGNPIEHCQPTLV 2526
             C++G   I   C +  +  + +PC     C  N  G+  C C  G+V  P T  GC P  +C  + +C +   C N RC    DPCD   CG G  C   +N +P C C       P  I     EC  +A+C     CLN KC    D C+ S  CG  + C+ SN+G PVC C +G    P               D      P    C+ D +C+   +C  S+C    DPC  P+ CG N  C A+ N   VC C   F            EC R       DS+C  S  C+   C+ +        C     C  N   +   KCLL      D   G       C   C    DC     C   +C    DPC  + CGP A C V       C CQ+G +P P  +  C  E   C  +  C   ++C    C         C+ +    G IC+E    +  C  K     +    I C   C  D DC     C+N +C+                    DPC  S CG  A C TK  ++L   C CPE   G+P   C+  +V
Sbjct:  131 ECRNGLVCINQRCTNRPDPCNPSPCGPGTTCKENGNGNPVCQCQSGLVPKPDTITGCGP--ECIIDPDCRNGQVCINQRCTKKPDPCDPSPCGPGTTCRENQNGNPVCQCNKGLVPKPDTITGCGPECFVDAECHGGFVCLNQKCSQKQDPCEPS-PCGPGTICKKSNNGNPVCHCRAGLIPKP---------------DTITGCGPE---CVTDRDCHSGLICKSSKCVEKPDPCV-PSPCGPNTSCKANINGNPVCHCLSDFIPKPDTITGCGYECER-------DSDCQSSYICNDFKCIVKPDPCDPSPCGPGTSCYPNFNGNPICKCLLGLVPKPDTITG-------CGPECKRDPDCNRGYICQTGKCIEKPDPCNPSPCGPGAECMVNTSGNPICRCQKGLVPKPDTITGCGPE---CVIDSDCDSGYICKTQTC---IVRPDPCDPSPCGDGAICEENAYGNPTCHCKLGLIPKPDPFIRCGPECVIDRDCNQGYICNNTKCVIE-----------------PDPCQPSPCGIGALC-TKTGRSLGFYCDCPEKYFGDPNVECKKIVV 646          

HSP 7 Score: 97.8265 bits (242), Expect = 4.711e-20
Identity = 169/555 (30.45%), Postives = 218/555 (39.28%), Query Frame = 0
Query: 4192 CRSDSECPSTEACIDRECR---DPCPFQTCGVNAECETRSHLS-TCICLEGFEGNP--YEGCTQYECKRHEECPSTLACRDFKCV---DPCD---CAVGANCRVS-NHKTTCTCPPGFTGDPYSRDDPPRPPILT---VGCEGNHECPDSHACINSRCV---DPCISNPCKNGATCT-VNKHEIFCACPNGFLFIGDFECKAPERPECVSDPECPLHLACISERCL---DPCTSQACGVNAKCTVTTHV-PVCACELDYVGDPYTVCQ-KAGCQSNSECPLSEACINRKC---QDPCPFEECGRNADCSTNRHV-PMCSCLTGYEGNPYEECR-QYECLVDSDCPYTLACPNRECI---DPCQ---CAANAECSVQNH-KASCTCLPGFQGNAYT-GGCSPILEPVVEDNKCKQDGDCPSRQACFDGDC---KNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEP-IEFG--CQTHQDCPPSQVCNNAACI---NPCTTQNPCSSLAKCYVQDH-MG-KCACPAGMTGDPYVSCLEIVT 4697
            C  D EC +   CI++ C    DPC    CG    C+   + +  C C  G    P    GC   EC    +C +   C + +C    DPCD   C  G  CR + N    C C  G           P+P  +T     C  + EC     C+N +C    DPC  +PC  G  C   N     C C  G +   D        PECV+D +C   L C S +C+   DPC    CG N  C    +  PVC C  D++  P T+      C+ +S+C  S  C + KC    DPC    CG    C  N +  P+C CL G    P        EC  D DC     C   +CI   DPC    C   AEC V       C C  G      T  GC P         +C  D DC S   C    C    +PC    PCG  +IC+ +         C+C+ G         I + +P I  G  C   +DC    +CNN  C+   +PC   +PC   A C      +G  C CP    GDP V C +IV 
Sbjct:  126 CTIDPECRNGLVCINQRCTNRPDPCNPSPCGPGTTCKENGNGNPVCQCQSGLVPKPDTITGCGP-ECIIDPDCRNGQVCINQRCTKKPDPCDPSPCGPGTTCRENQNGNPVCQCNKGLV---------PKPDTITGCGPECFVDAECHGGFVCLNQKCSQKQDPCEPSPCGPGTICKKSNNGNPVCHCRAGLIPKPDTITGC--GPECVTDRDCHSGLICKSSKCVEKPDPCVPSPCGPNTSCKANINGNPVCHCLSDFIPKPDTITGCGYECERDSDCQSSYICNDFKCIVKPDPCDPSPCGPGTSCYPNFNGNPICKCLLGLVPKPDTITGCGPECKRDPDCNRGYICQTGKCIEKPDPCNPSPCGPGAECMVNTSGNPICRCQKGLVPKPDTITGCGP---------ECVIDSDCDSGYICKTQTCIVRPDPC-DPSPCGDGAICEENAY---GNPTCHCKLGL--------IPKPDPFIRCGPECVIDRDCNQGYICNNTKCVIEPDPCQ-PSPCGIGALCTKTGRSLGFYCDCPEKYFGDPNVECKKIVV 646          

HSP 8 Score: 97.0561 bits (240), Expect = 7.870e-20
Identity = 181/639 (28.33%), Postives = 237/639 (37.09%), Query Frame = 0
Query: 2738 NPCNGFECEPNSFCQVNGR-NPLCLCDRGY--QRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNS--CGKNAECRMN-NHRAQCVCPSGFYG--NALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECS-----LNQECIRGACVDPCATHKCEDNERCIAQRH-KPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGAC---QNPCQGTSCPDGKSCQV-LNHQALCICTKD----PCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELY-GQPVCECIPGFVPKYPVSLGC---------------------VEPADDPCTPSPCGAFANCLV-VLNQLKCVCPPGLFGDP--FIQCQP---VEE--------------TPKDACQPSPCGSKANCNINDENQAICSCWEGYFG--NPLTGCLPECQTDQDCPSDQSCNNLKC---QDPC-PGFCGIGASCEVEQHKP--TCRCREGYKGDPYRQC---VVDRVPKPPIRPLPQ 3301
            +PC+   C P + C+ N   NP+C C+ G   +     GC   ECT + +C     C   RC N     N   CG    C+ N N    C C SG     + +  C     +C++   C     C+NQ           CT  P                    +PC+    CG    C+           E   GNP  +C+   G   +P+      G EC   AEC      LNQ+C +    DPC    C     C    +  P C C+  L+        C     +C+ +  C S L C    C    +PC  + C    SC+  +N   +C C  D    P +I+ CG E      E ++ C+       +     VK + C  + CGP  +C   + G P+C+C+ G VPK     GC                     +E   DPC PSPCG  A C+V       C C  GL   P     C P   ++                  D C PSPCG  A C  N      C C  G     +P   C PEC  D+DC     CNN KC    DPC P  CGIGA C          C C E Y GDP  +C   VV     PP  P PQ
Sbjct:   83 DPCSPSPCGPGTNCKTNADGNPVCHCNPGLIPKPDTINGCGP-ECTIDPECRNGLVCINQRCTNRPDPCNPSPCGPGTTCKENGNGNPVCQCQSGLVPKPDTITGC---GPECIIDPDCRNGQVCINQR----------CTKKP--------------------DPCD-PSPCGPGTTCR-----------ENQNGNP--VCQCNKGLVPKPDT-ITGCGPECFVDAECHGGFVCLNQKCSQKQ--DPCEPSPCGPGTICKKSNNGNPVCHCRAGLIPKPDTITGC---GPECVTDRDCHSGLICKSSKCVEKPDPCVPSPCGPNTSCKANINGNPVCHCLSDFIPKPDTITGCGYEC-----ERDSDCQ--SSYICNDFKCIVKPDPCDPSPCGPGTSCYPNFNGNPICKCLLGLVPKPDTITGCGPECKRDPDCNRGYICQTGKCIE-KPDPCNPSPCGPGAECMVNTSGNPICRCQKGLVPKPDTITGCGPECVIDSDCDSGYICKTQTCIVRPDPCDPSPCGDGAICEENAYGNPTCHCKLGLIPKPDPFIRCGPECVIDRDCNQGYICNNTKCVIEPDPCQPSPCGIGALCTKTGRSLGFYCDCPEKYFGDPNVECKKIVVIGSVNPPRSPEPQ 659          

HSP 9 Score: 87.8113 bits (216), Expect = 6.460e-17
Identity = 171/623 (27.45%), Postives = 237/623 (38.04%), Query Frame = 0
Query: 1166 SECGTNSHCIY---GNPNSCACNIGYFGNPYT----GCEVTTSVEDCDSLKCGDNA------VCSFASGKPECTCKRGYDGIPYERCQD-VDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQ-----CLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFC-ITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVS-DGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGH-RGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGK-CICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCM---DPCQNEICGENALCTVAGHQH-KCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKC---QDPCTET-CGPNALCSPEFENL---CQCPEGFAGVPTA 1754
            S CG  ++C     GNP  C CN G    P T    G E T   E  + L C +         C+ +   P  TCK   +G P  +CQ  +     ++ G   +CI  P   DCR          + C++ +  T+  D C    CGP   C   Q     C C  G       D + GC     C  + +C    +C     S  +   DPC+ + CGP + C  ++N    C C+ G      D   GC  E  C T+ DC +G  C  +   E+   DPC    C  N  C  + +G P+C C S F     T +   Y+ C  DSDC   + CN+    +K     CD   C  G  C    +    C+CL G    PD  +GC      +C  + +C    +C+         P C+   CG GA C+V       C C +GL      I GC    CV + DC     C   + TC+   DPC    CG+ A+C    + +  C C    IP P P +                                    C   C  +  C +G +C   KC    DPC  + CG  ALC+    +L   C CPE + G P  
Sbjct:   88 SPCGPGTNCKTNADGNP-VCHCNPGLIPKPDTINGCGPECTIDPECRNGLVCINQRCTNRPDPCNPSPCGPGTTCKENGNGNPVCQCQSGLVPKPDTITGCGPECIIDP---DCRNG--------QVCIN-QRCTKKPDPCDPSPCGPGTTCRENQNGNPVCQCNKGLVPKP--DTITGC--GPECFVDAECHGGFVCLNQKCSQKQ---DPCEPSPCGPGTICKKSNNGNPVCHCRAGLIPKP-DTITGCGPE--CVTDRDCHSGLICKSSKCVEKP--DPCVPSPCGPNTSCKANINGNPVCHCLSDFIPKPDTITGCGYE-CERDSDCQSSYICNDFKCIVK--PDPCDPSPCGPGTSCYPNFNGNPICKCLLGLVPKPDTITGC----GPECKRDPDCNRGYICQTGKCIEKPDP-CNPSPCGPGAECMVNTSGNPICRCQKGLVPKPDTITGCGP-ECVIDSDCDSGYICK--TQTCIVRPDPCDPSPCGDGAICEENAYGNPTCHCKLGLIPKPDPFIR-----------------------------------CGPECVIDRDCNQGYICNNTKCVIEPDPCQPSPCGIGALCTKTGRSLGFYCDCPEKYFGDPNV 639          

HSP 10 Score: 80.8777 bits (198), Expect = 7.360e-15
Identity = 172/684 (25.15%), Postives = 218/684 (31.87%), Query Frame = 0
Query: 2067 QNGRCVDPCD-GFCGIGAKCVVK-NHSPKCSCLPRWRGNP-KIKCELLECVENADCDASKSCLNNKCV---DACQLSGICGLNSRCRMSNHG-PVCSCNSGHTGDPRECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSRSECK---DPCQQPNACGVNALC-ASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIER-QAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFC--KPVCFADSDCEANELCHGKI---------------------CKEVCRSDSQCQSKEICQGIS--------------------------------------------CSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVP-----------CSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEG-LCVQICNSNTQCQAGLVCIDR-----QCVGGCSSNTQCPSESVCVEGKC---QDPCQNEASVCGECATCTTQNHQL--QCQCPRGTSGDPYQSCR 2649
            Q    +DPC    CG G  C    + +P C C P     P  I     EC  + +C     C+N +C    D C  S  CG  + C+ + +G PVC C SG    P               D      P    C++D +C + QVC    C    DPC  P+ CG    C  ++N   VC C  G         V  P T                                      C   C VD +C  G VCL++ C                   Q QDPC+ + CGP  +C+        C C+ G IP P  +  C  E   C  ++ C    +C +S C  KP     S C  N  C   I                     C   C  DS CQS  IC                                                C   C+ DPDC     C   +CI +                  DPC+ S CG  AEC                GNPI  CQ  LVP           C   SDC     C   TC+    ++ D      C +G +C +    N  C   L  I +     +C   C  +  C    +C   KC    DPCQ   S CG  A CT     L   C CP    GDP   C+
Sbjct:   77 QTRTIIDPCSPSPCGPGTNCKTNADGNPVCHCNPGLIPKPDTINGCGPECTIDPECRNGLVCINQRCTNRPDPCNPS-PCGPGTTCKENGNGNPVCQCQSGLVPKP---------------DTITGCGPE---CIIDPDCRNGQVCINQRCTKKPDPCD-PSPCGPGTTCRENQNGNPVCQCNKGL--------VPKPDTIT-----------------------------------GCGPECFVDAECHGGFVCLNQKCS------------------QKQDPCEPSPCGPGTICKKSNNGNPVCHCRAGLIPKPDTITGCGPE---CVTDRDCHSGLICKSSKCVEKPDPCVPSPCGPNTSCKANINGNPVCHCLSDFIPKPDTITGCGYECERDSDCQSSYICNDFKCIVKPDPCDPSPCGPGTSCYPNFNGNPICKCLLGLVPKPDTITGCGPECKRDPDCNRGYICQTGKCIEK-----------------PDPCNPSPCGPGAECMVN-----------TSGNPICRCQKGLVPKPDTITGCGPECVIDSDCDSGYICKTQTCI----VRPDPCDPSPCGDGAICEENAYGNPTCHCKLGLIPKPDPFIRCGPECVIDRDCNQGYICNNTKCVIEPDPCQ--PSPCGIGALCTKTGRSLGFYCDCPEKYFGDPNVECK 642          

HSP 11 Score: 78.9518 bits (193), Expect = 3.100e-14
Identity = 171/612 (27.94%), Postives = 227/612 (37.09%), Query Frame = 0
Query: 4454 RKCQDPCPFEECGRNADCSTNRHV-PMCSCLTGYEGNP--YEECRQYECLVDSDCPYTLACPNRECI---DPCQ---CAANAECSVQ-NHKASCTCLPGFQGNAYT-GGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCK---NPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACI---NPCTTQNPCSSLAKCYVQDHMGK-CACPAGMTGDPYVSCLEIVTGCK----SDDECQDHEACYNGNC-QNPCSYPFDPCGQQAECDAS-NHRAVCTCPIEWVGNP--MRECHQYECIQHNDCPNDKACIDNKCV---DPCLETTCGQRALCKSEFHISH-CFCPPGLQGNP-IVRCFQVECQQDGDCADNEKCDLRAQTCQLI-----CNAQSCVSGAICEAKNH-RKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVR------NPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCV------SPCNCGTGALCDVINHTP--ICYCPPKYSGNPQIACEKL 5014
            R   DPC    CG   +C TN    P+C C  G    P     C   EC +D +C   L C N+ C    DPC    C     C    N    C C  G      T  GC P         +C  D DC + Q C +  C    +PC    PCG  + C+ +         C C  G       + I    P    C    +C    VC N  C    +PC   +PC     C   ++    C C AG+   P     + +TGC     +D +C     C +  C + P      PCG    C A+ N   VC C  +++  P  +  C  YEC + +DC +   C D KC+   DPC  + CG    C   F+ +  C C  GL   P  +     EC++D DC     C    QT + I     CN   C  GA C         C CQ  LV   +      P      C ID DC S + C ++      C+VR      +PC     C+    +      C C +G+           P    C     C     C N KCV       P  CG GALC     +    C CP KY G+P + C+K+
Sbjct:   79 RTIIDPCSPSPCGPGTNCKTNADGNPVCHCNPGLIPKPDTINGCGP-ECTIDPECRNGLVCINQRCTNRPDPCNPSPCGPGTTCKENGNGNPVCQCQSGLVPKPDTITGCGP---------ECIIDPDCRNGQVCINQRCTKKPDPC-DPSPCGPGTTCRENQ---NGNPVCQCNKGLVPK--PDTITGCGP---ECFVDAECHGGFVCLNQKCSQKQDPCE-PSPCGPGTICKKSNNGNPVCHCRAGLIPKP-----DTITGCGPECVTDRDCHSGLICKSSKCVEKPDPCVPSPCGPNTSCKANINGNPVCHCLSDFIPKPDTITGCG-YECERDSDCQSSYICNDFKCIVKPDPCDPSPCGPGTSCYPNFNGNPICKCLLGLVPKPDTITGCGPECKRDPDCNRGYIC----QTGKCIEKPDPCNPSPCGPGAECMVNTSGNPICRCQKGLVPKPDTITGCGPE-----CVIDSDCDSGYICKTQT-----CIVRPDPCDPSPCGDGAICE---ENAYGNPTCHCKLGLIPKPDPFIRCGPE---CVIDRDCNQGYICNNTKCVIEPDPCQPSPCGIGALCTKTGRSLGFYCDCPEKYFGDPNVECKKI 644          

HSP 12 Score: 78.9518 bits (193), Expect = 3.346e-14
Identity = 181/637 (28.41%), Postives = 240/637 (37.68%), Query Frame = 0
Query: 4838 QTCQLI--CNAQSCVSGAICEAK-NHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQN---PCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGM------FVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVS------PCNCGTGALC-DVINHTPICYCPPKYSGNPQ-IACEKLECRNDDDCGDHQRCYDNLCV---DPCLIDNECGINAECIPRSH-QSTCECPPGY--QGDPFVKCSTFECLTNDECPPTKFCMVNQCL---DPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCS----PQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRT--MICKCRVGWVPDSSRSCVFLPTDTILGC----VKDDECPKDSACINRMC---KDPCD---CGRGAECFL-TGHRPVCRCPEGTKGNP--LIECTPIGCQSDNECQDPDVCAPNGNCV-PACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVV---GCTSDDECGDARACINAIC---KDPC---ACGPNAVCTIENHRP--VCTCKDGFYGDPEIVCKEV 5414
            QT  +I  C+   C  G  C+   +    C C P L+   +      P      C ID +C +   CI++ RC N   PC   +PC    TC+    +     VCQC  G+        G G  CI  P          C+  Q C+N +C        P  CG G  C +  N  P+C C       P  I     EC  D +C     C +  C    DPC   + CG    C   ++    C C  G   + D    C   EC+T+ +C     C  ++C+   DPCV + PCG N  C+ + +           G+P   C     P+P        EC  DSDC SS  C D  C       DPCD S         P      ICKC +G VP           DTI GC     +D +C +   C    C    DPC+   CG GAEC + T   P+CRC +G    P  +  C P  C  D++C    +C      V P     SPCG  A C      A    TCH             C  G     +       P +     C  D +C     C N  C    DPC    CG  A+CT         C C + ++GDP + CK++
Sbjct:   77 QTRTIIDPCSPSPCGPGTNCKTNADGNPVCHCNPGLIPKPDTINGCGPE-----CTIDPECRNGLVCINQ-RCTNRPDPC-NPSPCGPGTTCK---ENGNGNPVCQCQSGLVPKPDTITGCGPECIIDPD---------CRNGQVCINQRCTKKPDPCDPSPCGPGTTCRENQNGNPVCQCNKGLVPKPDTITGCGPECFVDAECHGGFVCLNQKCSQKQDPCE-PSPCGPGTICKKSNNGNPVCHCRAGLIPKPDTITGCGP-ECVTDRDCHSGLICKSSKCVEKPDPCVPS-PCGPNTSCKANIN-----------GNPVCHCLSDFIPKPDTITGCGYECERDSDCQSSYICNDFKC---IVKPDPCDPSPCGPGTSCYPNFNGNPICKCLLGLVPKP---------DTITGCGPECKRDPDCNRGYICQTGKCIEKPDPCNPSPCGPGAECMVNTSGNPICRCQKGLVPKPDTITGCGP-ECVIDSDCDSGYICKTQTCIVRPDPCDPSPCGDGAICE---ENAYGNPTCH-------------CKLGLIPKPD-------PFIRCGPECVIDRDCNQGYICNNTKCVIEPDPCQPSPCGIGALCTKTGRSLGFYCDCPEKYFGDPNVECKKI 644          

HSP 13 Score: 76.2554 bits (186), Expect = 2.047e-13
Identity = 151/515 (29.32%), Postives = 204/515 (39.61%), Query Frame = 0
Query: 5095 LDPCVVNEPCGRNAQCRV-SQHMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQN---PCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILG----CVKDDECPKDSACINRMCK---DPCD---CGRGAECFLTGH-RPVCRCPEGTKGNP--LIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAIC---KDPCA---CGPNAVCTIE-NHRPVCTCKDGFYGDPEIVCK-EVGCQSNSECETTHECINGDCTPVCGP-DHVPCGGDAICQ-GVNHQYVCTCPPGLEGNP-YVSCSTVECRDNSECTPDRACINKQC---QDPCAISDQCVDVAQCVVENH-QVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTC---QNPCLLAEPCGVNAKC 5574
            +DPC  + PCG    C+  +     C C PG          P+P        EC ID +C + L CI+Q C N   PC    PC     C           +C+C+ G VP           DTI G    C+ D +C     CIN+ C    DPCD   CG G  C    +  PVC+C +G    P  +  C P  C  D EC    VC  N  C      Q PC    E    G   +C+ + +          VC C  G     +    T+T     C +D +C     C ++ C    DPC    CGPN  C    N  PVC C   F   P+ +      C+ +S+C++++ C +  C     P D  PCG    C    N   +C C  GL   P  ++    EC+ + +C     C   +C    DPC  S  C   A+C+V       C C  G    + ++       CV DSDC S   C ++TC    +PC    PCG  A C
Sbjct:   82 IDPCSPS-PCGPGTNCKTNADGNPVCHCNPGLI--------PKPDTINGCGPECTIDPECRNGLVCINQRCTNRPDPCNP-SPCGPGTTCKENGN---GNPVCQCQSGLVPKP---------DTITGCGPECIIDPDCRNGQVCINQRCTKKPDPCDPSPCGPGTTCRENQNGNPVCQCNKGLVPKPDTITGCGP-ECFVDAECHGGFVCL-NQKCS---QKQDPC----EPSPCGPGTICKKSNN-------GNPVCHCRAGLIPKPD----TITGCGPECVTDRDCHSGLICKSSKCVEKPDPCVPSPCGPNTSCKANINGNPVCHCLSDFIPKPDTITGCGYECERDSDCQSSYICNDFKCIVKPDPCDPSPCGPGTSCYPNFNGNPICKCLLGLVPKPDTITGCGPECKRDPDCNRGYICQTGKCIEKPDPCNPS-PCGPGAECMVNTSGNPICRCQKGLV-PKPDTITGCGPECVIDSDCDSGYICKTQTCIVRPDPC-DPSPCGDGAIC 551          

HSP 14 Score: 71.633 bits (174), Expect = 5.486e-12
Identity = 182/731 (24.90%), Postives = 249/731 (34.06%), Query Frame = 0
Query: 2483 LADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQAGLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQ-NHQLQCQCPRGTSGDPYQSCRTNYLRCGS---TKNQCGSGLNCHRGLCAKSCEA--SAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCISGCGS----NRDCPYGEMCEGGQC---RNPCNGFECEPNSFCQ-VNGRNPLCLCDRGY--QRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSE--SNSCGKNAECRMN-NHRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACV---DPCATHKCEDNERCIAQRH-KPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICTKDPCSISPCGDEAICRA-VEGNAICECPEGT--RGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQL--KCVCPPGLFGDPFIQCQPV 3185
            + DPCS S CG    C+T             +GNP+ HC P L+P          K  +   C  +C +                     + +C+ GLVCI+++C                      DPC    S CG   TC    N    CQC  G    P          CG        C +G  C    C K  +    + C  G +C E    Q       C  G        I+GCG     + +C  G +C   +C   ++PC    C P + C+  N  NP+C C  G   +     GC   EC T+  C     C+  +C+        + CG N  C+ N N    C C S F         + + D +    CG   +        D  C+S    + F+    P P D         +PC    SC                    + GNP  +CK   G   +P+      G EC R  +C+    C  G C+   DPC    C     C+      P C C++ L+        C     +C+ +  C S   C                            CI   DPC  SPCGD AIC     GN  C C  G   + DP   C  E       C  +  C + Y     +C+             +EP  DPC PSPCG  A C      L   C CP   FGDP ++C+ +
Sbjct:   81 IIDPCSPSPCGPGTNCKTN-----------ADGNPVCHCNPGLIP----------KPDTINGCGPECTI---------------------DPECRNGLVCINQRCTNR------------------PDPCN--PSPCGPGTTCKENGNGNPVCQCQSGLVPKP-----DTITGCGPECIIDPDCRNGQVCINQRCTKKPDPCDPSPCGPGTTCREN---QNGNPVCQCNKGLVPKPDT-ITGCGPECFVDAECHGGFVCLNQKCSQKQDPCEPSPCGPGTICKKSNNGNPVCHCRAGLIPKPDTITGCGP-ECVTDRDCHSGLICKSSKCVEKPDPCVPSPCGPNTSCKANINGNPVCHCLSDF---------IPKPDTI--TGCGYECE-------RDSDCQSSYICNDFKCIVKPDPCDP--------SPCGPGTSCYPN-----------------FNGNP--ICKCLLGLVPKPDT-ITGCGPECKRDPDCNRGYICQTGKCIEKPDPCNPSPCGPGAECMVNTSGNPICRCQKGLVPKPDTITGC---GPECVIDSDCDSGYIC------------------------KTQTCIVRPDPCDPSPCGDGAICEENAYGNPTCHCKLGLIPKPDPFIRCGPE-------CVIDRDCNQGYICNNTKCV-------------IEP--DPCQPSPCGIGALCTKTGRSLGFYCDCPEKYFGDPNVECKKI 644          

HSP 15 Score: 70.4774 bits (171), Expect = 1.316e-11
Identity = 170/665 (25.56%), Postives = 230/665 (34.59%), Query Frame = 0
Query: 1411 GRTCHINFNGEQTCLDPCQIMSCPTNEKCMV-SDGMPICLCNSGFEKNKLTGSCDVYQGC----LADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGH-RGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVV-RNHVGKCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTC---MDPCQNEICGENALCTVAGHQHK-CQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTET-CGPNALCSPEFEN--LCQCPEGFAGVPTAAQGCVRIPPTCT--TDCPASSLCFNGYCM--PECTSHGQCARGEQCS---NG----MCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKNNICGAGKTC-ANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPT-NPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCTNEQGS--YQCTCHDGMVGDPYTQ 2046
            G  C +     +T +DPC    C     C   +DG P+C CN G     L    D   GC      D +C  G  C  ++    N    C+   C  G  C   G+    C+C  G    PD  +GC      +C  + +C   +VC      +   P C    CG G  C   +N    C C +GL      I GC    C  + +C     C  L+  C    DPC+   CG   +C  + + +  C C    IP P                   C   C +   C  G ICKS  C                      DPC  + CGPN  C        +C C   F   P    GC      C   +DC +S +C +  C+  P+      C  G  C    NG     CL       + + G       C P C+ D DC  G +C  G +C  +P            + C  + CG G  C  NT G+ IC C    VP          +C  D DC+    C   +        DPCD S C   A C   +  A+        G+PT + K+G   +  P     CG       D      C  GY    + C    +    +PC   A CT    S  + C C +   GDP  +
Sbjct:   68 GNHCLLTLPQTRTIIDPCSPSPCGPGTNCKTNADGNPVCHCNPG-----LIPKPDTINGCGPECTIDPECRNGLVC--INQRCTNRPDPCNPSPCGPGTTCKENGNGNPVCQCQSGLVPKPDTITGC----GPECIIDPDCRNGQVCINQRCTKKPDP-CDPSPCGPGTTCRENQNGNPVCQCNKGLVPKPDTITGCGP-ECFVDAECHGGFVC--LNQKCSQKQDPCEPSPCGPGTICKKSNNGNPVCHCRAGLIPKPDT--------------ITGCGPECVTDRDCHSGLICKSSKCVEK------------------PDPCVPSPCGPNTSCKANINGNPVCHCLSDFIPKPDTITGCGY---ECERDSDCQSSYICNDFKCIVKPDPCDPSPCGPGTSCYPNFNGNPICKCLLGLVPKPDTITG-------CGPECKRDPDCNRGYICQTG-KCIEKP------------DPCNPSPCGPGAECMVNTSGNPICRCQKGLVPKPDTITGCGPECVIDSDCDSGYICKTQTCIVRP---DPCDPSPCGDGAIC---EENAY--------GNPTCHCKLG--LIPKPDPFIRCGPECVIDRD------CNQGYICNNTKCVIEPDPCQPSPCGIGALCTKTGRSLGFYCDCPEKYFGDPNVE 640          

HSP 16 Score: 65.4698 bits (158), Expect = 4.379e-10
Identity = 170/633 (26.86%), Postives = 229/633 (36.18%), Query Frame = 0
Query:  834 IDECQAIGHTPCGSGADCLNNP-GSFSCSCPPGQGGDPFQ-GSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNP--PQCLCKAGFTGNP--LTGCEDLDECALNP-CKQGSICINKLATYQCE------CPPGTTGDPYTNG---CSGSKSV------------ECGADDECHGQLACIGSQCI---NPCSSVPCGSNANCVAENHA-AWCRCKSGF--AEDSQGNCVSLC-------NQVICGSNA------QCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHC---IYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSVCGKNAQC-INTPGGYDCRCHSDFVGNP--FEGCVHLEAVTEDD----------------DLCANQQCGPNAICNLG-----QCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKS--CICQDGFTGDAN 1390
            ID C     +PCG G +C  N  G+  C C PG    P     C P    C+ + +CR    C+  +C   P              PC+   CG    C  +    P C C++G    P  +TGC    EC ++P C+ G +CIN+  T + +      C PGTT     NG   C  +K +            EC  D ECHG   C+  +C    +PC   PCG    C   N+    C C++G     D+   C   C       + +IC S+        C+ SP GP   C   + GNP     C  LS     P             IT CG E C  ++ C  + +    +     DP   C P        S CG  + C     GNP  C C +G    P T   +T    +C                K +  C RGY     +  +  D C  S CG  A+C +NT G   CRC    V  P    GC   E V + D                D C    CG  AIC         C C  G     P+  +        C  + DC    IC+   ++      DPCQ + CG  + C          C C + + GD N
Sbjct:   82 IDPCSP---SPCGPGTNCKTNADGNPVCHCNPGLIPKPDTINGCGP---ECTIDPECRNGLVCINQRCTNRP-------------DPCNPSPCGPGTTCKENGNGNPVCQCQSGLVPKPDTITGCGP--ECIIDPDCRNGQVCINQRCTKKPDPCDPSPCGPGTTCRENQNGNPVCQCNKGLVPKPDTITGCGPECFVDAECHGGFVCLNQKCSQKQDPCEPSPCGPGTICKKSNNGNPVCHCRAGLIPKPDTITGCGPECVTDRDCHSGLICKSSKCVEKPDPCVPSPCGPNTSCKANINGNPV----CHCLSDFIPKP-----------DTITGCGYE-CERDSDCQSSYICNDFKCIVKPDP---CDP--------SPCGPGTSCYPNFNGNP-ICKCLLGLVPKPDT---ITGCGPEC----------------KRDPDCNRGYICQTGKCIEKPDPCNPSPCGPGAECMVNTSGNPICRCQKGLVPKPDTITGC-GPECVIDSDCDSGYICKTQTCIVRPDPCDPSPCGDGAICEENAYGNPTCHCKLGLI-PKPDPFIR---CGPECVIDRDCNQGYICN---NTKCVIEPDPCQPSPCGIGALCTKTGRSLGFYCDCPEKYFGDPN 638          

HSP 17 Score: 56.6102 bits (135), Expect = 2.284e-7
Identity = 134/476 (28.15%), Postives = 174/476 (36.55%), Query Frame = 0
Query: 5359 CTSDDECGDARACINAICK---DPC---ACGPNAVCTIE-NHRPVCTCKDGFYGDPEIVCK-EVGCQSNSECETTHECINGDCTPVCGP-DHVPCGGDAIC-QGVNHQYVCTCPPGLEGNP-YVSCSTVECRDNSECTPDRACINKQC---QDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTC---QNPCLLAEPCGVNAKCT-----------VLDTLPIRTMTCVCLPGYEGDASIQCTPVKTC---------------PAGSGLI----LNEFEECVCPPGFVLDSQGI--CAP-CRFD----VGFIIENGRCI----------CDYTKGFVLDLSGKK-CVCPENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRTC---GDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPPPVDIDRPEIVVN 5766
            CT D EC +   CIN  C    DPC    CGP   C    N  PVC C+ G    P+ +      C  + +C     CIN  CT    P D  PCG    C +  N   VC C  GL   P  ++    EC  ++EC     C+N++C   QDPC  S            N    C C  G    + ++       CV D DC S   C S  C    +PC+   PCG N  C            + D +P       C  GYE +    C     C               P G G       N    C C  G V     I  C P C+ D     G+I + G+CI          C      +++ SG   C C +      + I    PEC +D +C     C+   +TC    DPC   PCG  A            C E   G+P   C   ++PKP P     PE V++
Sbjct:  126 CTIDPECRNGLVCINQRCTNRPDPCNPSPCGPGTTCKENGNGNPVCQCQSGLVPKPDTITGCGPECIIDPDCRNGQVCINQRCTKKPDPCDPSPCGPGTTCRENQNGNPVCQCNKGLVPKPDTITGCGPECFVDAECHGGFVCLNQKCSQKQDPCEPSPCGPGTICKKSNNGNPVCHCRAGLI-PKPDTITGCGPECVTDRDCHSGLICKSSKCVEKPDPCV-PSPCGPNTSCKANINGNPVCHCLSDFIPKPDTITGC--GYECERDSDCQSSYICNDFKCIVKPDPCDPSPCGPGTSCYPNFNGNPICKCLLGLVPKPDTITGCGPECKRDPDCNRGYICQTGKCIEKPDPCNPSPCGPGAECMVNTSGNPICRCQKGLVPKPDTITGCGPECVIDSDCDSGYICK--TQTCIVRPDPCDPSPCGDGAI-----------CEENAYGNPTCHCKLGLIPKPDPFIRCGPECVID 584          
BLAST of GH13743 vs. L. salmonis genes
Match: EMLSAG00000002446 (supercontig:LSalAtl2s:LSalAtl2s146:201796:210139:1 gene:EMLSAG00000002446 transcript:EMLSAT00000002446 description:"augustus_masked-LSalAtl2s146-processed-gene-2.2")

HSP 1 Score: 128.642 bits (322), Expect = 1.718e-29
Identity = 160/551 (29.04%), Postives = 235/551 (42.65%), Query Frame = 0
Query:  394 CRKGFQPN-GV-LCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVN--------CGQRASCQIVKSEAFC----------ICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCV----CAKGFNGDPYIG-CFDIDECAENRFIC---GREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVC--KCPKGTNGDPLSGCRGESTFECTQDSQCDQG--------ESCL----SSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQ-CRENEECLQGKCIC 901
            C +G+  N G+ LC DIDEC+     C  +  C+N  GDY CQ +      P  +     CL+++        C +R +C  ++    C           C+ G+ YN   +S+ C DI+EC    +    C  +  C N+ GSF C+    C  G+  + + G C D DECA     C   GR  LC N  GS+ C                EKRR                  C+     +G    D   + TC P             QC  GF    +G SC+D+DEC  + C +   CEN +GSF C  +C  G   +PL+        +C    +C  G        +SCL    S +C C  G+  +  G+C D++EC+   +CG++S C+N PGS+ C C +GF+           G  C      ++I G CQ            C  I G    C C  GY+++  +++C DIDEC+   +   G   +C N PGS+ CSCP G                 SSNS+ C++ +ECL+   +C
Sbjct:  169 CPRGYNFNQGLNLCDDIDECEEESGXCDXSQTCINTIGDYMCQSMEEQNCPPGFKFFLLSCLDIDECMENKHSCSKRETCVNLEGSYKCEKEVTLPNKNKCKVGYKYNF--MSNQCEDINECQ---TGHHSCLESQRCDNTMGSFTCIRYTTCGTGYTLNLHTGRCDDNDECAMGMDNCASLGRGYLCRNIQGSFRC----------------EKRR------------------CD-----IGEILND---EGTCAP------------IQCQIGFVPGSSG-SCVDVDECEMDLCFRGQSCENTMGSFRCTNQCSMGLRLNPLNS-------QCEDIDECLIGMAACVGIYKSCLNTIGSYKCQCTDGFAID-QGECKDIDECIKPGICGMDSDCQNSPGSFRCVCKAGFKS---------VGGECIDTNECKEIPGICQQG----------CTNIWGSYR-CHCQAGYKLSSDSRSCIDIDECRDFDNLCLG---NCENIPGSYRCSCPDGY--------------LLSSNSRSCQDIDECLERNNVC 614          

HSP 2 Score: 92.0485 bits (227), Expect = 3.313e-18
Identity = 121/454 (26.65%), Postives = 168/454 (37.00%), Query Frame = 0
Query:  100 NDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNE------GYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVC----------KCKPGFEGDGKV-ECRDIDEC-------LTNQVC--------------------------------------------GINTLCINTHGNFSCE--------------------CLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQC--QCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEP---VKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQ--PNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCR--DPCLEVN 456
            N   G   CD  D  E +   CD    C NT+G + C   E      G++     C DIDEC   E  ++C +   C NL   Y C          KCK G++ +    +C DI+EC       L +Q C                                            G   LC N  G+F CE                    C  GF       CVD+DEC  + C  G  C N +G+++C  QC  GL  +P    C+      +    C     G    C  +     C C +GF  D    C DI+EC    +  CG+ + C N    +RC C AG+   G    +     ++   C     CTN      +  C C+ G++   +   C DIDEC+  +N C  N  C N+PG Y C C    + +   + C+  D CLE N
Sbjct:  174 NFNQGLNLCDDIDECEEESGXCDXSQTCINTIGDYMCQSMEEQNCPPGFKFFLLSCLDIDECM--ENKHSCSKRETCVNLEGSYKCEKEVTLPNKNKCKVGYKYNFMSNQCEDINECQTGHHSCLESQRCDNTMGSFTCIRYTTCGTGYTLNLHTGRCDDNDECAMGMDNCASLGRGYLCRNIQGSFRCEKRRCDIGEILNDEGTCAPIQCQIGFVPGSSGSCVDVDECEMDLCFRGQSCENTMGSFRCTNQCSMGLRLNPLNSQCEDIDECLIGMAAC----VGIYKSCLNTIGSYKCQCTDGFAIDQG-ECKDIDECIKPGI--CGMDSDCQNSPGSFRCVCKAGFKSVGGECIDTNECKEIPGICQQ--GCTN---IWGSYRCHCQAGYKLSSDSRSCIDIDECRDFDNLCLGN--CENIPGSYRCSCPDGYLLSSNSRSCQDIDECLERN 611          

HSP 3 Score: 74.3294 bits (181), Expect = 8.769e-13
Identity = 114/405 (28.15%), Postives = 160/405 (39.51%), Query Frame = 0
Query:  718 CRRGYERNPAGD-CVDLNECLL-GNVCGVNSVCKNLPGSYDCE------CPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGR---CQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPP---FFVDTLDGNHCKSPCHRFSCG----FNAECTPSNPPQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQC--ECPPGTTGDPYTNGCSGSKSVECGADDECH-GQLACIG--SQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQV---ICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHC 1096
            C RGY  N   + C D++EC      C  +  C N  G Y C+      CP GF+               SCL   + +E +    +   C N E   KC +     +   C  GY+ N  +  CEDI+ECQ  GH  C     C N  GSF+C      G     G  L L +      +C +N+EC  G   C+     +    + G+     C +  C      N E T + P QC  + GF       C D+DEC ++ C +G  C N + +++C  +C  G   +P  +        +C   DEC  G  AC+G    C+N   S                 C+C  GFA D QG C  +   +   ICG ++ C  SP    C C  G       GG C
Sbjct:  169 CPRGYNFNQGLNLCDDIDECEEESGXCDXSQTCINTIGDYMCQSMEEQNCPPGFKFFLL-----------SCLDIDECMENKHSCSKRETCVNLEGSYKCEKEVTLPNKNKCKVGYKYNFMSNQCEDINECQT-GHHSCLESQRCDNTMGSFTCIRYTTCG----TGYTLNLHTG-----RCDDNDECAMGMDNCASLGRGYLCRNIQGSF---RCEKRRCDIGEILNDEGTCA-PIQC--QIGFVPGSSGSCVDVDECEMDLCFRGQSCENTMGSFRCTNQCSMGLRLNPLNS--------QCEDIDECLIGMAACVGIYKSCLNTIGSYK---------------CQCTDGFAID-QGECKDIDECIKPGICGMDSDCQNSPGSFRCVCKAGF---KSVGGEC 519          

HSP 4 Score: 67.781 bits (164), Expect = 9.766e-11
Identity = 53/130 (40.77%), Postives = 65/130 (50.00%), Query Frame = 0
Query:   96 QCYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYE--GDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGF-EGDGKVECRDIDECL-TNQVC-GINTLCINTHGNFSC 220
            +C C  G+   G +  DTNECK  P      CTN  GS+ C C  GY+   D   C DIDEC+  +  N C+ N E  N+P  Y C C  G+        C+DIDECL  N VC   +  C NT G F C
Sbjct:  505 RCVCKAGFKSVGGECIDTNECKEIPGICQQGCTNIWGSYRCHCQAGYKLSSDSRSCIDIDECR--DFDNLCLGNCE--NIPGSYRCSCPDGYLLSSNSRSCQDIDECLERNNVCEKKHQHCSNTRGGFKC 630          
BLAST of GH13743 vs. L. salmonis genes
Match: EMLSAG00000011977 (supercontig:LSalAtl2s:LSalAtl2s852:331080:333437:1 gene:EMLSAG00000011977 transcript:EMLSAT00000011977 description:"maker-LSalAtl2s852-snap-gene-3.15")

HSP 1 Score: 111.694 bits (278), Expect = 1.693e-24
Identity = 124/390 (31.79%), Postives = 176/390 (45.13%), Query Frame = 0
Query: 1276 FEGCVH--LEAVTEDDDLCANQQCGPNAICNLGQ-----CLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNH-QKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSD-GMPICLCNSGFEKNKLTGSCDVYQGC----LADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGY--CRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVG-KCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPC-QNEICGENALCTVAGHQHKC 1648
            F+GC +  L+     +D C    CGP   C   +     C C SG       D ++GC     C T+ DC YN  C        +   DPC  + CGP + C  ++     C C+DG      D   GC  E  C+ + DC +G  C  +F+  +  +DPC+   C     C V++ G P+C C  G     L    D   GC      D +C  G+ C+E     K+    CD   C  G EC+ E  RGY  CRCL G    PD  +GC      +C+ + +C  S +CK S   +   P C    CG G +C    H G +C CP G F G+  I+ C K  C  +E+C  ++FC+  ++TC +PC   + CG++  C V  HQ  C
Sbjct:  147 FDGCANTCLDKQELRNDPCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKP--DTIKGC--GPECITDADCKYNYNCENQRCKEKK---DPCNPSPCGPGTTCKPNSLGNPVCECKDGLIPKP-DAITGCGPE--CTIDSDCKSGYEC--SFSKCRKIVDPCKPSPCGPGTACTVNNKGNPVCQCLPG-----LIPKPDTIIGCGFECERDLECENGYVCSEHRCIEKS--DPCDPSPCGPGTECM-ENDRGYPVCRCLLGLIPKPDTITGC----GPECTVDTDCEASHICKESRCMKRPNP-CDPNPCGAGGLCDPVGHTGFRCSCPPGYF-GDADIQ-CIKKDCDIDEECSLDQFCNVGNFTCTNPCTMMQSCGDSQFCRVVNHQPIC 509          

HSP 2 Score: 107.457 bits (267), Expect = 2.934e-23
Identity = 106/342 (30.99%), Postives = 143/342 (41.81%), Query Frame = 0
Query: 3547 LETDPC--SACGINADCDVRPNDQVICSCPKDYLGDP--YIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECSEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSP---PNCRPECTEDSACPNHLKCVREKC---VDPC-PGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGS-CRCIEDYVGDP--FVSCRPECVVNSDCPYGLACLSHKCK---DPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHK 3871
            L  DPC  S CG    C    ++  IC C    +  P     C PEC+T+ADC  +  C               N  C E  DPC P+PCG  + C+ N  G  +C C++  I  P     C PECT DS C +  +C   KC   VDPC P  CG    C   N  +  C    G               LI     I+G          C  G++   +   CI K +       PC+P+PCG   EC+E ++    CRC+   +  P     C PEC V++DC     C   +C    +PC+ N  CG   +C+   +   RCSC   Y GD  ++C K
Sbjct:  160 LRNDPCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKPDTIKGCGPECITDADCKYNYNC--------------ENQRCKEKKDPCNPSPCGPGTTCKPNSLGNPVCECKDGLIPKPDAITGCGPECTIDSDCKSGYECSFSKCRKIVDPCKPSPCGPGTACTVNNKGNPVCQCLPG---------------LIPKPDTIIGCGFECERDLECENGYVCSEHR--CIEKSD-------PCDPSPCGPGTECMENDRGYPVCRCLLGLIPKPDTITGCGPECTVDTDCEASHICKESRCMKRPNPCDPN-PCGAGGLCDPVGHTGFRCSCPPGYFGDADIQCIK 462          

HSP 3 Score: 100.908 bits (250), Expect = 3.354e-21
Identity = 127/409 (31.05%), Postives = 166/409 (40.59%), Query Frame = 0
Query: 3182 CQPVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNP--LTGCLPECQTDQDCPSDQSCNNLKC---QDPC-PGFCGIGASCEVEQH-KPTCRCREGYKGDPYRQCVVDRVPKPPIRP--LPQCQRNQDCPSFKVCDDGNC---VDPC-PERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCIVRGNREVCSCQPGYFGGPPN---CRPECVIQEDCPYDHHCLRGQCV---DPC-VNNCGEGAQC-QVVKHKPMCSC-------PDGSTG--------------NPYKRCQIIVRPPPKQPCFPSPCGANAVCKIV-RAQEKCHCLPGFLGDPPY--CRPECLADHECPSHKICH--QEKCIDPCENV--CGINALCHTKNHKVICVCPSNMQGDPFDRCSP 3541
            C   +E   D C PSPCG    C  N  N  IC C  G    P  + GC PEC TD DC  + +C N +C   +DPC P  CG G +C+      P C C++G             +PKP       P+C  + DC S   C    C   VDPC P  CG    C V N           KG+P           VC C PG    P     C  EC    +C   + C   +C+   DPC  + CG G +C +  +  P+C C       PD  TG              +  K  + + RP    PC P+PCGA  +C  V     +C C PG+ GD      + +C  D EC   + C+     C +PC  +  CG +  C   NH+ IC     +Q  P  R  P
Sbjct:  154 CLDKQELRNDPCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKPDTIKGCGPECITDADCKYNYNCENQRCKEKKDPCNPSPCGPGTTCKPNSLGNPVCECKDGL------------IPKPDAITGCGPECTIDSDCKSGYECSFSKCRKIVDPCKPSPCGPGTACTVNN-----------KGNP-----------VCQCLPGLIPKPDTIIGCGFECERDLECENGYVCSEHRCIEKSDPCDPSPCGPGTECMENDRGYPVCRCLLGLIPKPDTITGCGPECTVDTDCEASHICKESRCMKRP---NPCDPNPCGAGGLCDPVGHTGFRCSCPPGYFGDADIQCIKKDCDIDEECSLDQFCNVGNFTCTNPCTMMQSCGDSQFCRVVNHQPICGFNEVIQ-KPVQRSKP 524          

HSP 4 Score: 100.138 bits (248), Expect = 6.215e-21
Identity = 122/363 (33.61%), Postives = 158/363 (43.53%), Query Frame = 0
Query: 4092 DPCLPNPCGENTE-HRKAGSNCICTCLPGFYGDPYT--GCNYECLIHDDCPYNRACASNHRCS---NPCIGN-CGVQAICNVIEH-NAICSCPEEL--EGDPFIRCIPAGCRSDSECPSTEACIDRECR---DPCPFQTCGVNAECETRSHLS-TCICLEGFEGNP--YEGCTQYECKRHEECPSTLACRDFKCV---DPCD---CAVGANCRVSNH-KTTCTCPPGFTGDPYSRDDPPRPPILT---VGCEGNHECPDSHACINSRCV---DPCISNPCKNGATCTVNKHEIF-CACPNGFLFIGDFECKAPERPECVSDPECPLHLACI--SERCLDPCT-SQACGVNAKCTVTTHVPVCA 4421
            DPC P+PCG  T       +N IC CL G    P T  GC  EC+   DC YN  C  N RC    +PC  + CG    C      N +C C + L  + D    C P  C  DS+C S   C   +CR   DPC    CG    C   +  +  C CL G    P    GC  +EC+R  EC +   C + +C+   DPCD   C  G  C  ++     C C  G           P+P  +T     C  + +C  SH C  SRC+   +PC  NPC  G  C    H  F C+CP G+    D +C    + +C  D EC L   C   +  C +PCT  Q+CG +  C V  H P+C 
Sbjct:  163 DPCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKPDTIKGCGPECITDADCKYNYNC-ENQRCKEKKDPCNPSPCGPGTTCKPNSLGNPVCECKDGLIPKPDAITGCGPE-CTIDSDCKSGYECSFSKCRKIVDPCKPSPCGPGTACTVNNKGNPVCQCLPGLIPKPDTIIGC-GFECERDLECENGYVCSEHRCIEKSDPCDPSPCGPGTECMENDRGYPVCRCLLGLI---------PKPDTITGCGPECTVDTDCEASHICKESRCMKRPNPCDPNPCGAGGLCDPVGHTGFRCSCPPGYFGDADIQCI---KKDCDIDEECSLDQFCNVGNFTCTNPCTMMQSCGDSQFCRVVNHQPICG 510          

HSP 5 Score: 97.8265 bits (242), Expect = 3.943e-20
Identity = 114/373 (30.56%), Postives = 151/373 (40.48%), Query Frame = 0
Query: 4335 DPCISNPCKNGATCTVNKH-EIFCACPNGFLFIGDFECKAPERPECVSDPECPLHLACISERC---LDPCTSQACGVNAKCTVTTH-VPVCACELDYVGDPYTVCQ-------KAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCST-NRHVPMCSCLTGYEGNPYEECR-QYECLVDSDCPYTLACPNRECI------DPCQCAANAECSVQNHKAS--CTCLPGFQGNAYT-GGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCK---NPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCN--NAACINPCTTQNPCSSLAKCYVQDHMGKCA 4679
            DPC  +PC  G TCT NKH    C C +G +   D        PEC++D +C  +  C ++RC    DPC    CG    C   +   PVC C+   +  P  +          + C+S  EC  S+    RK  DPC    CG    C+  N+  P+C CL G    P       +EC  D +C     C    CI      DP  C    EC ++N +    C CL G      T  GC P         +C  D DC +   C +  C    NPC    PCGA  +C   D V      C+C  GY  + + +CI++       C   ++C   Q CN  N  C NPCT    C     C V +H   C 
Sbjct:  163 DPCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKPDTIKGC--GPECITDADCKYNYNCENQRCKEKKDPCNPSPCGPGTTCKPNSLGNPVCECKDGLIPKPDAITGCGPECTIDSDCKSGYECSFSKC---RKIVDPCKPSPCGPGTACTVNNKGNPVCQCLPGLIPKPDTIIGCGFECERDLECENGYVCSEHRCIEKSDPCDPSPCGPGTEC-MENDRGYPVCRCLLGLIPKPDTITGCGP---------ECTVDTDCEASHICKESRCMKRPNPC-DPNPCGAGGLC---DPVGHTGFRCSCPPGYFGDADIQCIKK------DCDIDEECSLDQFCNVGNFTCTNPCTMMQSCGDSQFCRVVNHQPICG 510          

HSP 6 Score: 87.0409 bits (214), Expect = 8.071e-17
Identity = 116/415 (27.95%), Postives = 169/415 (40.72%), Query Frame = 0
Query: 1767 TDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCL--KLCHTDKN------CLQGEIC---VDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNE-CKNNICGAGKTCA-NTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVI-QHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCT-NEQGSYQCTCHDGMVGDPYT-QGCKPKAQCYSNSECSSDTRCQNGRCV---DPCD-GFCGIGAKCVVKNHSP-KCSCLPRWRGNPKIKCELLECVENADCDASKSC--LNNKCVDACQLSGICGLNSRCRMSNHGPVCSCN 2158
            +DCP   LC    C   C    Q  R + C+   C     C T+K+      CL G +      K C P C TD+DC+                Y      C +  + C  + CG G TC  N+ G+ +C C    +P          +C+ D DC     C   S S  +K +DPC  S C P   C V  +    C C P     P +  IGC        GF C               C++GY      C +  +    +PC    +C  N++G   C C  G++  P T  GC P  +C  +++C +   C+  RC+   +PCD   CG G  C    H+  +CSC P + G+  I+C   +C  + +C   + C   N  C + C +   CG +  CR+ NH P+C  N
Sbjct:  137 SDCPGHGLCCFDGCANTCLDK-QELRNDPCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKPDTIKGCGPECITDADCKYN--------------YNCENQRCKEKKDPCNPSPCGPGTTCKPNSLGNPVCECKDGLIPKPDAITGCGPECTIDSDCKSGYEC---SFSKCRKIVDPCKPSPCGPGTACTVNNKGNPVCQCLPGLIPKP-DTIIGC--------GFECER----------DLECENGYVCSEHRCIEKSDPCDPSPCGPGTECMENDRGYPVCRCLLGLIPKPDTITGCGP--ECTVDTDCEASHICKESRCMKRPNPCDPNPCGAGGLCDPVGHTGFRCSCPPGYFGDADIQCIKKDCDIDEECSLDQFCNVGNFTCTNPCTMMQSCGDSQFCRVVNHQPICGFN 512          

HSP 7 Score: 87.0409 bits (214), Expect = 8.720e-17
Identity = 113/381 (29.66%), Postives = 149/381 (39.11%), Query Frame = 0
Query: 3918 CQPICVVNSDCPAHLACINNDCV-----------DPCFQNVCGSNTHCYVKSHQAK-CECFPGYDGNPLIGCNKGPTGTITA--------------EERDPC--ETCGQHAICHIHN-NIAACKCEDNYIDKP---PNCRRECVLHEDCPKHLACIQYKC---ASPCI-NQCGKNADCSVINH-DPICRCLPQYFGDPL------------VKCEPPKV------SQPIDPCLPNPCGENTE-HRKAGSNCICTCLPGFYGDP--YTGCNYECLIHDDCPYNRACASNH--RCSNPCIGN-CGVQAICNVIEHNAI-CSCPEELEGDPFIRCIPAGCRSDSECPSTEACI--DRECRDPCP-FQTCGVNAECETRSHLSTC 4233
            C  +   +SDCP H  C  + C            DPC  + CG  T C    H    C+C  G    P      GP     A              E++DPC    CG    C  ++     C+C+D  I KP     C  EC +  DC     C   KC     PC  + CG    C+V N  +P+C+CLP     P             ++CE   V       +  DPC P+PCG  TE         +C CL G    P   TGC  EC +  DC  +  C  +   +  NPC  N CG   +C+ + H    CSCP    GD  I+CI   C  D EC   + C   +  C +PC   Q+CG +  C   +H   C
Sbjct:  129 CWTVGTRDSDCPGHGLCCFDGCANTCLDKQELRNDPCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKPDTIKGCGPECITDADCKYNYNCENQRCKEKKDPCNPSPCGPGTTCKPNSLGNPVCECKDGLIPKPDAITGCGPECTIDSDCKSGYECSFSKCRKIVDPCKPSPCGPGTACTVNNKGNPVCQCLPGLIPKPDTIIGCGFECERDLECENGYVCSEHRCIEKSDPCDPSPCGPGTECMENDRGYPVCRCLLGLIPKPDTITGCGPECTVDTDCEASHICKESRCMKRPNPCDPNPCGAGGLCDPVGHTGFRCSCPPGYFGDADIQCIKKDCDIDEECSLDQFCNVGNFTCTNPCTMMQSCGDSQFCRVVNHQPIC 509          

HSP 8 Score: 87.0409 bits (214), Expect = 8.948e-17
Identity = 123/412 (29.85%), Postives = 157/412 (38.11%), Query Frame = 0
Query: 5150 DSDCASSLACIDQSCQNPCYTI-----DPCDKS--AVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGC----VKDDECPKDSACINRMCK---DPCD---CGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSP-----------VRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICK------DPCACGPNAVCTIENHR--PVCTCKDGFYGDPEIVCK-EVGCQSNSECETTHECINGDCTPVCGP-DHVPCGGDAICQGVNHQ-YVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACI--NKQCQDPCAISDQCVDVAQCVVENHQVDC 5520
            DSDC     C    C N C        DPC+ S     +   T      ICKC  G VP           DTI GC    + D +C  +  C N+ CK   DPC+   CG G  C     +P       + GNP+ EC       D     PD       C P C + S C S  EC      + CR        SP               VC+C  G     +    T+      C  D EC +   C    C       DP  CGP   C +EN R  PVC C  G    P+ +      C  +++CE +H C    C     P D  PCG   +C  V H  + C+CPPG  G+  + C   +C  + EC+ D+ C   N  C +PC +   C D   C V NHQ  C
Sbjct:  136 DSDCPGHGLCCFDGCANTCLDKQELRNDPCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKP---------DTIKGCGPECITDADCKYNYNCENQRCKEKKDPCNPSPCGPGTTC-----KP------NSLGNPVCEC------KDGLIPKPDAIT---GCGPECTIDSDCKSGYEC----SFSKCRKIVDPCKPSPCGPGTACTVNNKGNPVCQCLPGLIPKPD----TIIGCGFECERDLECENGYVCSEHRCIEKSDPCDPSPCGPGTEC-MENDRGYPVCRCLLGLIPKPDTITGCGPECTVDTDCEASHICKESRCMKRPNPCDPNPCGAGGLCDPVGHTGFRCSCPPGYFGDADIQCIKKDCDIDEECSLDQFCNVGNFTCTNPCTMMQSCGDSQFCRVVNHQPIC 509          

HSP 9 Score: 78.5666 bits (192), Expect = 3.376e-14
Identity = 95/340 (27.94%), Postives = 125/340 (36.76%), Query Frame = 0
Query: 3061 KDPCSISPCGDEAICRAVE-GNAICECPEGT--RGDPLDSCVKE----------------------ESCGTTACGPNMACQ-ELYGQPVCECIPGFVPKYPVSLG---------------------CVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNP--LTGCLPECQTDQDCPSDQSCNNLKCQ---DPC-PGFCGIGASCEVEQHKP-TCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDDGN--CVDPCP--ERCGLNADCRVQNHQVQC 3342
            KDPC+ SPCG    C+    GN +CEC +G   + D +  C  E                      + C  + CGP  AC     G PVC+C+PG +PK    +G                     C+E + DPC PSPCG    C+                                              ND    +C C  G    P  +TGC PEC  D DC +   C   +C    +PC P  CG G  C+   H    C C  GY GD   QC+              C  +++C   + C+ GN  C +PC   + CG +  CRV NHQ  C
Sbjct:  227 KDPCNPSPCGPGTTCKPNSLGNPVCECKDGLIPKPDAITGCGPECTIDSDCKSGYECSFSKCRKIVDPCKPSPCGPGTACTVNNKGNPVCQCLPGLIPKPDTIIGCGFECERDLECENGYVCSEHRCIEKS-DPCDPSPCGPGTECME---------------------------------------------NDRGYPVCRCLLGLIPKPDTITGCGPECTVDTDCEASHICKESRCMKRPNPCDPNPCGAGGLCDPVGHTGFRCSCPPGYFGDADIQCIKK-----------DCDIDEECSLDQFCNVGNFTCTNPCTMMQSCGDSQFCRVVNHQPIC 509          

HSP 10 Score: 73.9442 bits (180), Expect = 1.001e-12
Identity = 107/366 (29.23%), Postives = 150/366 (40.98%), Query Frame = 0
Query: 4780 DPCLETTCGQRALCKSEFHISH-CFCPPGLQGNP-IVRCFQVECQQDGDCADNEKCD-LRAQTCQLICNAQSCVSGAICEAKNH-RKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQ---NPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAP-SLVGC----ESSSKCKADQACLNAKCVS------PCNCGTGALCDVINH-TPICYCPPKYSGNPQ-IACEKLECRNDDDCGDHQRCYDNLCV---DPCLIDNECGINAECIPRSHQS-TCECPPGYQGDPFVKCSTFECLTNDECPPTKFCMVNQ--CLDPCVVNEPCGRNAQCRVSQHMASC 5119
            DPC  + CG    C +  H +  C C  GL   P  ++    EC  D DC  N  C+  R +  +  CN   C  G  C+  +     C C+  L+   +      P      C ID DC S + C S  +C+   +PC   +PC     C V +       VCQC  G+        I  P +++GC    E   +C+    C   +C+       P  CG G  C   +   P+C C       P  I     EC  D DC     C ++ C+   +PC   N CG    C P  H    C CPPGY GD  ++C   +C  ++EC   +FC V    C +PC + + CG +  CRV  H   C
Sbjct:  163 DPCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKPDTIKGCGPECITDADCKYNYNCENQRCKEKKDPCNPSPCGPGTTCKPNSLGNPVCECKDGLIPKPDAITGCGPE-----CTIDSDCKSGYEC-SFSKCRKIVDPC-KPSPCGPGTACTVNNKG---NPVCQCLPGL--------IPKPDTIIGCGFECERDLECENGYVCSEHRCIEKSDPCDPSPCGPGTECMENDRGYPVCRCLLGLIPKPDTITGCGPECTVDTDCEASHICKESRCMKRPNPC-DPNPCGAGGLCDPVGHTGFRCSCPPGYFGDADIQCIKKDCDIDEECSLDQFCNVGNFTCTNPCTMMQSCGDSQFCRVVNHQPIC 509          

HSP 11 Score: 72.7886 bits (177), Expect = 1.918e-12
Identity = 101/356 (28.37%), Postives = 144/356 (40.45%), Query Frame = 0
Query: 3883 DPCANRECGPYSQ-KVERNGICTCSCLPGYVGAP---PDCQPICVVNSDCPAHLACINNDCV---DPCFQNVCGSNTHCYVKSH-QAKCECFPGYDGNP--LIGCNKGPTGTITAEER--------------DPCET--CGQHAICHIHNN-IAACKCEDNYIDKPPN---CRRECVLHEDCPKHLACIQYKC---ASPC-INQCGKNADCSVINHD-PICRCLPQYFGDPLVK------------------CEPPKVSQPIDPCLPNPCGENTEHRKAGSNCI-CTCLPGFYGDPYTGC-NYECLIHDDCPYNRAC-ASNHRCSNPC--IGNCGVQAICNVIEHNAICSCPEELE 4180
            DPC    CGP +     ++    C CL G V  P     C P C+ ++DC  +  C N  C    DPC  + CG  T C   S     CEC  G    P  + GC  GP  TI ++ +              DPC+   CG    C ++N     C+C    I KP     C  EC    +C     C +++C   + PC  + CG   +C   +   P+CRCL      P                     C+  +  +  +PC PNPCG        G     C+C PG++GD    C   +C I ++C  ++ C   N  C+NPC  + +CG    C V+ H  IC   E ++
Sbjct:  163 DPCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKPDTIKGCGPECITDADCKYNYNCENQRCKEKKDPCNPSPCGPGTTCKPNSLGNPVCECKDGLIPKPDAITGC--GPECTIDSDCKSGYECSFSKCRKIVDPCKPSPCGPGTACTVNNKGNPVCQCLPGLIPKPDTIIGCGFECERDLECENGYVCSEHRCIEKSDPCDPSPCGPGTECMENDRGYPVCRCLLGLIPKPDTITGCGPECTVDTDCEASHICKESRCMKRPNPCDPNPCGAGGLCDPVGHTGFRCSCPPGYFGDADIQCIKKDCDIDEECSLDQFCNVGNFTCTNPCTMMQSCGDSQFCRVVNHQPICGFNEVIQ 516          

HSP 12 Score: 70.8626 bits (172), Expect = 9.240e-12
Identity = 116/398 (29.15%), Postives = 154/398 (38.69%), Query Frame = 0
Query: 1857 CSDLNECKNNIC-----GAGKTCA-NTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCT-NEQGSYQCTCHDGMVGDPYTQ-GCKPKAQCYSNSECSSDTRCQNGRCV---DPCD-GFCGIGAKCVVKNHS-PKCSCLPRWRGNP-KIKCELLECVENADCDASKSCLNNKCVDACQL--SGICGLNSRCRMSNH-GPVCSCNSGHTGDPRECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSRSE--CKDPCQQPNACGVNALCASKNHQQVC 2235
            C D  E +N+ C     G G TC  N   + IC C +  VP          +C +D DC     C        K   DPC+ S C P  TC            P   G   NP   C     P      G   C PE       C+ GY+   S C+ I +    +PC     CT N +G+  C C  G++  P T  GC    +C  + EC +   C   RC+   DPCD   CG G +C+  +   P C CL      P  I     EC  + DC+AS  C  ++C+          CG    C    H G  CSC  G+ GD                 +  C+K   K C +D  C+ DQ C+     C +PC    +CG +  C   NHQ +C
Sbjct:  154 CLDKQELRNDPCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKPDTIKGCGPECITDADCKYNYNCENQRCKEKK---DPCNPSPCGPGTTCK-----------PNSLG---NPVCECKDGLIPKPDAITG---CGPECTI-DSDCKSGYECSFSKCRKIVDPCKPSPCGPGTACTVNNKGNPVCQCLPGLIPKPDTIIGCG--FECERDLECENGYVCSEHRCIEKSDPCDPSPCGPGTECMENDRGYPVCRCLLGLIPKPDTITGCGPECTVDTDCEASHICKESRCMKRPNPCDPNPCGAGGLCDPVGHTGFRCSCPPGYFGDA----------------DIQCIK---KDCDIDEECSLDQFCNVGNFTCTNPCTMMQSCGDSQFCRVVNHQPIC 509          

HSP 13 Score: 69.3218 bits (168), Expect = 2.781e-11
Identity = 106/371 (28.57%), Postives = 150/371 (40.43%), Query Frame = 0
Query: 4458 DPCPFEECGRNADCSTNRHV-PMCSCLTGYEGNP--YEECRQYECLVDSDCPYTLACPNRECI---DPCQ---CAANAECSVQNH-KASCTCLPGF--QGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCK---NPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACI---NPCTTQNPCSSLAKCYVQDH-MGKCACPAGMTGDPYVSCLEIVTGC----KSDDECQDHEACYNGNCQ---NPCSYPFDPCGQQAECDASNHRAV-CTCPIEWVGNPMRECHQYECIQHNDCPNDKAC-IDN-KCVDPC-LETTCGQRALCKSEFH 4798
            DPC    CG    C+TN+H  P+C CL+G    P   + C   EC+ D+DC Y   C N+ C    DPC    C     C   +     C C  G   + +A TG C P         +C  D DC S   C    C+   +PC    PCG  + C V++   K    C C  G     +      +    F C+   +C    VC+   CI   +PC   +PC    +C   D     C C  G+   P     + +TGC      D +C+    C    C    NPC    +PCG    CD   H    C+CP  + G+   +C + +C    +C  D+ C + N  C +PC +  +CG    C+   H
Sbjct:  163 DPCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKPDTIKGCGP-ECITDADCKYNYNCENQRCKEKKDPCNPSPCGPGTTCKPNSLGNPVCECKDGLIPKPDAITG-CGP---------ECTIDSDCKSGYECSFSKCRKIVDPCK-PSPCGPGTACTVNN---KGNPVCQCLPGLIPKPD-----TIIGCGFECERDLECENGYVCSEHRCIEKSDPCD-PSPCGPGTECMENDRGYPVCRCLLGLIPKP-----DTITGCGPECTVDTDCEASHICKESRCMKRPNPCDP--NPCGAGGLCDPVGHTGFRCSCPPGYFGDADIQCIKKDCDIDEECSLDQFCNVGNFTCTNPCTMMQSCGDSQFCRVVNH 505          

HSP 14 Score: 66.2402 bits (160), Expect = 1.930e-10
Identity = 134/487 (27.52%), Postives = 178/487 (36.55%), Query Frame = 0
Query: 4567 QDGDCP-SRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGC--QTHQ----------DCPPSQVCNNAACINPCTTQ----------NPCSSLAKCYVQDHMGK-CACPAGMTGDPYVSCLEIVTGCKSDDEC-QDHEACYNGNCQNP-CSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQY-------------ECIQHNDCPNDKACIDNKC---VDPCLETTCGQRALCKSEFHISH-CFCPPGLQGNP--IVRCFQVECQQDGDCADNEKC-DLRAQTCQLICNAQSCVSGAIC-EAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQ---NPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQAC--LNAKCVSPC----NCGTGALCDVINHTPIC 4997
            +D DCP S   CFDG C N CL        ++ +V +                   ++ C      + + C  QT            DCP   +C    C N C  +          +PC     C    H    C C +G+   P     + + GC    EC  D +  YN NC+N  C    DPC   + C         TC    +GNP+ EC                EC   +DC +   C  +KC   VDPC  + CG    C      +  C C PGL   P  I+ C   EC++D +C +   C + R       C+   C  G  C E       C C   L+   +      P      C +D DC + H C  E RC    NPC   NPC +   C  +     R   C CP G F      CI       C+   +C  DQ C   N  C +PC    +CG    C V+NH PIC
Sbjct:   52 RDLDCPESALCCFDG-CANTCLLDSEAXPSALIEVPEVFXPYLPPPLPILIPEPLVDETCPNTFPKMHYDCIGQTEHTCWTVGTRDSDCPGHGLCCFDGCANTCLDKQELRNDPCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKP-----DTIKGCGP--ECITDADCKYNYNCENQRCKEKKDPC-NPSPCGPGT-----TCKPNSLGNPVCECKDGLIPKPDAITGCGPECTIDSDCKSGYECSFSKCRKIVDPCKPSPCGPGTACTVNNKGNPVCQCLPGLIPKPDTIIGC-GFECERDLECENGYVCSEHRCIEKSDPCDPSPCGPGTECMENDRGYPVCRCLLGLIPKPDTITGCGPE-----CTVDTDCEASHIC-KESRCMKRPNPC-DPNPCGAGGLCDPVGHTGFR---CSCPPGYFGDADIQCIKK----DCDIDEECSLDQFCNVGNFTCTNPCTMMQSCGDSQFCRVVNHQPIC 509          

HSP 15 Score: 65.0846 bits (157), Expect = 5.279e-10
Identity = 113/452 (25.00%), Postives = 159/452 (35.18%), Query Frame = 0
Query: 2485 DPCSVSYCGANAECRTKNHQ-ALCSCPEGMEGNP--IEHCQPTLVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQ---ICNSNTQCQAGLVCIDRQCVG---GCSSNTQCPSESVCVEGKCQ---DPCQNEASVCGECATCTTQNH-QLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCRNPCNGFECEPNSFCQVNGRN-PLCLCDRGY--QRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCS--ESNSCGKNAECRMNNHRA-QCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALC 2917
            DPC+ S CG    C T  H   +C C  G+   P  I+ C P    C + +DC  +  C       +C+ + D      C  G   +   + N   +C+ GL+       G    C+ ++ C S   C   KC+   DPC+   S CG    CT  N     CQC  G    P                  G G  C R L                              +C+NG  C E  CI                     +PC+   C P + C  N R  P+C C  G   +     GC   ECT +  C     C+  RC+   +  + N CG    C    H   +C CP G++G+A  +C+  + DC +  +C  +  C   +G F                              C NPC +  SCG    C+VVNHQ +C
Sbjct:  163 DPCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKPDTIKGCGPE---CITDADCKYNYNCEN----QRCKEKKDPCNPSPCGPGTTCKPNSLGNPVCECKDGLIPKPDAITGCGPECTIDSDCKSGYECSFSKCRKIVDPCK--PSPCGPGTACTVNNKGNPVCQCLPGLIPKP--------------DTIIGCGFECERDL------------------------------ECENGYVCSEHRCIEK------------------SDPCDPSPCGPGTECMENDRGYPVCRCLLGLIPKPDTITGCGP-ECTVDTDCEASHICKESRCMKRPNPCDPNPCGAGGLCDPVGHTGFRCSCPPGYFGDADIQCI--KKDCDIDEECSLDQFC--NVGNF-----------------------------TCTNPCTMMQSCGDSQFCRVVNHQPIC 509          

HSP 16 Score: 64.3142 bits (155), Expect = 8.154e-10
Identity = 104/378 (27.51%), Postives = 140/378 (37.04%), Query Frame = 0
Query: 5237 DPCD---CGRGAECFLTGHR-PVCRCPEGTKGNPLI------EC-TPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICK---DPCA---CGPNAVCTIENH-RPVCTCKDGFYGDPEIVCK-EVGCQSNSECETTHECINGDCTPVCGP-DHVPCGGDAICQGVNHQY-VCTCPPGLEGNP-YVSCSTVECRDNSECTPDRACINKQCQ--------DPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACI--SKTCQNPCLLAEPCGVNAKCTVLDTLPI 5582
            DPC+   CG G  C    H  P+C+C  G    P        EC T   C+ +  C++         C P     SPCG    C                  + +   VCEC  G     +     +T     CT D +C     C  + C+   DPC    CGP   CT+ N   PVC C  G    P+ +      C+ + ECE  + C    C     P D  PCG    C   +  Y VC C  GL   P  ++    EC  +++C     C   +C         +PC     C  V           C+CPPGY G     C K    C  D +C     C   + TC NPC + + CG +  C V++  PI
Sbjct:  163 DPCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKPDTIKGCGPECITDADCKYNYNCENQRCKEKKDPCNP-----SPCGPGTTC----------------KPNSLGNPVCECKDGLIPKPD----AITGCGPECTIDSDCKSGYECSFSKCRKIVDPCKPSPCGPGTACTVNNKGNPVCQCLPGLIPKPDTIIGCGFECERDLECENGYVCSEHRCIEKSDPCDPSPCGPGTECMENDRGYPVCRCLLGLIPKPDTITGCGPECTVDTDCEASHICKESRCMKRPNPCDPNPCGAGGLCDPVGHTGFR-----CSCPPGYFGDADIQCIKK--DCDIDEECSLDQFCNVGNFTCTNPCTMMQSCGDSQFCRVVNHQPI 508          

HSP 17 Score: 62.003 bits (149), Expect = 4.297e-9
Identity = 109/421 (25.89%), Postives = 157/421 (37.29%), Query Frame = 0
Query: 5080 NDECPPTKFCMVNQCLDPCVVNE----------PCGRNAQCRVSQHM-ASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVP--FRTMICKCRVGWVPDSSRSCVFLPTDTILGC----VKDDECPKDSACINRMCK---DPCD---CGRGAECFLTGH-RPVCRCPEGTKGNP--LIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQS------PCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICK------DPCACGPNAVCTIENHRPV-CTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGD--CTPVCGPDHVPCGGDAICQGVNHQYVC 5459
            + +CP    C  + C + C+  +          PCG    C  ++H    C+C  G          P+P   +    EC  D+DC  +  C +Q C+      DPC+ S         P      +C+C+ G +P           D I GC      D +C     C    C+   DPC    CG G  C +     PVC+C  G    P  +I C    C+ D EC++  VC+ +      C+ +S      PCG   EC                  +     VC C  G     +    T+T     CT D +C  +  C  + C       DP  CG   +C    H    C+C  G++GD +I C +  C  + EC     C  G+  CT  C      CG    C+ VNHQ +C
Sbjct:  136 DSDCPGHGLCCFDGCANTCLDKQELRNDPCNPSPCGPGTTCTTNKHNNPICKCLSGLV--------PKPDTIKGCGPECITDADCKYNYNCENQRCKE---KKDPCNPSPCGPGTTCKPNSLGNPVCECKDGLIPKP---------DAITGCGPECTIDSDCKSGYECSFSKCRKIVDPCKPSPCGPGTACTVNNKGNPVCQCLPGLIPKPDTIIGCG-FECERDLECENGYVCSEH-----RCIEKSDPCDPSPCGPGTECM----------------ENDRGYPVCRCLLGLIPKPD----TITGCGPECTVDTDCEASHICKESRCMKRPNPCDPNPCGAGGLCDPVGHTGFRCSCPPGYFGDADIQCIKKDCDIDEECSLDQFCNVGNFTCTNPCTMMQS-CGDSQFCRVVNHQPIC 509          

HSP 18 Score: 59.6918 bits (143), Expect = 2.300e-8
Identity = 127/506 (25.10%), Postives = 181/506 (35.77%), Query Frame = 0
Query: 3221 FGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDR-----VPKPPIRPLPQCQ--------RNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCIVRGNREVCSCQPGYFGGP---PNCRPECVIQEDCPYDHHCLRGQC---VDPC-VNNCGEGAQCQV-VKHKPMCSCPDGSTGNP-----------------------YKRCQIIVRPPPKQPCFPSPCGANAVCKI-VRAQEKCHCLPGFLGDPPY---CRPECLADHECPSHKICHQEKCI---DPCE-NVCGINALCHTKNHKV-ICVCPSNM--QGDPFDRCSP--------------------NPPEPLETDPCSACGINADCDVRPNDQVICSCPKDYLGDPYIEC-RPECLTNADCPSHQACLRNK--CVDPC--IGTCGVNAECS----EPIDPCQPNPCGLNSVCESNV 3642
            FG   + C      D DCP    C    C + C        S  +E  +               + +VD       PK     + Q +        R+ DCP   +C    C + C ++  L  D           C P   G        + N  +C C  G    P     C PEC+   DC Y+++C   +C    DPC  + CG G  C+      P+C C DG    P                       + +C+ IV      PC PSPCG    C +  +    C CLPG +  P     C  EC  D EC +  +C + +CI   DPC+ + CG    C   +    +C C   +  + D    C P                      P P + +PC A G+   CD   +    CSCP  Y GD  I+C + +C  + +C   Q C      C +PC  + +CG +  C     +PI       CG N V +  V
Sbjct:   39 FGRTESNCWSVGVRDLDCPESALCCFDGCANTCLLDSEAXPSALIEVPEVFXPYLPPPLPILIPEPLVDETCPNTFPKMHYDCIGQTEHTCWTVGTRDSDCPGHGLCCFDGCANTCLDKQELRND----------PCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKPDTIKGCGPECITDADCKYNYNCENQRCKEKKDPCNPSPCGPGTTCKPNSLGNPVCECKDGLIPKPDAITGCGPECTIDSDCKSGYECSFSKCRKIV-----DPCKPSPCGPGTACTVNNKGNPVCQCLPGLIPKPDTIIGCGFECERDLECENGYVCSEHRCIEKSDPCDPSPCGPGTECMENDRGYPVCRCLLGLIPKPDTITGCGPECTVDTDCEASHICKESRCMKRPNPCDPNPCGAGGL---CDPVGHTGFRCSCPPGYFGDADIQCIKKDCDIDEECSLDQFCNVGNFTCTNPCTMMQSCGDSQFCRVVNHQPI-------CGFNEVIQKPV 519          

HSP 19 Score: 57.7658 bits (138), Expect = 9.532e-8
Identity = 80/262 (30.53%), Postives = 104/262 (39.69%), Query Frame = 0
Query: 5359 CTSDDECGDARACINAICKD------PCACGPNAVCTIENH-RPVCTCKDGFYGDPEIVCK-EVGCQSNSECETTHECINGDCTPVCGP-DHVPCGGDAICQGVNH-QYVCTCPPGLEGNP--YVSCSTVECRDNSECTPDRACINKQC---QDPCAISDQCVDVAQCVVENHQVD-CTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQ---NPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQC 5601
            C +D +C     C N  CK+      P  CGP   C   +   PVC CKDG    P+ +      C  +S+C++ +EC    C  +  P    PCG    C   N    VC C PGL   P   + C   EC  + EC     C   +C    DPC  S  C    +C+  +     C C  G    + ++       C  D+DC +   C    C    NPC    PCG    C  +     R   C C PGY GDA IQC
Sbjct:  206 CITDADCKYNYNCENQRCKEKKDPCNPSPCGPGTTCKPNSLGNPVCECKDGLIPKPDAITGCGPECTIDSDCKSGYECSFSKCRKIVDPCKPSPCGPGTACTVNNKGNPVCQCLPGLIPKPDTIIGCG-FECERDLECENGYVCSEHRCIEKSDPCDPS-PCGPGTECMENDRGYPVCRCLLGLI-PKPDTITGCGPECTVDTDCEASHICKESRCMKRPNPCD-PNPCGAGGLCDPVGHTGFR---CSCPPGYFGDADIQC 460          

HSP 20 Score: 56.9954 bits (136), Expect = 1.522e-7
Identity = 110/412 (26.70%), Postives = 153/412 (37.14%), Query Frame = 0
Query: 1060 CNQVICGSNAQCIVSP-SGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQ---CGQEQCGVNAFCDPNRLS---CTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFAS-GKPECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAIC---NLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQK-SCICQDGFTGDANDP--QRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIM-SCPTNEKCMVSDGMPICLCNSGFEK 1456
            CN   CG    C  +  + P C+C  G+V  P     C    C + + C +    C+  RC  +   C    CG    C PN L    C C+ G +  P  +         C  EC  +S C  G   S           ++ C     V+ C    CG    C+  + G P C C  G    P      +  C F  C ++ +C N   GY C  H          C+      E  D C    CGP   C   + G  +C          D + GC     C  +TDC  + IC     S      +PC    CG    C    H    C C  G+ GDA+    ++ C  +E+CS ++ C  G     NF    TC +PC +M SC  ++ C V +  PIC  N   +K
Sbjct:  165 CNPSPCGPGTTCTTNKHNNPICKCLSGLVPKPDTIKGCGP-ECITDADC-KYNYNCENQRCKEKKDPCNPSPCGPGTTCKPNSLGNPVCECKDGLIPKPDAI-------TGCGPECTIDSDCKSGYECS-----------FSKCRKI--VDPCKPSPCGPGTACTVNNKGNPVCQCLPGLIPKP----DTIIGCGFE-CERDLECEN---GYVCSEHR---------CI------EKSDPCDPSPCGPGTECMENDRGYPVCRCLLGLIPKPDTITGC--GPECTVDTDCEASHICK---ESRCMKRPNPCDPNPCGAGGLCDPVGHTGFRCSCPPGYFGDADIQCIKKDCDIDEECSLDQFCNVG-----NF----TCTNPCTMMQSCGDSQFCRVVNHQPICGFNEVIQK 517          

HSP 21 Score: 56.6102 bits (135), Expect = 1.759e-7
Identity = 105/428 (24.53%), Postives = 154/428 (35.98%), Query Frame = 0
Query: 2128 NKCVDACQLS------GICGLNSRCRMSNHG-PVCSCNSGHTGDPRECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSRSECK---DPCQQPNACGVNALCASKNH-QQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMH--------QCQSHNDCAINERCDEG-KCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQC---QDPCKAAQCGPNALCQVIER-QAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQG---ISC-SQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSV-SYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLV 2526
            N C+D  +L         CG  + C  + H  P+C C SG    P                    +K     C+ D +C  +  C    CK   DPC  P+ CG    C   +    VC C  G            P  C +DS+C    +C  S C           C     C +N + +   +CL       D  +G       C   C    +C N   C  H+C    DPC  + CGP   C   +R    C C  G IP P  +  C  E   C  +  C  + +C  S C       + C+ N    G +C  V  +  +C       G   I C  + C  D +C+ D+ C+            V N T        +PC++   CG +  CR  NHQ +C   E ++  P++  +P ++
Sbjct:  152 NTCLDKQELRNDPCNPSPCGPGTTCTTNKHNNPICKCLSGLVPKPDT------------------IKGCGPECITDADCKYNYNCENQRCKEKKDPCN-PSPCGPGTTCKPNSLGNPVCECKDGLIPKPDAITGCGPE-CTIDSDCKSGYECSFSKCRKIVDPCKPSPCGPGTACTVNNKGNPVCQCLPGLIPKPDTIIG-------CGFECERDLECENGYVCSEHRCIEKSDPCDPSPCGPGTECMENDRGYPVCRCLLGLIPKPDTITGCGPE---CTVDTDCEASHICKESRCMK---RPNPCDPNPCGAGGLCDPVGHTGFRCSCPPGYFGDADIQCIKKDCDIDEECSLDQFCN------------VGNFT------CTNPCTMMQSCGDSQFCRVVNHQPICGFNEVIQ-KPVQRSKPFVI 527          
BLAST of GH13743 vs. L. salmonis genes
Match: EMLSAG00000000337 (supercontig:LSalAtl2s:LSalAtl2s104:500942:512548:-1 gene:EMLSAG00000000337 transcript:EMLSAT00000000337 description:"augustus_masked-LSalAtl2s104-processed-gene-5.0")

HSP 1 Score: 109.768 bits (273), Expect = 1.599e-23
Identity = 150/481 (31.19%), Postives = 201/481 (41.79%), Query Frame = 0
Query:  469 EAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCF-PNSQCL-------VQNGLPFCQCLP-------GFKLSPNGRSCIDIDECAGNP--CGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCL----SSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQ---------SCSGSS-----------CSCLPPYQDIEGRC-QLADCS--NCEAPAKCVQITGGISYCACPRGYEMNPRTKN-CEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPG---QGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCIC 901
            E  C+C EG+     E  + C DIDEC   +  +G C  + IC N PGSF C C  GF  +  + C D +EC  N         CTN  GSY C C +     P +    + +R   +D+ C       NG C          C  +   A C  P+   L       + N  P  +          GF+  P   SCID+DEC  N   CG+   C NL GSF C+C  G      + C+  +  E  Q+  CD    C+    S  C C  GY    +  C D+NEC    +C   S+C N  GSY C+C SG++ +    CQ         SC+  +           C C   Y +  G C    +CS  N +    C+ + G    C C  GY  +    N C DIDEC A G+  C    +C+N+ GS+SCSC  G      DPF+   L  R  C          EC+ G CIC
Sbjct:  339 EPKCVCAEGYTILDGE--TDCSDIDEC---LFDSGGC--DHICINKPGSFVCECPPGFAPEG-LECVDENECLSNNGHGPCHGECTNNHGSYVCSCVSL----PGTXLGDDSKRCVANDELCKE----LNGGC-------SHTCYSSQGQAFCMCPDDMKLDTDWKNCISNNDPEEKVKEKKTCDSNGFEYDPASDSCIDVDECGVNENICGEHGQCVNLNGSFECQCSDGYILYESNMCQDINECESEQNV-CDVNSYCVNLEGSFECRCSNGYIL-ESNVCQDINECEDEFICNHGSICVNFEGSYRCDCSSGYELDENRYCQDIDECLQFDSCNNVNSHCINNPGSYFCECNAGYWNNSGFCDDFDECSDRNGDCSQICINLEGSYR-CDCLSGYHTDSVNSNECVDIDEC-AKGYHTC--DQNCVNSLGSYSCSCDWGFEMSHEDPFKCYSLCDRMNCVY--------ECINGTCIC 782          

HSP 2 Score: 109.768 bits (273), Expect = 1.815e-23
Identity = 137/504 (27.18%), Postives = 192/504 (38.10%), Query Frame = 0
Query:   74 KCTKDCLYTTGRHCQHGACLDSQCYCNDGYG--GKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKC--KPGFE-GDGKVECRDIDECLTNQVCGINTLCINTHGNFSCEC------------------------------LPGFHGNP-HDGCVDIDECRTNP--CGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTN-NAQCLPN-GS--CACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSG-CLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGF---NGDPY 531
            +C KDC       C+     + +C C +GY       D  D +EC +        C N  GSF C C  G+  +G  C D +EC        C  + EC N    YVC C   PG   GD    C   DE       G +  C ++ G   C C                                GF  +P  D C+D+DEC  N   CG   +C NL G+++CQC  G          ++ +   +++       C  N+ C        C C  G+  +  + C DINEC+    + C  G+IC+N    YRC+C +GY  D    C+ +     C     C N N+ C+ N GS  C C  G+  N   C D DEC      C    IC+N+ G Y C C++                                          Y+   ++S  C+DIDEC K     G    +  C NS GS++C C  GF   + DP+
Sbjct:  323 QCNKDC----DHKCEINENGEPKCVCAEGYTILDGETDCSDIDECLFDSGGCDHICINKPGSFVCECPPGFAPEGLECVDENECLSNNGHGPC--HGECTNNHGSYVCSCVSLPGTXLGDDSKRCVANDELCKELNGGCSHTCYSSQGQAFCMCPDDMKLDTDWKNCISNNDPEEKVKEKKTCDSNGFEYDPASDSCIDVDECGVNENICGEHGQCVNLNGSFECQCSDGYI------LYESNMCQDINECESEQNVCDVNSYCVNLEGSFECRCSNGYILESNV-CQDINECEDE--FICNHGSICVNFEGSYRCDCSSGYELDENRYCQDID---ECLQFDSCNNVNSHCINNPGSYFCECNAGYWNNSGFCDDFDECSDRNGDCS--QICINLEGSYRCDCLS-----------------------------------------GYHTDSVNSNECVDIDECAK-----GYHTCDQNCVNSLGSYSCSCDWGFEMSHEDPF 760          

HSP 3 Score: 108.612 bits (270), Expect = 4.118e-23
Identity = 133/448 (29.69%), Postives = 188/448 (41.96%), Query Frame = 0
Query:  136 CSCNEGYE-GDG-FHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGI-NTLCINTHGNFSCEC--LPGFH-GNPHDGCVDIDE-CRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKI-SCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTP----PEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYD 571
            C C EGY   DG   C DIDEC    L ++   +  C N P  +VC+C PGF  +G +EC D +ECL+N   G  +  C N HG++ C C  LPG   G+    CV  DE C+    G    C +  G   C CP  +  D     C +   P   ++    ++C  N                GF  DP   SC+D++EC  +    CG    C+N +  + C+C  GY                                        ++ N  +CQDI+EC+S +N C  NS C+N+ G +EC+C    +           C D   E  C   + C   +    C C  G+  +       C DIDEC +  S      VN+ C N+PGS+ C C  G+  +    C D DEC++    C +  +C N  GSY C C +G   D
Sbjct:  342 CVCAEGYTILDGETDCSDIDEC----LFDSGGCDHICINKPGSFVCECPPGFAPEG-LECVDENECLSNNGHGPCHGECTNNHGSYVCSCVSLPGTXLGDDSKRCVANDELCKELNGGCSHTCYSSQGQAFCMCPDDMKLDTDWKNCISNNDPE--EKVKEKKTCDSN----------------GFEYDPASDSCIDVDECGVNENI-CGEHGQCVNLNGSFECQCSDGY--------------------------------------ILYESN--MCQDINECESEQNVCDVNSYCVNLEGSFECRCSNGYILESNVCQDINECED---EFICNHGSICVNFEGSYRCDCSSGYELDENRY---CQDIDECLQFDSCN---NVNSHCINNPGSYFCECNAGYWNNSGF-CDDFDECSDRNGDCSQ--ICINLEGSYRCDCLSGYHTD 713          

HSP 4 Score: 104.76 bits (260), Expect = 5.694e-22
Identity = 108/337 (32.05%), Postives = 148/337 (43.92%), Query Frame = 0
Query:   88 QHGACLD----SQCYCNDGYGGKGCDM-PDTNECKYRP--CDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVC-GINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQS-----SSLYQCGVGAICINQSPGYRCECPAGYN-GDGRFACEPVKVRTTCSSD--FDCTNNAQCLPNGSCACRKGFQPNGVLCQDI 408
            +HG C++     +C C+DGY     +M  D NEC+     CDV  YC N  GSF C C+ GY  +   C+DI+EC   E    C   + C N    Y C C  G+E D    C+DIDECL    C  +N+ CIN  G++ CEC  G+  N    C D DEC          C NL G+Y+C C +G   D    +  +     + +      +C QN  C  S     C+C  GF    ++S  D  +C S     + +Y+C  G           C CP GY   +   +C P K    CS +   D T+   C          GF P G +CQ +
Sbjct:  528 EHGQCVNLNGSFECQCSDGYILYESNMCQDINECESEQNVCDVNSYCVNLEGSFECRCSNGYILESNVCQDINEC---EDEFICNHGSICVNFEGSYRCDCSSGYELDENRYCQDIDECLQFDSCNNVNSHCINNPGSYFCECNAGYWNNS-GFCDDFDECSDRNGDCSQICINLEGSYRCDCLSGYHTD----SVNSNECVDIDECAKGYHTCDQN--CVNSLGSYSCSCDWGF----EMSHEDPFKCYSLCDRMNCVYECINGT----------CICPRGYVLSNDNVSCVP-KKNNGCSMEGLVDQTHRYFC---SEMESSPGFYPVGTICQSL 836          

HSP 5 Score: 91.6633 bits (226), Expect = 5.266e-18
Identity = 85/285 (29.82%), Postives = 135/285 (47.37%), Query Frame = 0
Query:  121 CDVFGYCTNTLGSFFCSCNEGY-EGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDEC-RTNPC-GIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKIS--CVDINECQSSSLYQCGVGAICINQSPGYRCECPAGY--NGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGF 398
            C   G C N  GSF C C++GY   +   C+DI+EC+  +  N C  N+ C NL   + C+C  G+  +  V C+DI+EC    +C   ++C+N  G++ C+C  G+  + +  C DIDEC + + C  + + C N  G+Y C+C AG   +   G C            C+ ++   + +C        C C  G+  D   S  CVDI+EC +   + C     C+N    Y C C  G+  + +  F C  +  R  C   ++C        NG+C C +G+
Sbjct:  526 CGEHGQCVNLNGSFECQCSDGYILYESNMCQDINECESEQ--NVCDVNSYCVNLEGSFECRCSNGYILESNV-CQDINECEDEFICNHGSICVNFEGSYRCDCSSGYELDENRYCQDIDECLQFDSCNNVNSHCINNPGSYFCECNAGYWNN--SGFCD-------DFDECSDRNGDCSQICINLEGSYRCDCLSGYHTDSVNSNECVDIDEC-AKGYHTCDQN--CVNSLGSYSCSCDWGFEMSHEDPFKCYSLCDRMNCV--YECI-------NGTCICPRGY 786          

HSP 6 Score: 73.9442 bits (180), Expect = 1.219e-12
Identity = 123/453 (27.15%), Postives = 183/453 (40.40%), Query Frame = 0
Query:  924 CGFNAECTPSNPPQCLCKAGFT-GNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDEC---HGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVS---LCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGG---------RCITQCGQEQCGVNA-FCDPN--------RLSCTCQSGFLGDPTLVCMPPTQQAECSSE---CGTNSHCI-YGNPNSCACNIGYFGNPYTGCEVTTSVEDC-DSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECL-FSVCGK-NAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAIC-NLG---QCLCASGFKGDDPN-----DLVEGCSSAATCQTN 1335
            C    E   +  P+C+C  G+T  +  T C D+DEC  +      ICINK  ++ CECPPG             + +EC  ++EC   +G   C G +C N   S  C     CV+          +   +DS+  CV+   LC ++  G +  C  S     C C + M  +     +C  +S +     +++ +TC             CI     ++CGVN   C  +           C C  G++   + +C       EC SE   C  NS+C+       C C+ GY         V   + +C D   C   ++C    G   C C  GY+      CQD+DECL F  C   N+ CIN PG Y C C++ +  N            +D D C+++    + IC NL    +C C SG+  D  N     D+ E      TC  N
Sbjct:  328 CDHKCEINENGEPKCVCAEGYTILDGETDCSDIDECLFDSGGCDHICINKPGSFVCECPPGF----------APEGLECVDENECLSNNGHGPCHG-ECTNNHGSYVCS----CVS-------LPGTXLGDDSK-RCVANDELCKELNGGCSHTCYSSQGQAFCMCPDDMKLDT-DWKNC--ISNNDPEEKVKEKKTCDSNGFEYDPASDSCI---DVDECGVNENICGEHGQCVNLNGSFECQCSDGYILYESNMCQDIN---ECESEQNVCDVNSYCVNLEGSFECRCSNGYI----LESNVCQDINECEDEFICNHGSICVNFEGSYRCDCSSGYELDENRYCQDIDECLQFDSCNNVNSHCINNPGSYFCECNAGYWNNS--------GFCDDFDECSDRNGDCSQICINLEGSYRCDCLSGYHTDSVNSNECVDIDECAKGYHTCDQN 736          

HSP 7 Score: 73.1738 bits (178), Expect = 2.274e-12
Identity = 103/371 (27.76%), Postives = 148/371 (39.89%), Query Frame = 0
Query:  630 QNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQC--DQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNV----CGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQ-----GSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDT---LDGNHCKSPCHRFSCGFNAECTP-SNPPQCLCKAGFTGNPLTGCEDLDECA-LNPCKQ-GSICINKLATYQCECPPG 983
            +NG P C C  G+ +      C DIDEC  +  G D IC N  GSFVC+CP G   + L         EC  +++C  + G       C    G   +    CV L    LG+        + +CK L G     C S  QG  F            C+ P  D++      +C +   P + V+            G+E +P + +C D+DEC  +    CG    C+N  GSF C C  G              C   ++ C  NS C   E   +  C CS  + +++    D N C+     F C   + C       +C C +G+  +    C+D+DEC   + C    S CIN   +Y CEC  G
Sbjct:  336 ENGEPKCVCAEGYTILDGETDCSDIDECLFDSGGCDHICINKPGSFVCECPPGFAPEGL---------ECVDENECLSNNGHGPCHGECTNNHG---SYVCSCVSLPGTXLGDDSKRCVANDELCKELNGGCSHTCYSS-QGQAF------------CMCP-DDMKLDTDWKNCISNNDPEEKVKEKKTCD----SNGFEYDPASDSCIDVDEC-GVNENICGEHGQCVNLNGSFECQCSDGYILYESNMCQDINECESEQNVCDVNSYCVNLEGSFE--CRCSNGYILESNVCQDINECED---EFICNHGSICVNFEGSYRCDCSSGYELDENRYCQDIDECLQFDSCNNVNSHCINNPGSYFCECNAG 670          
BLAST of GH13743 vs. L. salmonis genes
Match: EMLSAG00000008732 (supercontig:LSalAtl2s:LSalAtl2s542:459239:479456:-1 gene:EMLSAG00000008732 transcript:EMLSAT00000008732 description:"maker-LSalAtl2s542-augustus-gene-4.8")

HSP 1 Score: 102.064 bits (253), Expect = 6.201e-21
Identity = 142/516 (27.52%), Postives = 208/516 (40.31%), Query Frame = 0
Query:   96 QCYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKD-IDECQIPELANTCVQNAECCNLPAH--YVCKCKPGFEGDGKVECRDI-DECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSG-------------DPYQGACQAQVAP--------------SVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDI---NECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDF-DCTNNAQCLP---NGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISP--TGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGC-FDIDECAENRFICGREALCTNQVGSYSCQC---YNG 567
            +C+C  G+ G  C++ D +EC+  PC   G C +    F C C EGY G    C D I +C     +N C   A C N      + C C+ G+EG+    C  + D C +N      T      G F+C+C+PG+ G+  +  VD ++C   PC +GAKC +L+ ++ C CP+G SG             D   G C   +                +++   C    C  N  C    N   C C  GFTG      VD    + CQ+   Y          +  G+ C+C  G+ G     CE       C+++  D +  A+C+       C CR GF+  G  CQ I+     ENPC     CL+    Y+C C++   G   E+     C    C   A+C  +  + FC+C  G             D   C+ +        C     C +     NC C   + G   IGC ++ D CAE+   C   + C +    Y C C   YNG
Sbjct: 2008 KCFCPSGFSGNSCEI-DIDECESNPCYNGGTCFDKPQGFTCKCPEGYLGH--QCMDEISDCD----SNPCPDRAMCKNEAGXGIFSCLCRDGYEGE---RCNSVVDPCQSNPCFNDATCKTLEQGRFTCQCMPGWEGSLCE--VDSNDCAXQPCLLGAKCKDLVNDFLCDCPSGFSGKRCEEKVDLCKNSDCINGKCVDMLFRYECHCNSGWSGPMCNININDCTVSPCKNNGQCIDDINDFNCVCEPGFTGKKCQHTVDYCISHPCQNGGSY----------KGEGFFCDCRPGFLG---LTCEAAI--DECAANLCDLSGTAKCIDLDNEFKCECRDGFE--GEKCQ-INSNDCIENPCLNGGTCLDEINGYKCSCLSGWTGGNCEKDI-GYCDSQPCQNDATCVNLFQDFFCVCPSG------------TDGKFCETAPERCIGNPCVNGGFCRDFGSGLNCSCPSSYTG---IGCQYEFDACAEDS--CQHGSTCIDNGKEYECICSPGYNG 2475          

HSP 2 Score: 73.1738 bits (178), Expect = 3.067e-12
Identity = 140/542 (25.83%), Postives = 206/542 (38.01%), Query Frame = 0
Query:  816 CACPRGYEMNPRTKNCE-DIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSN-----SQCRENEECLQGKCICSPPFFVDTLDGNHCKS---PCHRFSCGFNAECTPSNPPQ--CLCKAGFTGNPLTGCE-DLDECALNPCKQGSICINKLATYQCECPPGTTGDP--------YTNGCSGSKSVECGADDECHGQLACIGSQC---INPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCD----PNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYG-------NPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDE-CLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAIC----NLGQCLCASGFKGDD 1318
            C CP G+  N    +CE DIDEC++    PC +G  C + P  F+C CP G  G      C+   S C SN     + C+         C+C      D  +G  C S   PC    C  +A C      +  C C  G+ G   + CE D ++CA  PC  G+ C + +  + C+CP G +G            + C   K V+     ECH      G  C   IN C+  PC +N  C+ + +   C C+ GF      + V  C    C +         G  C C  G +G          L+C +A               I +C    C ++         N   C C+ GF G+   +          S++C  N  C+ G       N   C+C  G     +TG      +  CDS  C ++A C        C C  G DG   + C+   E C+ + C     C +   G +C C S + G    GC +      + D CA   C   + C       +C+C+ G+ G +
Sbjct: 2009 CFCPSGFSGN----SCEIDIDECES---NPCYNGGTCFDKPQGFTCKCPEGYLGH----QCMDEISDCDSNPCPDRAMCKNEAGXGIFSCLCR-----DGYEGERCNSVVDPCQSNPCFNDATCKTLEQGRFTCQCMPGWEG---SLCEVDSNDCAXQPCLLGAKCKDLVNDFLCDCPSGFSGKRCEEKVDLCKNSDCINGKCVDMLFRYECHCNSGWSGPMCNININDCTVSPCKNNGQCIDDINDFNCVCEPGFTGKKCQHTVDYCISHPCQNGGS--YKGEGFFCDCRPGFLG----------LTCEAA---------------IDECAANLCDLSGTAKCIDLDNEFKCECRDGFEGEKCQI---------NSNDCIENP-CLNGGTCLDEINGYKCSCLSG-----WTGGNCEKDIGYCDSQPCQNDATCVNLFQDFFCVCPSGTDG---KFCETAPERCIGNPCVNGGFCRDFGSGLNCSCPSSYTG---IGCQY------EFDACAEDSCQHGSTCIDNGKEYECICSPGYNGKN 2477          

HSP 3 Score: 73.1738 bits (178), Expect = 3.252e-12
Identity = 139/557 (24.96%), Postives = 211/557 (37.88%), Query Frame = 0
Query:  520 CVCAKGFNGDPYIGC-FDIDECAENRFICGREALCTNQVGSYSCQC---YNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGA------CNCQEPYVGPNCE---DACRDATCFPNSQC-LVQNGLPFCQCLPGFKLSPNGRSC-IDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQG---ESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSC-----------------SGSSCSCLPPYQDIEGRCQLADCS----NCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTL-------DGNHCKSP--------------CHRFSCGFNAECTPS----------------------------NPPQCLCKAGFTGNPLTGCED-LDECALNPCKQGSICINKLATYQCECPPGTTGD 987
            C C  GF+G+    C  DIDEC  N   C     C ++   ++C+C   Y G Q       C ++   C S+  C   A+C N A      C C++ Y G  C    D C+   CF ++ C  ++ G   CQC+PG++    G  C +D ++CA  PC   A C++L+  F+C CP G      SG R E   +  ++S C  G   +      C C  G+   P  + +++N+C + + C  N  C +    ++C C  GF G     CQ                    G  C C P +  +     + +C+    +    AKC+ +      C C  G+E      N  D  E       PC +G  CL+    + CSC  G  G    G+C      C S   C+ +  C+          F D         DG  C++               C  F  G N  C  S                               +C+C  G+ G     CE+ +++C    C   S CI+ +  + C CP   TG+
Sbjct: 2009 CFCPSGFSGN---SCEIDIDECESNP--CYNGGTCFDKPQGFTCKCPEGYLGHQ-------CMDEISDCDSN-PCPDRAMCKNEAGXGIFSCLCRDGYEGERCNSVVDPCQSNPCFNDATCKTLEQGRFTCQCMPGWE----GSLCEVDSNDCAXQPCLLGAKCKDLVNDFLCDCPSG-----FSGKRCEEKVDLCKNSDCINGKCVDMLFRYECHCNSGWS-GPMCN-ININDCTV-SPCKNNGQCIDDINDFNCVCEPGFTGK---KCQHTVDYCISHPCQNGGSYKGEGFFCDCRPGFLGLTCEAAIDECAANLCDLSGTAKCIDLDNEFK-CECRDGFEGEKCQINSNDCIE------NPCLNGGTCLDEINGYKCSCLSGWTG----GNCEKDIGYCDSQP-CQNDATCVN--------LFQDFFCVCPSGTDGKFCETAPERCIGNPCVNGGFCRDFGSGLNCSCPSSYTGIGCQYEFDACAEDSCQHGSTCIDNGKEYECICSPGYNGK---NCEENINDCTPGSCPPSSTCIDLIDDFYCRCPFNLTGE 2514          

HSP 4 Score: 69.3218 bits (168), Expect = 4.779e-11
Identity = 131/481 (27.23%), Postives = 189/481 (39.29%), Query Frame = 0
Query:  232 DGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVD-INECQSSSLYQCGVGAICINQSPG--YRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQC--LPNG--SCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCL-DIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSS-----------LSCQEKRRSCQSDQ-ECIGNAVCFN----GACNCQEPYVGPNCE---DACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNG 685
            D C ++ +C  N C  G  C  +    +C CP+G SG+    +C+  +        C +  C     C     G  C C EG+ G     C+D I++C S+    C   A+C N++    + C C  GY G+    C    V   C S+  C N+A C  L  G  +C C  G++  G LC+ +D       PC   + C ++  D+ C C +   G   E+   D C   +C     C  +     C C  GW        SG + +I+  D ++SP   C  N  C +    FNCVC  GF G          +C      C             S  C NGG Y               L+C+     C ++  +  G A C +      C C++ + G  C+   + C +  C     CL +     C CL G+     G    DI  C   PC  DA C NL   F C CP GT+G
Sbjct: 1982 DSCQEV-KCMPNICENGGLCVPVNHRPKCFCPSGFSGN----SCEIDI------DECESNPCYNGGTCFDKPQGFTCKCPEGYLGH---QCMDEISDCDSNP---CPDRAMCKNEAGXGIFSCLCRDGYEGE---RCN--SVVDPCQSN-PCFNDATCKTLEQGRFTCQCMPGWE--GSLCE-VDSNDCAXQPCLLGAKCKDLVNDFLCDCPSGFSGKRCEEKV-DLCKNSDC-INGKCVDMLFRYECHCNSGW--------SGPMCNININDCTVSP---CKNNGQCIDDINDFNCVCEPGFTGK---------KCQHTVDYC------------ISHPCQNGGSYKGEGFFCDCRPGFLGLTCEAAIDECAANLCDLSGTAKCIDLDNEFKCECRDGFEGEKCQINSNDCIENPCLNGGTCLDEINGYKCSCLSGWT---GGNCEKDIGYCDSQPCQNDATCVNLFQDFFCVCPSGTDG 2399          
BLAST of GH13743 vs. L. salmonis genes
Match: EMLSAG00000011824 (supercontig:LSalAtl2s:LSalAtl2s829:38411:43233:1 gene:EMLSAG00000011824 transcript:EMLSAT00000011824 description:"maker-LSalAtl2s829-augustus-gene-0.4")

HSP 1 Score: 96.2857 bits (238), Expect = 1.484e-19
Identity = 83/266 (31.20%), Postives = 120/266 (45.11%), Query Frame = 0
Query:   97 CYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGS-FFCSCNEGYEGDGFHC-KDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECR-DIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNG 359
            C C  G+ G  C+   TNEC ++PC   G C     S + C C  G+ GD  HC K    C      + C  N  C N P  Y+C C  GF G   + C   +D C  +  C  N  CI     + CEC  GF G   +   ++D+C ++PC     C +L+ +++C CP G +G          +   ++   C    C     C+   N  ICTC  GFTG  +   ++INEC  +    C     C+++   +RC CP GY+G
Sbjct:  297 CNCPPGFTGINCETRITNECSHQPCLNGGTCQGKGSSNYTCVCPVGFHGD--HCEKRAQXCH----DSPCQNNGACTNGPQGYICGCPHGFSG---INCEIKLDACRADAPCLNNGKCIPVGEFYRCECPLGFTGPNCE--ENVDDCSSSPCRNSGTCIDLISDFKCYCPPGFTG----------LQCEINVNDCRRHPCFNGGTCRDGXNDFICTCPHGFTG--RDCSIEINECLPNP---CMNDGFCVDRMDDFRCHCPRGYSG 536          

HSP 2 Score: 60.4622 bits (145), Expect = 1.328e-8
Identity = 127/471 (26.96%), Postives = 174/471 (36.94%), Query Frame = 0
Query:  603 CQEPYVGPNCEDAC--RDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSF--VCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCV---DLNECLLGNVCGVNSVCKNL-PGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMN---PRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNPLTGCED-LDECALNPCKQGSICINKLATYQCECPPGTTG--------DPYTNGCSGSKSVECGADDEC----HGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFA 1049
            C   Y G +C+  C  RD T F +  C  Q       CLPG++  P   S  + D C    C Q    E+   S    CKC  G  G PL         +C +   C+ G       C+C  G+     G      DLN C     C   + C N   GSY C CP GF G    +C++   + CS  P      G CQ    SN                C CP G+  +    R + C D         +PC +   C N P  + C CP G  G     +C     AC +++ C  N     GKCI    F+                              +C C  GFTG     CE+ +D+C+ +PC+    CI+ ++ ++C CPPG TG        D   + C    +   G +D      HG      S  IN C   PC ++  CV       C C  G++
Sbjct:  155 CSSHYYGNDCDTLCRPRDDT-FGHYICGSQGEKI---CLPGWEKDP---SEPEWDYCTKAICLQGCHSEHGECSSPNECKCRTGWTG-PLCD-------QCVRYPGCEHGYCNKPHECICYDGW-----GGLFCKNDLNYCTNHEPCRNGATCYNTGQGSYTCNCPPGFTG---INCETRITNECSHQPCLNG--GTCQGKGSSNYT--------------CVCPVGFHGDHCEKRAQXCHD---------SPCQNNGACTNGPQGYICGCPHGFSGI----NCEIKLDACRADAPCLNN-----GKCIPVGEFY------------------------------RCECPLGFTG---PNCEENVDDCSSSPCRNSGTCIDLISDFKCYCPPGFTGLQCEINVNDCRRHPCFNGGTCRDGXNDFICTCPHGFTGRDCSIEINECLPNPCMNDGFCVDRMDDFRCHCPRGYS 535          

HSP 3 Score: 59.3066 bits (142), Expect = 3.461e-8
Identity = 87/308 (28.25%), Postives = 119/308 (38.64%), Query Frame = 0
Query:  392 CACRKGFQPNGVLCQ-DIDECQSTENPCGANSICLNV-PGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAF-CICEEGWAYNPKEISSGCLDIDECDKSISP--TGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGC-FDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFN----GACNCQEPYVGPNCE---DACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSC-IDIDECAGNPCGQDAICENLLGSFVCKCPKGTNG 685
            C C  G+   G+ C+ D++ C + E PC   + C N   G Y C C     G   E    + C    C    +CQ   S  + C+C  G+              D C+K         C  N  C+N P  + C C  GF+G   I C   +D C  +   C     C      Y C+C  G     +  +C+E    C S   C  +  C +      C C   + G  CE   + CR   CF    C        C C  GF     GR C I+I+EC  NPC  D  C + +  F C CP+G +G
Sbjct:  257 CICYDGW--GGLFCKNDLNYCTNHE-PCRNGATCYNTGQGSYTCNCPPGFTGINCETRITNECSHQPCLNGGTCQGKGSSNYTCVCPVGFHG------------DHCEKRAQXCHDSPCQNNGACTNGPQGYICGCPHGFSG---INCEIKLDACRADA-PCLNNGKCIPVGEFYRCECPLGF----TGPNCEENVDDCSS-SPCRNSGTCIDLISDFKCYCPPGFTGLQCEINVNDCRRHPCFNGGTCRDGXNDFICTCPHGF----TGRDCSIEINECLPNPCMNDGFCVDRMDDFRCHCPRGYSG 536          
BLAST of GH13743 vs. SwissProt
Match: gi|341940690|sp|Q61555.2|FBN2_MOUSE (RecName: Full=Fibrillin-2; Contains: RecName: Full=Fibrillin-2 C-terminal peptide; Flags: Precursor)

HSP 1 Score: 266.159 bits (679), Expect = 4.220e-69
Identity = 570/2146 (26.56%), Postives = 792/2146 (36.91%), Query Frame = 0
Query:  135 FCSCNEGYEGDGFHCKDIDECQI-PELANTCVQNAECCNLPAHYVCKCKPGFEGDGK-VECRDIDECLTNQVCGINTLCINTHGNFSCECLPGF-HGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAG--LSG------DPYQGACQAQV----------APSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGV--GAICINQSPGYRCECPAGYNGDGR-FACEPVKVRTTCSSDFDCTNNAQCLPNG----SCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYI--GCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGA----CNCQEPYVGPNCEDACRDA-TCFP-----NSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNP----CGQ-------------DAI--------------------------CENLLGSFVCKCPKGTN-GDPLSGCRGESTFECTQDSQCDQGESCL----SSRCVCRRGYERNPAGDCVDLNECLLG-NVCGVNSVCKNLPGSYDCECPSGFQGNPFT---------SCQSCSGSSCSCLPPYQDIE---GRCQLADCSNCEAPAKC----VQITG------GISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLP-------LRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQ----CLCKAGFTGNPLT-GCEDLDECALNPCK-QGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGS----QCINPCSSVPCGSNANCVAENHAAWCRCKSG--------FAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSA--SPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGF-LGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNS--CACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYE-RCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTE------DDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVE--GCSSAATCQ---------------------------------------TNTDCGYNEIC---STIAHSGHR-------FCSDPCQQAQCG-PNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGR----TCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACD---LVNCPSGAECVSEGHRGYCRCLPGYSGN----PDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTC--ASSSQCPPGQICKSGICAAGCSSNTH-CEEGRVCITGKCQDPCTETCGPNALCSPEFENLCQCPEGFAGVPTAAQGCVRIPPTCT----TDCPASSLCFNGYCMPECTSHGQCARGEQCSNG--MCLKLCHTDKNCLQ------------GEICVDKFCEPGCRTDS-DCRLGEVCGAGG-QCSCQPGYEMTQSGCSDLNECKN--NICGAGKTCANTPGSYICSCPTNQVPDESGA-CRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQL--IGSNCQDIDECASG-NPCHNSAKCTNEQGSYQCTCHDGMV 2040
             CS   G   DG   +DI+EC + P++      N  C NL   Y C C  G+E D     C DIDECL N++   N LC NT G++SC C PG+      + C D++EC +NPC  GA C N LG++ C+C  G  LS       D  +G C   +            ++  + C        + C+R    L   C  GF     ++C D+NEC+       GV     C+N    + CECP G   DG    C  +++   C   +D       +P      +C C  G    G  C++  +  + E      ++C   PG      I  L G P  +   +            C+       C C  G+A + +E    C DIDEC   ISP   CG + IC N+PGSF C C +G+     +   C DIDEC  N  +C R   C N  GS+ C C  G +  PS   C +      SD  C  N  C N      C+C   Y        C D   C       ++QC    G   C C  G+ L P+GRSC DIDEC  NP     GQ             D                            CEN  GSF+C C  G +     +GC      E      CD   SCL    S +C CR G+  N    C+DL+EC  G + C +N+ C N PGSY C C  GF G+ FT         +   C    C  +P     E   G    +D  +C+   +C    + + G      G+ +C C  GYE++    NC DIDEC       C +G  C+N PG + C+CPP    +P    C+        L+     +     N E   G    S    +    GN C++            C P N  +    C    GF  NP+T   ED+DEC   P   QG  CIN   ++QCECP G      T  C      EC A     G   C  +     CI P   +      NC+    +   R  +G        F    +  C +    V    N  C   P+ P    F+ + GN  PG    + +  +     C E    C  G CI Q G                C C +GF   D  LVC    + +   + C  N+ CI  +P S  C C  G+  +P   C       +  ++    + +C    G  +C C  G+     +  C DVDEC    CG N  C NT G Y+C C+  F       C+ ++  +        +  C N+      +CN G  L   G    D N+ V   G  S  TCQ                                       TNT  G+  IC     ++ +G R       FC    +  +C  P +F  T   +  C C         DP   C ++++ +  + CP G     + H        CL+   I S   N +C+ +DG   C C  G+  +     C     C   + C  G   N +      C    +   ++NC    EC         RC+  +       P   +  +   Q  C    ECAE        G   C+          G +C        CICP G+    P  EG     CV+  +C                 +  IC EN  C      ++C+C   F  S +    C  N +G LC     QT C  ASSS+     + KS  C  G     H CE         C  P T           +++ +C    G+A        C  +P  CT     +   S  CF         S   C   ++CS     C  +C   K   Q            G+ C D      C+T   +C+   V   GG  C C PG+    + C D NEC +  ++CGA   C NTPGS+ C C      D SG  C   D+C  +  C         ++ G  +C   C   Y         +QH  +  C  +   + +NP               CG  SC+    + KC C  G+      S C D++EC+S  NPC  S  C+N +G Y C C  G  
Sbjct:  748 LCSSGIGITVDG---RDINECALDPDIC----ANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDVNECESNPCVNGA-CRNNLGSFHCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATLKSECCATLGAAWGSPCERCE--LDAACPRGFARIKGVTCEDVNECEVFP----GVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRME-HCFLKWDEDECIHPVPGKFRMDACCCAVG-AAWGTECEECPKPGTKE----YETLCPRGPGFANRGDI--LTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNNGFALDMEE--RNCTDIDEC--RISPD-LCG-SGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLC-RGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCR-NGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNPNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECE-IGAHNCDMHASCLNVPGSFKCSCREGWVGNGI-KCIDLDECANGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENTNLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECAD--PINCVNGL-CVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCET------------CPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDID--ECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTY--NVGKAWNKPCEPCPT-PGTADFKTICGN-IPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGS-------------FRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCI-NSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVC--SHGLCVDLQGSYQCICNNGFKASQDQTMCMDVDECERHPCG-NGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVRSENCIDINECDEDPNICLFGSCTNTPGGFQCICPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTT---KAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICS---NGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTCTNVIGSFECTCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPVGYA--LREDQKMCKDLDECAE--------GLHDCESR--------GMMCKNLIGTFMCICPPGM-ARRPDGEG-----CVDENECRT---------------KPGIC-ENGRCVNIIGSYRCECNEGF-QSSSSGTECLDNRQG-LCFAEVLQTMCQMASSSR---NLVTKSECCCDGGRGWGHQCE--------LCPLPGT----------AQYKKICPHGPGYATDGRDIDECKVMPSLCTNGQCVNTMGSFRCFCKVGYTTDISGTACVDLDECSQSPKPCNFICKNTKGSYQCSCPRGYVLQEDGKTCKDL---DECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDASGLNCEDVDECDGNHRCQHG----CQNILGGYRC--GCPQGY---------VQHYQWNQCVDE--NECSNPG-------------ACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPC--SYGCSNTEGGYLCGCPPGYF 2719          

HSP 2 Score: 244.588 bits (623), Expect = 1.282e-62
Identity = 397/1439 (27.59%), Postives = 549/1439 (38.15%), Query Frame = 0
Query:  112 DTNECKYRPCD-VFGYCTNTLGSFFCSCNEGYEGDG--FHCKDIDECQI-PELANTCVQNAECCNLPAHYVCKCKPGFEGDGKV--ECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNP-HDGCVDIDECRT--NPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPK-ISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGY----------------------------NGDGRFACE-----PVKVRTTCSSDFD--------CTNNAQCL---PNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLE-VNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIG-CFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKR---------------RSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCI--DIDECAGNP-CGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLG-NVCGVNSVCKNLPGSYDCECPSGF-QGNPFTSC---------QSCSGSSCSCLPPYQDIE---------GRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQG----KCICSPPFFVDT----LDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNP-LTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLA--CIGSQCINPCSSVPCGSN---------ANCVAENH------------------AAWCRCKSGFAEDSQGNCVSLC------NQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSG---FLGDPTLVCMPPTQQA-----------------------ECSSECG--TNSHCIYGNPN-SCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDF-VGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQ 1382
            D NECK  P    +G C NT+GSF C CN G+  D    +C DIDEC+I P+L  + +    C N P  + C+C  G+E    +   C DIDEC  N +      C+NT G+F C+C  G   +P  + CVDI+EC    N C  G KC N++G YQC C  G    P +  C       +   GC+ Q       C  S     C+C EG+   P   SC DI+EC+++       G  C N    YRC C  G+                            N  G F C       VK  TT  +D D        C  +A CL    +  C+CR+G+  NG+ C D+DEC +  + C  N+ C+N PG Y C C     G        D C E  N  +   C  V     C CE G  + P   S  C DIDEC    S    C V   C+N PG F+C+C  G+  D   G C DIDECA+   I     LC N  G Y C C    Q +P+ + C + R                SC ++   +G  V  +  C       G  CE      TC P     V +   +  C  G    PN  + I  DIDEC   P   Q   C N  GSF C+CP+G                                       Y       C D++EC     VCG  + C N  G+Y C CP  + Q N   +C         +S +G++C    P+   +         G+     C  C  P      T     C    G+  +  T    DIDEC+ I    C +G  C+N  GSF C CP G   +     C  +    + ++ C+ N +C+      +C C+  F +      +D N C    +  S G   +   S   QC+C  GF  +   T C D+DEC  +PC  G+ C N + +Y C C PG            + + +C   DEC       C   +C N   S  C  N          NC+  N                   +  C C  G+   S+ NC+ +       N  + GS   C  +P G  C C  G V           LS  +   C +  Q+     C T     +C V    +  +  C C        GDP  +C    + A                       EC    G  +N  CI  + +  C C +GY  + YTG     + E      CG N  C+   G  ECTC  G++  P   C+D++EC  +      +C+NT G Y+C C   + +    + C  L+   E    C ++      +     C+C  G     P+   EGC     C+T      N  C  I  S    C++  Q +  G       DN Q  C  +
Sbjct: 1066 DINECKAFPGMCTYGKCRNTIGSFKCRCNNGFALDMEERNCTDIDECRISPDLCGSGI----CVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNG-KCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQ-------CTNSEGSYECSCSEGYALMPDGRSCADIDECENNP--DICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNPNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGWVGNGIKCIDLDECANGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENTNLCENGQCLNVPGAYRCECEMG--FTPASDSRSCQDIDEC----SFQNIC-VFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADP--INCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTE---VGVGVSRSSCCCSLGKAWGNPCE------TCPP-----VNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGY--------------------------------------YLSEETRICEDIDECFAHPGVCGPGT-CYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKT----ICGNIPGFTFDIHTGKAVDIDECKEIPGI-CANGV-CINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSY--QCICNNGFKASQDQTMCMDVDECERHPCGNGT-CKNTVGSYNCLCYPGF---------ELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVRSE-NCIDINECDEDPNICLFGS---CTNTPGGFQCICPPGFV-----------LS-DNGRRCFDTRQS----FCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLD-YTGVRCVDTDECSIGNPCG-NGTCTNVIGSFECTCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPVGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGM-ARRPDG--EGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECL---DNRQGLCFAE 2382          

HSP 3 Score: 214.157 bits (544), Expect = 2.236e-53
Identity = 615/2445 (25.15%), Postives = 878/2445 (35.91%), Query Frame = 0
Query:   84 GRHCQHGACLDS----QCYCNDGY----GGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGY--EGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEG--DGKVECRDIDECLT---------------NQVCGINTLCINTHGNFSCECLP-------GFHGNPHDGC------VDIDECRTNP--CGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKI-SCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDF-----DCTNNAQCLPNGSCA------------------CRKGF-QPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLE---------------------------VNCGQRASCQ------IVKSEAFCICEEGWAYNPKEISSG---CLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGD-PYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECA--GNPCGQDAICENLLGSFVCKCPKGTNGDP-LSGCRGESTFECTQ-----DSQCDQGESCLSSRCVCRRGYERNPAG-DCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNPLTGCEDLDECA--LNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAED-SQGNCVSL--CNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQE-----QCGVNAFCDPNRLSCTCQSG-FLGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKC---GDNAVCSFASGKPECTCKRGYDGIPYER-CQDVDECLF--SVCGKNAQCINTPGGYDCRCHSDFVG-NPFEGCVHLEAV----TEDDDLCANQQCGPNAICNLGQCLCASGFK-GDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQA-QCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCST-------NEDC---PAGRTCH----INFNGEQTCLDPCQIMSCP---TNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVN---------CPS-------GAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPA-CSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFENLCQ--CPEGFAGVPTA------AQGCVRIPPTCT------TDCPASSLCFNGYCMP----ECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPG----CRTDSDCRLGEVCGA--------GGQCSCQPGYEMT--QSGCSDLNECKNNIC---GAGKTCANTPGSYICSCPTNQV--PDESG-----ACRS-PDQCSSDQ----------DCNDALACLADSLSGAKKCLD--------PCDISYCTPLATCNVIQHKAFCSCPPK-----------FRGDPTNPKIGCYQVEYPCEGF----------TCGHGSCHPEDHAPKCHCQDGY--QLIGSNCQDIDECA-SGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGFCGIGAKCVVKNHSP-----KCSCLPRWRGNPKI-----KCELLECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPR--ECEQNLDCPGDGKCDNFVC---VKPHEKSCLVDIN-------CNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECV 2250
            G  C++G C+++    QC CN G+     GK C   D +EC      + G C N  GSF C C  G+    +G +C D+DECQ P +      N  C N    + C C PG     DG+V C D     T                 V      C N    F   C P        FHG    G        DI+EC  +P  C  G  C NL G+Y+C C +G   D     C       V++  C+      N LC+ +     CTC  G+    +  +C D+NEC+S+      V   C N    + CEC  G             ++ TC  +      +   N   L +  CA                  C +GF +  GV C+D++EC+     C  N  C+N  G + C+C   L      + C D  +E                           V       C+        + E  C    G+A N  +I +G     DI+EC    +  G C     C N+ GSF C C  GF  D     C DIDEC  +  +CG   +C N  GS+ C+C+ G  Y+   +      ++C    EC  N +                    CR  TC  N++   Q     C C  G +LSP+   C+DI+EC+   N C ++  C N++G++ C C  G    P   GC      EC       D+QC   E   S  C C  GY   P G  C D++EC           C N+PG Y C C  GF  +     ++C   +   L P       C   +C N          T G   C C  GY +   T  C D+DEC+ IG   C   A CLN PGSF CSC  G  G+  +  C+ L    +   QC  N +C+                                   TP +  +C C  GFTG+  T C D+DECA   N C+ G  C+N    Y+CEC  G T          S S  C   DEC  Q  C+       C+++P               C C  G+  D + GNC  +  C   I   N  C+ +P    C C      NP   G            C++     + G C  + G        C        +R SC C  G   G+P   C PP    E  + C                  G+  NP T   +   +++C  L     G N + +F  G  +C C +GY      R C+D+DEC     VCG    C NT G Y C C  +++  N    C+ +       + +   C N+        N+ + +C   +  G   N   E C +  T    T CG     +   H+G     D C++      N  CI       C C  GF+   ND    C+  ++CS        N DC   P    C        +    C+D  + +  P   ++  C+   G   C+CN+GF+ ++    C     C     C  G   N V      C P  +L +         C S          C +E     C C  GY   PD ++               C ++  C    G  SC P  C  LE              +CICP G  V               +E+C D   CD     C+             CT      +C CPP F+ S          D G  C F   Q+ C ++ +        +G C+   + NT   + + C +   + P      P  LC  + E   Q  CP G   VP+          C+  P  C+      TD      C  GY +      C    +C+ G  C NG C  +  + +       C + F EPG    C   ++C    +  A          +C+C  GY +   Q  C DL+EC   +      G  C N  G+++C CP      PD  G      CR+ P  C + +          +CN+       S S   +CLD            + C   ++   +  K+ C C                G     KI  +   Y  +G            C +G C     + +C C+ GY   + G+ C D+DEC+ S  PC+    C N +GSYQC+C  G V     + CK   +C +         CQ   CV+   GF         ++H+      +C   P   G   I          EC      DAS   LN + VD C  +  C     C+    G  C C  G+    +  +C    +C   G C +  C   +  ++ +C    +       C+D   CS S  K+PC           C++     +C CPPG+    +  CV
Sbjct:  576 GVLCKNGRCVNTDGSFQCICNAGFELTTDGKNC--VDHDECTTTNMCLNGMCINEDGSFKCVCKPGFILAPNGRYCTDVDECQTPGIC----MNGHCINNEGSFRCDCPPGLAVGVDGRV-CVDTHMRSTCYGEIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDICANGI-CENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCD------NGLCRNTPGSYSCTCPPGYVFRTETETCEDVNECESNPC----VNGACRNNLGSFHCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGFARIKGVTCEDVNECEVFPGVC-PNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEHCFLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGPGFA-NRGDILTGRPFYKDINECK---AFPGMC-TYGKCRNTIGSFKCRCNNGFALDMEERNCTDIDECRISPDLCG-SGICVNTPGSFECECFEG--YESGFM----MMKNCMDIDECERNPL-------------------LCRGGTCV-NTEGSFQ-----CDCPLGHELSPSREDCVDINECSLSDNLC-RNGKCVNMIGTYQCSCNPGYQATPDRQGCT--DIDECMIMNGGCDTQCTNSEG--SYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMAS--MDMKTCIDVNECDLNP-----NICMFGECEN----------TKGSFICHCQLGYSVKKGTTGCTDVDECE-IGAHNCDMHASCLNVPGSFKCSCREGWVGNGIK--CIDLDECANGTHQCSINAQCVN----------------------------------TPGSY-RCACSEGFTGDGFT-CSDVDECAENTNLCENGQ-CLNVPGAYRCECEMGFT--------PASDSRSCQDIDECSFQNICV----FGTCNNLP-----------GMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVG------------CVDN----RVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCETC-PPVNSTEYYTLCPGGE--------------GFRPNPIT--IILEDIDECQELPGLCQGGNCINTF--GSFQCECPQGYYLSEETRICEDIDECFAHPGVCGP-GTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENE-----LPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFS--YNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICNNGFKASQDQTMCMDVDEC-ERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKN---------------CIDTNECVALPG--SCSPGTCQNLEGSF-----------RCICPPGYEV--------------RSENCIDINECDEDPNICL----------FGSCTNTPGGFQCICPPGFVLS----------DNGRRC-FDTRQSFCFTNFE--------NGKCSVPKAFNT--TKAKCCCS---KMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTCTNVIGSFEC-----TCNEGF-EPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPVGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEGF----QSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYATDGRDIDECKVMPSLCTNGQCVNTMGSFRCFCKVGYTTDISGTACVDLDECSQSPKPCN--FICKNTKGSYQCSCPRGYVLQEDGKTCKDLDECQTKQH-----NCQF-LCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDASG--LNCEDVDECDGNHRC--QHGCQNILGGYRCGCPQGYVQHYQWNQCVDENECSNPGACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSS--KNPCSYG--------CSNTEGGYLCGCPPGYFRVGQGHCV 2727          

HSP 4 Score: 197.593 bits (501), Expect = 1.876e-48
Identity = 332/1283 (25.88%), Postives = 470/1283 (36.63%), Query Frame = 0
Query:  125 GYCTNTLGSFFCSCNEGYEGDG-FHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGD-GKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFH-GNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGY--NGDGRFACEPVKVRTTCSSDF-----------------------DCTNNAQCLP---------NGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYI-GCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRR-SCQSDQECIGNAVCFNGA------CNCQEPYVGPNCEDACRDATCF------------------------PNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDI-----------DECAGNPCGQ---DAICENLLGSFVCK---------------CPKG----TNGDPLSGC-RGESTFECTQ-DSQCDQGE---SCLSSRCVCRRGYERN-PAGDCVDLNECLLG-NVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSN----SQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFN------AECTPSNPP---QCLCKAGFTGN-PLTGCEDLDECALNP--CKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSL----CNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECS--SECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYD-GIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNP 1275
            G C  T+ S+ C CN GY+ D    C D+DEC     +N C  N +C N P  Y CKC  GF+    K  C DIDEC+ N V   N  C+NT G+F C C  GF        CVD DEC T    +   C N  G+++C C  G    P                                 NG  CT              D++ECQ+  +   G    CIN    +RC+CP G     DGR  C    +R+TC  +                        D      C P         +G C+   G   +G   +DI+EC    + C AN IC N+ G Y C C +                                          Y P      C+DIDEC   +     C  N +C N+PGS++C C  G+        C D++EC  N  + G    C N +GS+ C+C  G +   + L C +  + +C  + +     V  NGA      C       G  CE    DA C                         PN +C+   G   C+C  G  L   GR C+DI           DEC     G+   DA C  +  ++  +               CP+G      GD L+G    +   EC      C  G+   +  S +C C  G+  +    +C D++EC +  ++CG + +C N PGS++CEC  G++              C   P        C+   C N E          G   C CP G+E++P  ++C DI+EC ++    C +G  C+N  G++ CSC PG    P +  C  +      N    +QC  +E   +  C CS  + +   DG  C        C  N       +CT  N P   +CLC  GF  +  +  C D++EC LNP  C  G  C N   ++ C C  G +    T GC+     E GA +                     C  +A+C+    +  C C+ G+  +    C+ L         C  NAQC+ +P    C C EG  G+ +        +CS    C E    C+ G+C+               P    C C+ GF         P +    C    EC   + C++G                                      C+   G   C C  GY+       C D+DEC   +   N  C+NTPG Y+C C  DF  NP
Sbjct:  501 GRCIPTVSSYRCECNMGYKQDANGDCIDVDECT----SNPC-SNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCVCKPGFILAP---------------------------------NGRYCT--------------DVDECQTPGICMNGH---CINNEGSFRCDCPPGLAVGVDGR-VCVDTHMRSTCYGEIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDG---RDINECALDPDIC-ANGICENLRGSYRCNCNS-----------------------------------------GYEPDASGRNCIDIDEC---LVNRLLCD-NGLCRNTPGSYSCTCPPGYVFRTETETCEDVNECESNPCVNG---ACRNNLGSFHCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGFARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEHCFLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGPGFANRGDILTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNNGFALDMEERNCTDIDECRISPDLCG-SGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLL------CRGGTCVNTE----------GSFQCDCPLGHELSPSREDCVDINEC-SLSDNLCRNGK-CVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYE--CSCSEGYAL-MPDGRSCADI---DECENNPDICDGGQCT--NIPGEYRCLCYDGFMASMDMKTCIDVNECDLNPNICMFGE-CENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHN---------------------CDMHASCLNVPGSFKCSCREGWVGNGI-KCIDLDECANGTHQCSINAQCVNTPGSYRCACSEGFTGDGF--------TCSDVDECAENTNLCENGQCLNV-------------PGAYRCECEMGF--------TPASDSRSCQDIDECSFQNICVFG-------------------------------------TCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNP 1559          

HSP 5 Score: 184.496 bits (467), Expect = 2.119e-44
Identity = 305/1174 (25.98%), Postives = 431/1174 (36.71%), Query Frame = 0
Query:  468 SEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYI-GCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKG----------TNGDPLSGCRGESTFE---------------CTQDSQCDQGESC--------LSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCL-PLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNPLTGCEDLDECALNP--CKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVEC---GADDECHGQL--------------ACIGSQC------------------------------------INPCSSVPCG-SNANCVAENHAAWCRCKSGFAED-SQGNCVSL----CNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCI-YGNPNSCACNIGYFGNP-YTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYER-CQDVDECLFS--VCGKNAQCINTPGGYDCRCHSDFVGN-PFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNT-DCGYNEICSTIAHSGHRFCS-------------DPCQQA--QCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNED-CPAGR----------TCHINF---NGEQTC--LDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECV 1507
            S   C C  G+    ++ +  C+D+DEC  +    G C       N+PGS+ C C  GF   P    C DIDEC +N  +C +   C N  GS+ C C  G +            ++C    EC    +C NG                           C+ ++G   C C PGF L+PNGR C D+DEC       +  C N  GSF C CP G           +    S C GE                   C  +     GE C             +C  G      G   D+NEC L      N +C+NL GSY C C SG++ +        SG +C  +         C    C N          T G   C CP GY     T+ CED++EC++    PC +GA C NN GSF C C PG         C+  L+  C  N Q    E  + G  + S      TL G    SPC R  C  +A           C  GF       CED++EC + P  C  G  C+N   ++ CECP G T D     C   +   C     +DEC   +              A  G++C                                    IN C + P   +   C     +  CRC +GFA D  + NC  +     +  +CGS   C+ +P    C+CFEG     Y  G   + +C     C      C+GG C+   G  Q             C C  G    P+        +   S     N  C+       C+CN GY   P   GC   T +++C  +  G +  C+ + G  EC+C  GY  +P  R C D+DEC  +  +C    QC N PG Y C C+  F+ +   + C+ +     + ++C   +C       +  C C  G+          GC+    C+    +C  +  C  +  S    C              D C     QC  N+ C+       C C +GFTGD       C   ++C+ N + C  G+           C + F   +  ++C  +D C   +      C    GM  C+C+ G+E ++  G+C     C    +C  G   N       NC P  D    P+G  CV
Sbjct:  508 SSYRCECNMGYK---QDANGDCIDVDECTSNPCSNGDC------VNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLC-KNGRCVNTDGSFQCICNAGFELTTDG-------KNCVDHDECTTTNMCLNG--------------------------MCINEDGSFKCVCKPGFILAPNGRYCTDVDECQTPGICMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGEIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDGR--DINECALDPDICANGICENLRGSYRCNCNSGYEPDA-------SGRNCIDIDECLVNRLLCDNGLCRN----------TPGSYSCTCPPGYVFRTETETCEDVNECES---NPCVNGA-CRNNLGSFHCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATLKSE--CCATL-GAAWGSPCER--CELDA----------ACPRGFARIKGVTCEDVNECEVFPGVCPNGR-CVNSKGSFHCECPEGLTLDGTGRVCLDIRMEHCFLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGPGFANRGDILTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNNGFALDMEERNCTDIDECRISPDLCGSGI-CVNTPGSFECECFEG-----YESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQ-------------CDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGC---TDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDIC-DGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNPNICMFGECENTKGSFI--CHCQLGYS---VKKGTTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGWVGNGIKCIDLDECANGTHQCSINAQCVNTPGSYRCACSEGFTGDGFT----CSDVDECAENTNLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPP--DFQLNPTGVGCV 1565          

HSP 6 Score: 184.111 bits (466), Expect = 2.423e-44
Identity = 324/1233 (26.28%), Postives = 446/1233 (36.17%), Query Frame = 0
Query:  194 RDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGF--TGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCG---QRASC------QIVKSEAFCI---------CEEGWAYNPKEISSGC----------LDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPY-IGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICE-NLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSC------SCLPPYQDIE------------------GRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNC------EDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEE-CLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGN--PLTGCEDLDECALNPCK-QGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQG-NCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTL-VCMPPTQQAECSSECGTNSH-CIYG------NPNSCACNIGY-FGNPYTGCEVTTSVEDCD--SLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSV--CGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQC--GPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEIC 1344
            + ID C  +    +N  CI T  ++ CEC  G+  + +  C+D+DEC +NPC  G  C N  G+Y C+C AG    P + AC       + +   N   C +N  C  +     C C  GF  T D K +CVD +EC ++++    +  +CIN+   ++C C  G+                                          PNG  C D+DECQ T   C  N  C+N  G + C C   L      + C D  +   C    ++  C       + KSE  C          C+   A N  E    C           DI+EC  ++ P      N IC N  GS+ C C  G+  D     C DIDEC  NR +C    LC N  GSYSC C       P     + +  +C+   EC  N  C NGAC                              G   C+C PG KLS  G  CID  +       QD  CE N+ G+ +    K      L    G     C  D+              C RG+ R     C D+NEC +      N  C N  GS+ CECP G   +        +G  C       C   + + E                  G     +C  C  P      T       CPRG     R          +DI+EC+A     C  G  C N  GSF C C  G   D  + +C  +        +CR + + C  G C+ +P  F                              +C C  G+      +  C D+DEC  NP   +G  C+N   ++QC+CP G    P    C      EC   D       C   +C+N   +  C  N    A               D QG   +  C  +  G + QC  S     C C EG    P         SC+    C      C GG+C                P    C C  GF+    +  C+         +EC  N + C++G          C C +GY      TGC   T V++C+  +  C  +A C    G  +C+C+ G+ G    +C D+DEC      C  NAQC+NTPG Y C C   F G+ F  C  ++   E+ +LC N QC   P A     +C C  GF            S + +CQ   +C +  IC
Sbjct:  486 QTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNPCSNG-DCVNTPGSYYCKCHAGFQRTPTKQAC-----IDIDECIQNGVLC-KNGRCVNTDGSFQCICNAGFELTTDGK-NCVDHDECTTTNMC---LNGMCINEDGSFKCVCKPGFI---------------------------------------LAPNGRYCTDVDECQ-TPGIC-MNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGEIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDGRDINEC--ALDP--DICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLC-DNGLCRNTPGSYSCTC-------PPGYVFRTETETCEDVNECESNP-CVNGACR--------------------------NNLGSFHCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATL----KSECCATLGAAWGSPCERCELDA-------------ACPRGFARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDG-------TGRVCLDIRMEHCFLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYET------LCPRGPGFANRGDILTGRPFYKDINECKAFPGM-CTYGK-CRNTIGSFKCRCNNGFALDMEERNCTDI-------DECRISPDLCGSGICVNTPGSF------------------------------ECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDIN--ECSLSDN-----LCRNGKCVNMIGTYQCSCNPGYQA-------------TPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMP------DGRSCADIDECENNPDICDGGQCTNI-------------PGEYRCLCYDGFMASMDMKTCID-------VNECDLNPNICMFGECENTKGSFICHCQLGYSVKKGTTGC---TDVDECEIGAHNCDMHASCLNVPGSFKCSCREGWVGNGI-KCIDLDECANGTHQCSINAQCVNTPGSYRCACSEGFTGDGFT-CSDVDECAENTNLCENGQCLNVPGAY----RCECEMGFT---------PASDSRSCQDIDECSFQNIC 1494          

HSP 7 Score: 144.821 bits (364), Expect = 1.787e-32
Identity = 173/624 (27.72%), Postives = 247/624 (39.58%), Query Frame = 0
Query:  150 KDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGD-GKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPK-ISCVDINECQSSSLYQCGV--GAICINQSPGYRCECPAGYNGDG---------RFACEPVKVRTTC---SSDFDCTNNAQC----------------LPNGSCACRK------GFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPC--RDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNG--------ACNCQEPYVGPNCEDACRDATCFPN------SQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAG--NPCGQDAICENLLGSFVCKCPKGT----NGDPLSGCRGESTFECTQDSQCDQGESCLS 713
            +D++EC   E    C  N +C N    + C+C  G+  D   V C D DEC     CG N  C N  G+F C C  GF   P   C DI+EC  NP     +C N  G+Y+C CP G +    Q  C+     +     C ++      +C+      +C C  G    P    CVD NEC++      G+     C+N    YRCEC  G+             +  C    ++T C   SS  +    ++C                LP G+   +K      G+  +G   +DIDEC+   + C  N  C+N  G + C C            C   D C +        C+  K    C C  G+    +E    C D+DEC      T +     +C N+ G F C C  GF    +  C D +EC     +CG + +C N  GS+SC+C  G   D S L+C++         EC GN  C +G         C C + YV     + C D     N      + C    G   C C  GF       +C D++EC+   NPC     C N  G ++C CP G      G  +SG         + D++ +  E+ LS
Sbjct: 2163 EDVNECL--ESPGIC-SNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCG-NGTCTNVIGSFECTCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPVGYALREDQKMCKDLDECAEGLHDCESRG----MMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKP----GICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCPLP-GTAQYKKICPHGPGYATDG---RDIDECKVMPSLC-TNGQCVNTMGSFRCFCKVGYTTDISGTACVDLDECSQSPKPCNFICKNTKGSYQCSCPRGYVL--QEDGKTCKDLDECQ-----TKQHNCQFLCVNTLGGFTCKCPPGFT-QHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDASGLNCEDV-------DECDGNHRCQHGCQNILGGYRCGCPQGYVQHYQWNQCVDENECSNPGACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCSYG--CSNTEGGYLCGCPPGYFRVGQGHCVSGMGFNKGQYLSVDAEAEDDENALS 2752          
BLAST of GH13743 vs. SwissProt
Match: gi|311033452|sp|P35555.3|FBN1_HUMAN (RecName: Full=Fibrillin-1; Contains: RecName: Full=Asprosin; Flags: Precursor)

HSP 1 Score: 252.677 bits (644), Expect = 4.230e-65
Identity = 517/1990 (25.98%), Postives = 749/1990 (37.64%), Query Frame = 0
Query:   99 CNDGYGG-KGCDMPDTNECKYRPCD-VFGYCTNTLGSFFCSCNEGYEGD--GFHCKDI-----------DECQIPELANTCVQNAECCNLPAHY------------------VCKCKPGFEG----DGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHD-GCVDIDECRTNP--CGIGAKCTNLLGNYQCQCPAGL-SGDPYQGAC----QAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKIS-CVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGD-GRFACEPVKVRTTCSS--DFDCTNNAQCLPNGSCACRKGF--QPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPC---LEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNG----ACNCQEPYV----GPNCEDACRDATCFPN----SQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLS-GCRGESTFECTQDSQ--CDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVN-SVCKNLPGS-YDCECPSG--FQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEEC--------LQGKCICSPPFFVDTLDGNHCKSPCHR----FSCGFNAECTPSNPPQCLCKAGFTGNPLTGC-EDLDECALNP--CKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNC--VSLCNQV--ICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFC--DPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYG-NPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFS--VCGKNAQCINTPGGYDCRCHSDF-VGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICS-----TIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTC---LDPCQIMSCP-TNE----------KCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQG-HSCNEVSFGMKN------CVPACDLVNCPSGAECVSEGH----------------RG--YCRCLPGYSGNP------DDRSGCMI--FSQNKC----SSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVG-KCICP--QGLFVGNPQIEGCRKVSCV-ENEDCPDNEFCDRLSYTC-----------------MDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEV---LCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFENL-CQCPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGG--------QCSCQPG--YEMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRS 1899
            C  GY   KG    D +EC+  P     G C NT GSF C C  G   D  G  C DI           +EC +P +A     +A CC++ A +                  +C   PGF      +GK   +DI+EC        +  C NT G+F C C  GF  +  +  C DIDECR +P  CG G +C N  G+++C+C  G  SG      C    + Q  P + + G          +C  +     C C  G    P IS C+DINEC+ S+ + C  G  C+N    Y+C C  GY+    R  C  +   +  +   +  CTN+        C+C+ GF   P+   C DIDEC+   N C     C N+PG+Y C C    + +   + C D     L  N     +C+  K    C C+ G  Y+ K+  +GC DI+EC+        CG +A+C+N+ GSF C C+ G+ GD  I C D+DEC+    +C + A C N +GSY C C  G  Y     +C +    C  +    GN  C N      C C   +V    G  CED   D    PN      C    GL  C+C  G++L  +G +C D++EC          C N  GS++C CP     +P   GC    +  C  D +   D G++  S+      G   + A  C     C LG   G    +C  +  S Y   CP G  F+ NP T            +   Q++ G CQ   C N          T G   C CP GY +N  T+ C+D++EC+  G   CG G  C N  G+++C CPP         +C+ +R +    +   +N+ C         +  C CS         G     PC +     +  F   C    P       GF  +  TG   D+DEC   P  C+ G +CIN + +++CECP G   +         K + C   DEC               +   C  NA C+    +  C CK G+   S G C   + C ++  IC S+ QCI +     C C  G   N               + CL+          I +C ++ CG N  C       +C C  GF+      C+   + A  +     N  CI       C CN GY   P     V  +    +  KC     C    G   C C  GY  +  E+C+D+DEC+    +C     C NT G + C C   F + +    C  L            +   P +  N  +  C    KG+   D  E       C T  D  + +IC       +         D C++     +  CI  +    C C  G+    N+    C   ++CS    C  G   ++    E TC    +P  +M+C   NE          +C+ + G   C C  G+         +  + C  + +C +G H C E     KN      C+        P G  CV E                  RG   C C  G++ +P      D+R G       QN C    S+     +SE C   +G R   P C         +C  +  V  K +CP  +G       I+ C+ +  V  N +C +    DR SY C                 ++ C       N +C      ++C CP  +I          L E   +   C F    T    + +CPPG              +T C +   C +          CG   +C     +  C+C  GF+   T +        +C               + EC  + +C  G  C N +    C   +  LQ       +    C  +++C    +CG           +C C  G  YE    GC D+NEC +        C+NT G Y+C CP        G C S
Sbjct:  896 CGKGYSRIKGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCPSGMTLDATGRICLDIRLETCFLRYEDEECTLP-IAGRHRMDACCCSVGAAWGTEECEECPMRNTPEYEELCPRGPGFATKEITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCGRG-QCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGG----------VCHNTEGSYRCECPPGHQLSPNISACIDINECELSA-HLCPNGR-CVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGGCETFCTNSEGSY---ECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQ-CTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMG--YSGKKGKTGCTDINECEIGAH---NCGKHAVCTNTAGSFKCSCSPGWIGDG-IKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEG--YTGDGFTCTDLDE-CSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDI--DECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEI----GVGVSKASCC-----CSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILED-------IDECQELPGLCQGGKCIN----------TFGSFQCRCPTGYYLNEDTRVCDDVNECETPG--ICGPGT-CYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNI------GRAWNKPCEQCPIPSTDEFATLCGSQRP-------GFVIDIYTGLPVDIDECREIPGVCENG-VCINMVGSFRCECPVGFFYN--------DKLLVCEDIDECQ--------------NGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNIC-SHGQCIDTVGSFYCLCHTGFKTN------------DDQTMCLD----------INECERDACG-NGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAP-GTCQNLDGSYRCICPPGYS-LQNEKCEDIDECVEEPEICAL-GTCSNTEGSFKCLCPEGFSLSSSGRRCQDLRMSYCYAKFEGGKCSSPKSR-NHSKQECCCALKGEGWGDPCE------LCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILAGNE----CVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLR------EDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECC--CDGGRGWGPHCE--------ICPFQGTVAFKKLCPHGRGFMTNGADIDECKVIHDVCRNGECVN----DRGSYHCICKTGYTPDITGTSCVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFT----------QHHTSCIDNNECTSD------INLCGSKGICQNTPGSFTCECQRGFSLDQTGS--------SCED-------------VDECEGNHRCQHG--CQNIIGGYRCSCPQGYLQ------HYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPAGFQYEQFSGGCQDINECGSAQAPCSYGCSNTEGGYLCGCPPGYFRIGQGHCVS 2688          

HSP 2 Score: 235.343 bits (599), Expect = 8.544e-60
Identity = 385/1397 (27.56%), Postives = 533/1397 (38.15%), Query Frame = 0
Query:   87 CQHGACLDSQ----CYCNDGYGGK----GCDMPDTNECKY--RPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTN-QVCGINTLCINTHGNFSCECLPGFHGNPH-DGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDP-KISCVDI-------------NECQSSSLYQCGVGAI------CINQSPGYRCE-CPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPN--GVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRD--PCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDE-------------CDKSI--SPTGKC---------GVNAICSNSP----GSFNCVCAK---GFNGDPYIGC-FDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGA----CNCQEPYVGP-----NCEDACRDATCFPN----SQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGE---SCLSSRCVCRRGYERNPAG-DCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCG--SGADCLNNPGSFSCSCPPGQG-GDPFQ------------------GSCLPLRSACSSNSQCRENEECLQGKCI-------CSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNP------------PQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLAC---IGS-QCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTC------QCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGR-----CITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGY----DGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDC 1338
            C  G C +++    C+C+ GY GK    GC   D NEC+     C     CTNT GSF CSC+ G+ GDG  C D+DEC      + C Q+A+C N    Y C CK G+ GDG   C D+DEC  N  +CG N  C+N  G + CEC  GF  +     C DIDEC      +   C NL G ++C+C  G   D   G C   V   +    C + +      C  +    IC C   F  +P ++ CVD              +   ++   + GVG         + ++ G  CE CPA    + +  C                      P G     +GF+PN   V+ +DIDECQ     C     C+N  G ++C+C          + C D   C         +C        CIC     Y      + C+D+               CD  +  + T K            N  C   P      F  +C     GF  D Y G   DIDEC E   +C    +C N VGS+ C+C  G  Y+   L C E    CQ+   C  NA C N A    C+C+  Y        N  + C++    PN     QC+   G  +C C  GFK + +   C+DI+EC  + CG +  C N +GSF C+C  G      + C           + C  G+   +  S +C C  GYE  P G  CVD+NECLL         C+NL GSY C CP G+         S     C  +    +    C L  CSN E   KC+          CP G+ ++   + C+D+           G  S     N+     C    G+G GDP +                  G  +    +     +C+E + C  G+CI       C  PF    L GN C             EC+  NP             +C C+ GF   P+  CED++ECA NP      C+N   +Y+C+CP G         C      E G  D    Q+ C   IG+  CI             CV EN    C+ K G  E+  G C++      C  N     SP+   C       CF  ++ N      C + S S+ +P  +    C GGR     C     Q        C   R   T  +G   D   V     +  EC ++ G+  HCI        C  GY   P         + +C+      N +C    G  +C+C +GY    DG     C+D+DEC          C+NT GG+ C+C   F  +    C+     T D +LC ++    N   +   C C  GF  D        C     C+ N  C
Sbjct: 1291 CLSGTCENTKGSFICHCDMGYSGKKGKTGC--TDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECS--NGTHMCSQHADCKNTMGSYRCLCKEGYTGDG-FTCTDLDECSENLNLCG-NGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNC-TDVNECLDPTTCISGN------CVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKILC----------------------PGG-----EGFRPNPITVILEDIDECQELPGLCQGGK-CINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPP--DYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVC-ENGVCINMVGSFRCECPVGFFYNDKLLVC-EDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQE---IPNICSHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERDACG-NGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAPGTCQNLDGSYRCICPPGY---------SLQNEKCEDIDECVEEPEICALGTCSNTEGSFKCL----------CPEGFSLSSSGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGY-ILAGNECVD---------TDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCVDENE---CQTKPGICEN--GRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCFTEVLQN-----MCQIGS-SNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMT--NGADIDECKVIHDVCRNGECVNDRGS-YHCI--------CKTGY--TPDITGTSCVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDG---RSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQH-HTSCIDNNECTSDINLCGSKGICQNTPGSF-TCECQRGFSLDQTG---SSCEDVDECEGNHRC 2577          

HSP 3 Score: 221.861 bits (564), Expect = 8.473e-56
Identity = 553/2175 (25.43%), Postives = 791/2175 (36.37%), Query Frame = 0
Query:  125 GYCTNTLGSFFCSCNEGYEGD-GFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGD-GKVECRDIDECLTN-QVCG----------------------------------------INTLCINTHGNFSCECLPGFH-GNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVG--------------------AICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGS---------CACRKGF--QPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPC----RDPCLEVNCGQRASCQI----VKSE-------------AFC----ICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSY----SCQCYNGGQYDPSSLSCQE--KRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNP--CGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCL----SSRCVCRRGYERNP-AGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNP------------------FTSCQSCSGS-SCSCLPPYQDIEGRCQLADCSNCE------APAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQG----KCICSPPFFVDTL---DGNHCKSPCHRFSCGFNAECTPS-NPPQCLCKAGFTGNPLTGCEDLDECA--LNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAED-SQGNC--VSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSG-FLGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSL-KCGDNAVCSFASGKPECTCKRGYDGIPYER-CQDVDECLF-SVCGKNAQCINTPGGYDCRCHSDFVG-NPFEGCVHL-EAVTEDDDLCANQQCGPNAICNLGQCLCASGFK-GDDPNDLVEGCSSAATCQTNTDCGYNEICSTI-AHSGHRFCSDPCQQA-QCGPNSFCITDNHQKSCICQDGFT--------GDANDPQRG--CQREEKCSTNE-----DCPAGRTCHINFNGEQTCLDPCQIMSCP---TNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEV---------SFGMKNCVPACDLVNCPSG-------AECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSC---------QPACSYLE--------CGVGAVCVVRNHVGKCICPQGLFVGNP--QIEGCRKVSC---VENEDCPDNEFCDRLSYTCMDPCQNEICGEN-ALCTV---AGHQHKCQCPPSFIPSPTPEVL-CEKNDRGDLCPFGQCQTTCASSS-QCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFENLCQCPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCL----KLCHTDKNCLQGEI-CVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMT--QSGCSDLNEC--KNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYC---------TPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGY--QLIGSNCQDIDECASG-NPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYS 2056
            G C  T GS  C CN+G++ D    C D+DEC+     N C    EC N    Y C+C+ G++    + ECRDIDECL N ++C                                         +N +CIN  G+F C C PGF   +    C DI+EC T    +  +C N  G+Y+C+C  GL+       C      S    G     C +      + +   C   E   G+P   C   N  +  +L   G G                     IC N    Y+C C +GY  D             C    +C  N+    NG          C C KGF  +P+   C+DIDEC+S+  PC  N +C N PG + C+C +     P +  C    +  C +     R    I    +KS+               C    IC +G++   +   + C DIDEC+  + P G C  N +C N+ GSF C C  G   D   G   +D   E  F+   +  CT  +       +C C  G  +   +  C+E   R + + ++ C              +P+     E     + C  + +C    G   C+C  GF L    R+C DIDEC  +P  CG+   C N  G F CKC +G     +         EC +D    +G  C     S RC C  G++ +P    C+D+NEC L      N  C NL G Y C C  G+   P                   T C +  GS  CSC P +  +  +    D   CE         +C  I G    C C  G+  +   K C D++EC  +    C SG  C N  GSF C C  G  G   +  C  +         C ++  C       KC CSP +  D +   D + C +  H   C  +A+C  +    +CLCK G+TG+  T C DLDEC+  LN C  G  C+N    Y+CEC  G    P  +G        C   DEC     C+       C ++P               C C+ G+  D S GNC  V+ C       +  C+ +P    C C      NP   G     S +       +G            G   C        ++ SC C  G   G P  +C P    +E    C                  G+  NP T   +   +++C  L        C    G  +C C  GY      R C DV+EC    +CG    C NT G Y C C  D++  N    C+ +  ++   +    NQ C    + N+ + +C   +  G   N   E C   +T +  T CG       I  ++G     D C++      N  CI       C C  GF          D ++ Q G  CQR  +C         DC  G      F     C D  +    P   ++ +C+ + G   CLC++GF+ N     C     C  D+ C  G   N +          F + +     D+  C SG        +C++      C+C  GY   PD R+   I   N+C           C+  +G   C            C  ++        C +G  C       KC+CP+G  + +   + +  R   C    E   C   +  +     C    + E  G+   LC        +  C      I  P    +  ++    D+C  GQC  T  S   +CP G I    +    C     C  G  C  G C+         N +   E    C C EGF   P     C  I          +  C N Y   EC          +C  G  L    ++C  +  C +G+  C +K  E  C+      +G        C C PGY+      GC D NEC  K  IC  G+ C NT GSY C C      D   A  + D+C  +++       L +         +P   S C              C      AF    P  RG  TN   G    E       C +G C  +  +  C C+ GY   + G++C D++EC     PC+    C N +GSYQC+C  G +     + CK   +C +
Sbjct:  463 GRCIPTPGSCRCECNKGFQLDLRGECIDVDECE----KNPCA-GGECINNQGSYTCQCRAGYQSTLTRTECRDIDECLQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGSDINECALDPDICPNGICENLRGTYKCICNSGYEVD--------STGKNCVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESS--PC-INGVCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGYS---RIKGTQCEDIDECE--VFP-GVC-KNGLCVNTRGSFKCQCPSGMTLDA-TGRICLDIRLETCFLRYEDEECTLPIAGRHRMDACCCSVGAAW--GTEECEECPMRNTPEYEELCPRGPGFATKEITNGKPFFKDINECKMIPSLC-THGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCGR-GQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISACIDINECELSAHLCPNGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYR-CLCYDGFMASEDMKTCVDVNECD-LNPNICLSGT-CENTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHM--CSQHADCKNTMGSYRCLCKEGYTGDGFT-CTDLDECSENLNLCGNGQ-CLNAPGGYRCECDMGFV--PSADG------KACEDIDECSLPNICV----FGTCHNLP-----------GLFRCECEIGYELDRSGGNCTDVNECLDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDN----------GDTACSNEIGVGVSKASCCCSLGKAWGTPCEMC-PAVNTSEYKILCPGGE--------------GFRPNPIT--VILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGP-GTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPG----YRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERDA-CGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDI---NECLLEPRKCAPGTCQNLDGSYRCICPPGYSLQNEKCEDIDECVEEPEICALG-TCSNTEGSFKCLCPEGFSLSSSGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYI----LAGNECVDTDECSVGNPCGNGTCK---------NVIGGFE----CTCEEGFE--PGPMMTCEDINECAQNPLLCAFRCVNTYGSYEC----------KCPVGYVLREDRRMCKDEDECEEGKHDCTEKQME--CKN----LIGTY-----MCICGPGYQRRPDGEGCVDENECQTKPGICENGR-CLNTRGSYTCEC-----NDGFTASPNQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTN---GADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQAPKPCN--FICKNTEGSYQCSCPKGYILQEDGRSCKDLDECAT 2491          

HSP 4 Score: 209.92 bits (533), Expect = 3.912e-52
Identity = 472/1943 (24.29%), Postives = 711/1943 (36.59%), Query Frame = 0
Query:  295 QNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSC---------ACRKGFQ--PNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRD--PCLEVNCGQRASCQIVKSEAFCICEEGWAYN-------PKEISSGCLDIDECDKSISPTGKCGVNAIC-----------------SNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGEST----FECTQDSQCDQG--ESCLSSRC-------------------VCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSC------SCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYC-------------ACPRG-----YEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEE-CLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGN--PLTGCEDLDECALNPCK-QGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQ-LACIGS-QC-----------------INPCSSVPCGSNANCVAENHAAWCRCKSGFA-EDSQGNCVSLC----NQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSE-CGTNSHCI-YGNPNSCACNIGYFGNPYTGCEVTTSVEDCD--SLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECL--FSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTE--DDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQ------DGFTGDANDPQRGCQREEKCSTN--------EDCPAGRTCHINF---NGEQTCLDPCQIMSCPTNE-----------KCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNK----CSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNP-QIEGCRKVSCV-ENE-----------DCPDNEFCDRLSYTC--MDPCQNE-ICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGD------LCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCI-TGKCQDPCTETCGPNALCSPEFENL-CQCPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICV--DKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKNN--ICGAGKTCANTPGSYICSCPTNQVPDESG------------ACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDP 2043
            QN  C  +     C C +GF  D +  C+D++EC+ +       G  CIN    Y C+C AGY        +    RT C    +C  N +   NG C          C  GF    +G  C+D+DEC S  N C  N +C+N  G ++C C          + C+D   C          C        C C  G A            + S C    +  + I P       + C                 + +   +  +C+ G  G    G  DI+ECA +  IC    +C N  G+Y C C +G + D +        ++C    EC+ N++  +                         N QC    G   C C  GF   P+ ++C DIDEC  +PC  + +C+N  GSF+C+C   +  DP      E+     ++   D +C+     + L S+C                   +C +GY R     C D++EC +      N +C N  GS+ C+CPSG   +        +G  C      +C   Y+D E    +A     +A    V    G   C              CPRG      E+       +DI+EC+ I  + C  G  C N  GSF C C  G   D  + +C  +        +CR + + C +G+C+ +P  F                              +C C  G+      +  C D+DEC  +P   +G +C N   +Y+CECPPG    P  + C      E  A    +G+ +  IG  QC                 I+ CS +  G    C     +  C C+ GFA    Q +C  +     N  IC    QC   P    C C++G + +        + +C   + C      C  G C    G                C C  G+ G           + E  +  CG ++ C        C+C+ G+ G+        T +++C   +  C  +A C    G   C CK GY G  +  C D+DEC    ++CG N QC+N PGGY  RC  D    P       E + E    ++C    C  + +  L +C C  G++ D        C+    C   T C    I     ++   +  D     +  P      D    +C         +G T  +N+   G  +   C +         E CPA  T         GE    +P  ++    +E           KC+ + G   C C +G+  N+ T  CD    C     C  G   N V  G   C+   D +    G  C+         C   Y  +     G ++F+  K    CS N   A ++ C++          C        A        G  I    ++ G P  I+ CR++  V EN            +CP   F +     C  +D CQN  +C  NA C      ++C C P +  + T +     NDR +      +C  GQC  T   S  C         +C  G  +N   ++  +C+   +C+    + CG N  C     +  C+C  GF  + +    C+ +    + +    +LC NG C+    S  QC    QC+ G   ++    + C+    C+   + C PG   + D           +C C PGY +    C D++EC     IC  G TC+NT GS+ C CP       SG            A     +CSS +  N +      +L G +   DPC++        C     +AF    P   G    P      ++   E   C HG C   D + +C C  GY L G+ C D DEC+ GNPC N   C N  G ++CTC +G    P
Sbjct:  461 QNGRCIPTPGSCRCECNKGFQLDLRGECIDVDECEKNPC----AGGECINNQGSYTCQCRAGY--------QSTLTRTECRDIDECLQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDEC-SIRNMC-LNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSG-PGMTSAG-SDINECALDPDIC-PNGICENLRGTYKCICNSGYEVDSTG-------KNCVDINECVLNSLLCD-------------------------NGQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESSPC-INGVCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGYSRIKGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCPSGMTLDA-------TGRICLDIRLETCFLRYEDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPMRNTPEYEELCPRGPGFATKEITNGKPFFKDINECKMI-PSLCTHGK-CRNTIGSFKCRCDSGFALDSEERNCTDI-------DECRISPDLCGRGQCVNTPGDF------------------------------ECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISACIDINECELSAHLCPNGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNIC-DGGQCTNIPGEYRCLCYDGFMASE------DMKTCVDVNECDLNPNICLSGTCENTKGS-------------FICHCDMGYSGKKGKTGCTDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDGIK----CTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGDGF-TCTDLDECSENLNLCG-NGQCLNAPGGY--RCECDMGFVPSADGKACEDIDECSLPNICVFGTC--HNLPGLFRCECEIGYELDRSGG---NCTDVNECLDPTTC----ISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTV--GNYTCICPPDYMQVNGGNNCMDMRRS---LCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQ----------CPIPSTDEFATLCGSQRPGFVI---DIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQC----NDRNECQEIPNICSHGQCIDT-VGSFYC---------LCHTGFKTN---DDQTMCLDINECE---RDACG-NGTCRNTIGSFNCRCNHGF--ILSHNNDCIDVDECASGN---GNLCRNGQCINTVGSF-QC----QCNEG--YEVAPDGRTCVDINECLLEPRKCAPGTCQNLD--------GSYRCICPPGYSLQNEKCEDIDECVEEPEICALG-TCSNTEGSFKCLCPEGFSLSSSGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKG-EGWGDPCEL--------CPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILAGNECVDTDECSVGNPCGN-GTCKNVIGGFECTCEEGFEPGP 2200          

HSP 5 Score: 177.178 bits (448), Expect = 3.225e-42
Identity = 296/1143 (25.90%), Postives = 419/1143 (36.66%), Query Frame = 0
Query:  208 NTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQA---------------------------QVAPSVSQQGCNAQSCGQ--------NALCQRSSNGLICTCREGF-TGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGY--NGDGRFACEPVKVRTTCSSDFDCTNNAQCLP-------NGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIG-CFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPF------CQCLP----GFKLSPNGRSCIDIDECAGNP-CGQDAICENLLGSFVCKCPKGTNGDPLS----GCRGESTFECTQDSQCD---QGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNP-LTGCEDLDECALNP--CKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFA-EDSQGNCVSL----CNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSE-CGTNSHCI-YGNPNSCACNIGYFGNPYTGCEVTTSVEDCD--SLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECL--FSVCGKNAQCINTPGGYDCRCHSDFV 1272
            N  CI T G+  CEC  GF  +    C+D+DEC  NPC  G +C N  G+Y CQC AG      +  C+                                 V++ G N +   +        N +C        C C+ GF        C DINEC++  +   G    C+N    YRCEC  G     DGR  C    +R+TC   +      QC+           C C       G  CQ          PC A +       +Y+  C +    T       +  L+ +      C+ ++    CIC  G  Y        C+DI+EC   +  +  C  N  C N+PGSF C C KGF   P +  C DIDEC  +  I G   +C N  GS+ C+C +    DP+   C E  +                    C +  +   CE     AT    SQC    G  +      CQ  P    G+     G  C DIDEC   P   ++ +C N  GSF C+CP G   D         R E+ F   +D +C     G   + + C C  G     A    +  EC + N      +C   PG    E  +   G PF        + C  +P        C    C N          T G   C C  G+ ++   +NC DIDEC+ I    CG G  C+N PG F C C  G     ++   + +++       C + +EC +   +C                 CH     +  EC P          G   +P ++ C D++EC L+   C  G  C+N +  YQC C PG    P                     +L C+    I+ CS +  G    C     +  C C+ GFA    Q +C  +     N  IC    QC   P    C C++G + +        + +C   + C      C  G C    G                C C  G+ G           + E  +  CG ++ C        C+C+ G+ G+        T +++C   +  C  +A C    G   C CK GY G  +  C D+DEC    ++CG N QC+N PGGY C C   FV
Sbjct:  462 NGRCIPTPGSCRCECNKGFQLDLRGECIDVDECEKNPCA-GGECINNQGSYTCQCRAGYQSTLTRTECRDIDECLQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGR---CVNTDGSYRCECFPGLAVGLDGR-VCVDTHMRSTCYGGY---KRGQCIKPLFGAVTKSECCCASTEYAFGEPCQ----------PCPAQN-----SAEYQALCSSGPGMTSAGSDINECALDPDICPNGICENLRGTYKCICNSG--YEVDSTGKNCVDINEC---VLNSLLCD-NGQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESSPCING---VCKNSPGSFICECSSESTLDPTKTICIETIKG------------------TCWQTVIDGRCEININGATL--KSQCCSSLGAAWGSPCTLCQVDPICGKGYS-RIKGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCPSGMTLDATGRICLDIRLETCFLRYEDEECTLPIAGRHRMDA-CCCSVG----AAWGTEECEECPMRNTPEYEELCPRGPGFATKEITN---GKPFFK----DINECKMIPSL------CTHGKCRN----------TIGSFKCRCDSGFALDSEERNCTDIDECR-ISPDLCGRG-QCVNTPGDFECKCDEG-----YESGFMMMKN-------CMDIDECQRDPLLCR-------------GGVCHNTEGSYRCECPP----------GHQLSPNISACIDINECELSAHLCPNGR-CVNLIGKYQCACNPGYHSTP--------------------DRLFCVD---IDECSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNIC-DGGQCTNIPGEYRCLCYDGFMASE------DMKTCVDVNECDLNPNICLSGTCENTKGS-------------FICHCDMGYSGKKGKTGCTDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDGIK----CTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGYTGDGF-TCTDLDECSENLNLCG-NGQCLNAPGGYRCECDMGFV 1436          

HSP 6 Score: 59.6918 bits (143), Expect = 9.484e-7
Identity = 244/986 (24.75%), Postives = 348/986 (35.29%), Query Frame = 0
Query: 2348 NALCQVIERQAFCVCQRGFIPNPSPVV-----ACTREPITCQGNKQCPE---NFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTA--------DKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGA-------NAECRTKNHQALCSCPEGMEGNPIEHCQPTLVPCSSASDCP-QSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQAGLVCIDR--QCVGGCSSNTQCPSESVCVEG--------KCQDPCQNEASVC------GECATCTTQNHQLQ---CQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCISG--CGSNRDCPYGEMCEGGQCRNPCNGFECE--------PNSFCQ-VN--GRNPLCLCDRGYQRLASGGC----AKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPC-ATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGT---SCP-------DGKSCQVLNH--------QALCI--------------------------CTKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPL-DSCVKEESC-GTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFI-QCQPVEETPKDACQPSPCGS-KANCNI---NDENQAICSCWEGYF 3221
            N +C  +     C C  GF  N   +V      C   P+ CQ N +C     ++ CD   CKP     S  + N+    +    +C S  QC          C  G +++ D T           AC N  C             G I++H  D   V  C +       N +C        C C EG E        P    C   ++C  + + C+ GTC     L G      +C  G  +Q    N +C+    C++    C  G  SNT+   + +C EG        +CQD      S C      G+C++  ++NH  Q   C       GDP + C T            GSG+       A   +   EC   + C  G C     I +D     EC  G  ++G  C    +C  G  C  G C+N   GFEC         P   C+ +N   +NPL    R      S  C              C  +  CE G+  + C+E     K  EC+       C+C  G+      E  VD N+C       EN +CLN  G + C C  G T  P Q  +C   ++         N C + GS  +  + K     + C C    G  P         C+  P     +  + C        N     GA +D C   H    N  C+  R    C CK     +  G          C+  ++C       +  C+N  +G+   SCP       DG+SC+ L+         Q LC+                          CT D   I+ CG + IC+   G+  CEC  G   D    SC   + C G   C     CQ + G   C C  G++  Y  +  CV+  ++ C  +     A+C   L   KC+CP G   + F   CQ + E          CGS +A C+    N E   +C C  GYF
Sbjct: 1779 NGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPV-CQRNAECINTAGSYRCD---CKPGYRFTSTGQCNDRNECQEIPNIC-SHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYE------VAPDGRTCVDINECLLEPRKCAPGTCQ---NLDGS--YRCICPPGYSLQ----NEKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSSGRRCQDL---RMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMD---ECKEPDVCKHGQC-----INTDGSYRCECPFGYILAGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGK--HDCTE-----KQMECKNLIGTYMCICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQD-ECLDNREGYCFTEVLQNMCQI-GSSNRNPVTK-----SECCCDGGRGWGPH--------CEICPFQGTVAFKKLCPHGRGFMTN-----GADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITG--------TSCVDLNECNQAPKPCNFICKNT-EGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQHHTSCIDNNECTSD---INLCGSKGICQNTPGSFTCECQRGFSLDQTGSSCEDVDECEGNHRC--QHGCQNIIGGYRCSCPQGYLQHYQWNQ-CVD--ENECLSAHICGGASCHNTLGSYKCMCPAGFQYEQFSGGCQDINE----------CGSAQAPCSYGCSNTEGGYLCGCPPGYF 2679          
BLAST of GH13743 vs. SwissProt
Match: gi|1042782300|sp|P98133.2|FBN1_BOVIN (RecName: Full=Fibrillin-1; AltName: Full=MP340; Contains: RecName: Full=Asprosin; Flags: Precursor)

HSP 1 Score: 252.292 bits (643), Expect = 5.918e-65
Identity = 514/1984 (25.91%), Postives = 748/1984 (37.70%), Query Frame = 0
Query:   99 CNDGYGG-KGCDMPDTNECKYRPCD-VFGYCTNTLGSFFCSCNEGYEGD--GFHCKDI-----------DECQIPELANTCVQNAECCNLPAHY------------------VCKCKPGFEG----DGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHD-GCVDIDECRTNP--CGIGAKCTNLLGNYQCQCPAGL-SGDPYQGAC----QAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKIS-CVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGD-GRFACEPVKVRTTCSS--DFDCTNNAQCLPNGSCACRKGF--QPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPC---LEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNG----ACNCQEPYV----GPNCEDACRDATCFPN----SQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLS-GCRGESTFECTQD--SQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVN-SVCKNLPGS-YDCECP--SGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEEC--------LQGKCICSPPFFVDTLDGNHCKSPCHR----FSCGFNAECTPSNPPQCLCKAGFTGNPLTGC-EDLDECALNP--CKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNC--VSLCNQV--ICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFC--DPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYG-NPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFS--VCGKNAQCINTPGGYDCRCHSDF-VGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICS-----TIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTC---LDPCQIMSCP-TNE----------KCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCL-ADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGH----------------RG--YCRCLPGYSGNP------DDRSGCMI--FSQNKC----SSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVG-KCICP--QGLFVGNPQIEGCRKVSCV-ENEDCPDNEFCDRLSYTC-----------------MDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEV---LCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFENL-CQCPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGG--------QCSCQPG--YEMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRS 1899
            C  GY   KG    D +EC+  P     G C N+ GSF C C  G   D  G  C DI           +EC +P +A     +A CC++ A +                  +C   PGF      +GK   +DI+EC        +  C NT G+F C C  GF  +  +  C DIDECR +P  CG G +C N  G+++C+C  G  SG      C    + Q  P + + G          +C  +     C C  G    P IS C+DINEC+ S+ + C  G  C+N    Y+C C  GY+    R  C  +   +  +   +  CTN+        C+C+ GF   P+   C DIDEC+   N C     C N+PG+Y C C    + +   + C D     L  N     +C+  K    C C+ G  Y+ K+  +GC DI+EC+        C  +A+C+N+ GSF C C+ G+ GD  I C D+DEC+    +C + A C N +GSY C C  G  Y     +C +    C  +    GN  C N      C C   +V    G  CED   D    PN      C    GL  C+C  G++L  +G +C D++EC          C N  GS+ C CP     +P   GC    +  C  D   + D G++  S+      G   + A  C     C LG   G    +C  +  S Y   CP   GF+ NP T            +   Q++ G CQ   C N          T G   C CP GY +N  T+ C+D++EC+  G   CG G  C N  G+++C CPP         +C+ +R +    +   +N+ C         +  C CS         G     PC +     +  F   C    P       GF  +  TG   D+DEC   P  C+ G +CIN + +++CECP G   +         K + C   DEC               +   C  NA C+    +  C CK G+   S G C   + C ++  IC S+ QCI +     C C  G   N            +  + CL+          I +C ++ CG N  C       +C C  GF+      C+   + A  +     N  CI       C CN GY   P     V  +    D  KC     C    G   C C  GY  +  ++C+D+DEC+    +C     C NT G + C C   F + +    C  L            +   P +  N  +  C    KG+   D  E       C T  D  + +IC       +         D C++     +  CI  +    C C  G+    N+    C   ++CS    C  G   ++    E TC    +P  +M+C   NE          +C+ + G   C C +G+   +    C     C     DCA+     +   G   C+        P G  CV E                  RG   C C  G++ +P      D+R G       QN C    S+     +SE C   +G R   P C         +C  +  V  K +CP  +G       I+ C+ +  V  N +C +    DR SY C                 ++ C       N +C      ++C CP  +I          L E   +   C F    T  + + +CPPG              +T C +   C +          CG   +C     +  C+C  GF+  P+ A        +C               + EC  + +C  G  C N +    C   +  LQ       +    C  +++C    +CG           +C C  G  YE    GC D+NEC +        C+NT G Y+C+CP        G C S
Sbjct:  896 CGKGYSRIKGTQCEDIDECEVFPGVCKNGLCVNSKGSFKCQCPSGMTLDATGRICLDIRLETCFLRYEDEECTLP-VAGRHRMDACCCSVGAAWGTEECEECPVRNTPEYEELCPRGPGFATKEITNGKRFFKDINECKMIPNLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCGRG-QCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGG----------VCLNTEGSYRCECPPGHQLAPNISACIDINECELSA-HLCPHGR-CVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGGCETFCTNSEGSY---ECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQ-CTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMG--YSGKKGKTGCTDINECEIGAH---NCDRHAVCTNTAGSFKCSCSPGWIGDG-IKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEG--YTGDGFTCTD-LDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDI--DECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEI----GVGVSKASCC-----CSLGKAWGTPCELCPPVNTSEYKILCPGGEGFRPNPITVILED-------IDECQELPGLCQGGKCIN----------TFGSFQCRCPTGYYLNEDTRVCDDVNECETPG--ICGPGT-CYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNI------GRAWNKPCEQCPIPSTDEFATLCGSQRP-------GFVIDIYTGLPVDIDECREIPGVCENG-VCINMVGSFRCECPVGFFYN--------DKLLVCEDIDECQ--------------NGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNIC-SHGQCIDTVGSFYCLCHTGFKTN------------ADQTMCLD----------INECERDACG-NGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLDPRKCAP-GTCQNLDGSYRCICPPGYS-LQNDKCEDIDECVEEPEICAL-GTCSNTEGSFKCLCPDGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSR-NHSKQECCCALKGEGWGDPCE------LCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILQGNE----CVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPAGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGTYLCICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECC--CDGGRGWGPHCE--------ICPFQGTVAFKKLCPHGRGFMTNGADIDECKVIHDVCRNGECVN----DRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGSFTCKCPPGFT----------QHHTACIDNNECTSD------INLCGSKGICQNTPGSFTCECQRGFSLDPSGA--------SCED-------------VDECEGNHRCQHG--CQNIIGGYRCSCPQGYLQ------HYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPAGFQYEQFSGGCQDINECGSAQAPCSYGCSNTEGGYLCACPPGYFRIGQGHCVS 2688          

HSP 2 Score: 234.187 bits (596), Expect = 1.589e-59
Identity = 386/1404 (27.49%), Postives = 539/1404 (38.39%), Query Frame = 0
Query:   87 CQHGACLDSQ----CYCNDGYGGK----GCDMPDTNECKY--RPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTN-QVCGINTLCINTHGNFSCECLPGFHGNPH-DGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDP-KISCVDI-------------NECQSSSLYQCGVGAI------CINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPN--GVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRD--PCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSG--CLDIDE-------------CDKSI--SPTGKC---------GVNAICSNSP----GSFNCVCAK---GFNGDPYIGC-FDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGA----CNCQEPYVGP-----NCEDACRDATCFPN----SQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGE---SCLSSRCVCRRGYERNPAG-DCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCG--SGADCLNNPGSFSCSCPPGQG-GDPFQ------------------GSCLPLRSACSSNSQCRENEECLQGKCI-------CSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNP------------PQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLAC---IGSQ-CINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTC------QCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGR-----CITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGY----DGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEIC 1344
            C  G C +++    C+C+ GY GK    GC   D NEC+     CD    CTNT GSF CSC+ G+ GDG  C D+DEC      + C Q+A+C N    Y C CK G+ GDG   C D+DEC  N  +CG N  C+N  G + CEC  GF  +     C DIDEC      +   C NL G ++C+C  G   D   G C   V   +    C + +      C  +     C C   F  +P ++ CVD              +   ++   + GVG         + ++ G  CE            C PV            T+  + L    C   +GF+PN   V+ +DIDECQ     C     C+N  G ++C+C          + C D   C         +C        CIC   +     +++ G  C+D+               CD  +  + T K            N  C   P      F  +C     GF  D Y G   DIDEC E   +C    +C N VGS+ C+C  G  Y+   L C E    CQ+   C  NA C N A    C+C+  Y        N  + C++    PN     QC+   G  +C C  GFK + +   C+DI+EC  + CG +  C N +GSF C+C  G      + C           + C  G+   +  S +C C  GYE  P G  CVD+NECLL         C+NL GSY C CP G+         S     C  +    +    C L  CSN E   KC+          CP G+ ++   + C+D+           G  S     N+     C    G+G GDP +                  G  +    +     +C+E + C  G+CI       C  PF    L GN C             EC+  NP             +C C+ GF   P+  CED++ECA NP      C+N   +Y+C+CP G         C      E G  D    Q+ C   IG+  CI             CV EN    C+ K G  E+  G C++      C  N     SP+   C       CF  ++ N      C + S S+ +P  +    C GGR     C     Q        C   R   T  +G   D   V     +  EC ++ G+  HCI        C  GY   P         + +C+      N +C    G  +C+C +GY    DG     C+D+DEC          C+NT G + C+C   F  +    C+     T D +LC ++    N   +   C C  GF  D          S A+C+   +C  N  C
Sbjct: 1291 CLSGTCENTKGSFICHCDMGYSGKKGKTGC--TDINECEIGAHNCDRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECS--NGTHMCSQHADCKNTMGSYRCLCKEGYTGDG-FTCTDLDECSENLNLCG-NGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNC-TDVNECLDPTTCISGN------CVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCE-----------LCPPVN-----------TSEYKIL----CPGGEGFRPNPITVILEDIDECQELPGLCQGGK-CINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYM----QVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVC-ENGVCINMVGSFRCECPVGFFYNDKLLVC-EDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQE---IPNICSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDACG-NGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLDPRKCAPGTCQNLDGSYRCICPPGY---------SLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCL----------CPDGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGY-ILQGNECVD---------TDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPAGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGTYLCICGPGYQRRPDGEGCVDENE---CQTKPGICEN--GRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCFTEVLQN-----MCQIGS-SNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMT--NGADIDECKVIHDVCRNGECVNDRGS-YHCI--------CKTGY--TPDITGTACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDG---RSCKDLDECATKQHNCQFLCVNTIGSFTCKCPPGFTQH-HTACIDNNECTSDINLCGSKGICQNTPGSF-TCECQRGFSLD---------PSGASCEDVDECEGNHRC 2577          

HSP 3 Score: 210.305 bits (534), Expect = 2.682e-52
Identity = 547/2220 (24.64%), Postives = 793/2220 (35.72%), Query Frame = 0
Query:  125 GYCTNTLGSFFCSCNEGYEGD-GFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGD-GKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDG--CVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGY--NGDGRFACEPVKVRTTCSSDFDCTNNAQCLP-------NGSCACRKGFQPNGVLCQ-------------------------DIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDP---CLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIG--------NAVCFNGACNCQEPYVGPNCEDACRDATCFP----NSQCLVQNGLPFCQCLPGFKLSPNGRSCIDI-----------DECAGNPCGQ---DAICENLLGSFVCK----------------CPKGTNGDPLSGCRGESTFECTQD-----SQCDQGE---SCLSSRCVCRRGYERNP-AGDCVDLNECLLG-NVCGVNSVCKNLPGSYDCECPSGF----------------QGNPFT----SCQSCSGS-SCSCLPPYQDIEGRCQLADCSNCEAPA------KCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECL----QGKCICSPPFFVDT-----LDGNHCK---SPCHRFSCGFNAECTPSNPPQCLCKAGFTGNP-LTGCEDLDECALNP--CKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLC----NQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCL---------------EQGQTC--QGGRC--ITQCGQEQCGVNAFC--DPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECG----------TNSHCIYGNPNSCACNIGY-FGNPYTGC---------------------EVTTSVEDCDS------LKCGDNAVCSFASGKPECTCKRGYDGIPYER-CQDVDECLF-SVCGKNAQCINTPGGYDCRCHSDFVG-NPFEGCVHL-EAVTEDDDLCANQQCGPNAICNLGQCLCASGFK-GDDPNDLVEGCSSAATCQTNTDCGYNEICSTI-AHSGHRFCSDPCQQA-QCGPNSFCITDNHQKSCICQDGFT--------GDANDPQRG--CQREEKCSTNE-----DCPAGRTCHINFNGEQTCLDPCQIMSCP---TNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEV---------SFGMKNCVPACDLVNCPSG-------AECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSC---------QPACSYLE--------CGVGAVCVVRNHVGKCICPQGLFVGNP--QIEGCRKVSC---VENEDCPDNEFCDRLSYTCMDPCQNEICGEN-ALCTV---AGHQHKCQCPPSFIPSPTPEVL-CEKNDRGDLCPFGQCQTTCASSS-QCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFENLCQCPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCL----KLCHTDKNCLQGEI-CVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMT--QSGCSDLNEC--KNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYC---------TPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGY--QLIGSNCQDIDECASG-NPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYS 2056
            G C  T GS+ C CN+G++ D    C D+DEC+     N C    EC N    Y C+C+PG++    + ECRDIDECL N     N  CINT G+F C C  GFH    DG  C D+DEC      +   C N  G+++C C  G                                  Q +S+G  C               DINEC++  +   G    C+N    YRCEC  G     DGR  C    +R+TC   +      QC+           C C       G  CQ                         DI+EC    + C  N IC N+ G Y+C C +        + C D     L         C+       C C +G+ Y P+  +  C DIDEC+ S        +N +C NSPGSF C C+     DP                   + +C   +     Q    G+ + +      K + C S     G        + +C  G    +    G  CED   +   FP    N  C+   G   CQC  G  L   GR C+DI           +EC     G+   DA C ++  ++  +                CP+G          G+  F+   +     + C  G+   +  S +C C  G+  +    +C D++EC +  ++CG    C N PG ++C+C  G+                Q +P       C +  GS  C C P +Q         D + CE  A      +CV + G    CAC  GY   P    C DIDEC  +     G    C N+ GS+ CSC PG    P Q SC  +   C  N    +  +C     + +C+C   F         +D N C    + C   +C             C C  G++G    TGC D++EC +    C + ++C N   +++C C PG  GD           ++C   DEC                +  C  +A+C     +  C CK G+  D    C  L     N  +CG N QC+ +P G  C+C  G V +        +  CS  + C+               E G      GG C  + +C      ++  C   P   +C C   F  +PT V    T+   C  +            +N   +  +  SC C++G  +G P   C                      +T  +ED D       L  G   + +F  G  +C C  GY      R C DV+EC    +CG    C NT G Y C C  D++  N    C+ +  ++   +    NQ C    + N+ + +C   +  G   N   E C   +T +  T CG       I  ++G     D C++      N  CI       C C  GF          D ++ Q G  CQR  +C         DC  G      F     C D  +    P   ++ +C+ + G   CLC++GF+ N     C     C  D+ C  G   N +          F + +     D+  C +G        +C++      C+C  GY   PD R+   I   N+C  +        C+  +G   C            C  ++        C +G  C       KC+CP G  + +   + +  R   C    E   C   +  +     C    + E  G+   LC        +  C      I  P    +  ++    D+C  GQC  T  S   +CP G I +   C         C  G  C  G C+         N +   E    C C EGF   P     C  I          +  C N Y   EC          +C  G  L    ++C  +  C +G+  C +K  E  C+      L         C C PGY+      GC D NEC  K  IC  G+ C NT GSY C C      D   A  + D+C  +++       L +         +P   S C              C      AF    P  RG  TN   G    E       C +G C  +  +  C C+ GY   + G+ C D++EC     PC+    C N +GSYQC+C  G +     + CK   +C +
Sbjct:  463 GRCIPTPGSYRCECNKGFQLDLRGECIDVDECE----KNPCA-GGECINTQGSYTCQCRPGYQSTLTRTECRDIDECLQNGRICNNGRCINTDGSFHCVCNAGFHVT-RDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGF---------------------------------QLASDGRYCK--------------DINECETPGICMNGR---CVNTDGSYRCECFPGLAVGLDGR-VCVDTHMRSTCYGGY---KRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPSQNSAEYQALCSSGPGITSAGSDINECALDPDIC-PNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNGQCRNTPGSFVCTCPKGFIYKPELKT--CEDIDECESSPC------INGVCKNSPGSFICECSSESTLDP------------------TKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTPCQVDPICGKGYSRIK----GTQCEDI-DECEVFPGVCKNGLCVNSKGSFKCQCPSGMTLDATGRICLDIRLETCFLRYEDEECTLPVAGRHRMDACCCSVGAAWGTEECEECPVRNTPEYEELCPRGPGFATKEITNGKRFFKDINECKMIPNLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCG-RGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCLNTEGSYRCECPPGHQLAPNISACIDINECELSAHLCPHGRCVNLIGKYQ-CACNPGYHSTPDRLFCVDIDECSIMNG---GCETFCTNSEGSYECSCQPGFALMPDQRSCTDI-DECEDNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCE-----NTKGSFICHCDMGYSGKKGKTGCTDINECEIGAHNCDRHAVCTNTAGSFKCSCSPGWIGD----------GIKCTDLDECSN-------------GTHMCSQHADCKNTMGSYRCLCKEGYTGDGF-TCTDLDECSENLNLCG-NGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPPVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTF--GSFQCRCPTGYYLNEDTRVCDDVNECETPGICGP-GTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPG----YRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDA-CGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDI---NECLLDPRKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALG-TCSNTEGSFKCLCPDGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILQGNECV----DTDECSVGNPCGNGTCK---------NVIGGFE----CTCEEGFE--PGPMMTCEDINECAQNPLLCAFRCVNTYGSYEC----------KCPAGYVLREDRRMCKDEDECEEGKHDCAEKQME--CKNLIGTYL---------CICGPGYQRRPDGEGCVDENECQTKPGICENGR-CLNTRGSYTCEC-----NDGFTASPNQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTN---GADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCN--FICKNTEGSYQCSCPKGYILQEDGRSCKDLDECAT 2491          

HSP 4 Score: 60.077 bits (144), Expect = 8.506e-7
Identity = 244/986 (24.75%), Postives = 347/986 (35.19%), Query Frame = 0
Query: 2348 NALCQVIERQAFCVCQRGFIPNPSPVV-----ACTREPITCQGNKQCPE---NFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTA--------DKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGA-------NAECRTKNHQALCSCPEGMEGNPIEHCQPTLVPCSSASDCPQS-KTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQAGLVCIDRQ--CVGGCSSNTQCPSESVCVEG--------KCQDPCQNEASVC------GECATCTTQNHQLQ---CQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCISG--CGSNRDCPYGEMCEGGQCRNPCNGFECE--------PNSFCQ-VN--GRNPLCLCDRGYQRLASGGC----AKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPC-ATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGT---SCP-------DGKSCQVLNH--------QALCI--------------------------CTKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLD-SCVKEESC-GTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFI-QCQPVEETPKDACQPSPCGS-KANCNI---NDENQAICSCWEGYF 3221
            N +C  +     C C  GF  N   +V      C   P+ CQ N +C     ++ CD   CKP     S  + N+    +    +C S  QC          C  G +++ D T           AC N  C             G I++H  D   V  C         N +C        C C EG E        P    C   ++C    + C+ GTC     L G      +C  G  +Q    N +C+    C++    C  G  SNT+   + +C +G        +CQD      S C      G+C++  ++NH  Q   C       GDP + C T            GSG+       A   +   EC   + C  G C     I +D     EC  G  + G  C    +C  G  C  G C+N   GFEC         P   C+ +N   +NPL    R      S  C              C  +  CE G+  + C+E     K  EC+       C+C  G+      E  VD N+C       EN +CLN  G + C C  G T  P Q  +C   ++         N C + GS  +  + K     + C C    G  P         C+  P     +  + C        N     GA +D C   H    N  C+  R    C CK     +  G          C+  ++C       +  C+N  +G+   SCP       DG+SC+ L+         Q LC+                          CT D   I+ CG + IC+   G+  CEC  G   DP   SC   + C G   C     CQ + G   C C  G++  Y  +  CV+  ++ C  +     A+C   L   KC+CP G   + F   CQ + E          CGS +A C+    N E   +C+C  GYF
Sbjct: 1779 NGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPV-CQRNAECINTAGSYRCD---CKPGYRFTSTGQCNDRNECQEIPNIC-SHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCINTVGSFQCQCNEGYE------VAPDGRTCVDINECLLDPRKCAPGTCQ---NLDGS--YRCICPPGYSLQ----NDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPDGFSLSSTGRRCQDL---RMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMD---ECKEPDVCKHGQC-----INTDGSYRCECPFGYILQGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPAGYVLREDRRMCKDEDECEEGK--HDCAE-----KQMECKNLIGTYLCICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQD-ECLDNREGYCFTEVLQNMCQI-GSSNRNPVTK-----SECCCDGGRGWGPH--------CEICPFQGTVAFKKLCPHGRGFMTN-----GADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITG--------TACVDLNECNQAPKPCNFICKNT-EGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGSFTCKCPPGFTQHHTACIDNNECTSD---INLCGSKGICQNTPGSFTCECQRGFSLDPSGASCEDVDECEGNHRC--QHGCQNIIGGYRCSCPQGYLQHYQWNQ-CVD--ENECLSAHICGGASCHNTLGSYKCMCPAGFQYEQFSGGCQDINE----------CGSAQAPCSYGCSNTEGGYLCACPPGYF 2679          
BLAST of GH13743 vs. SwissProt
Match: gi|1042782301|sp|Q61554.2|FBN1_MOUSE (RecName: Full=Fibrillin-1; Contains: RecName: Full=Asprosin; Flags: Precursor)

HSP 1 Score: 249.595 bits (636), Expect = 3.507e-64
Identity = 516/1988 (25.96%), Postives = 748/1988 (37.63%), Query Frame = 0
Query:  106 KGCDMPDTNECKYRPCD-VFGYCTNTLGSFFCSCNEGYEGD--GFHCKDI-----------DECQIPELANTCVQNAECCNLPAHY------------------VCKCKPGFEG----DGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHD-GCVDIDECRTNP--CGIGAKCTNLLGNYQCQCPAGL-SGDPYQGAC----QAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKIS-CVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCT-NNAQCL-----PNGS--CACRKGF--QPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPC---LEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNG----ACNCQEPYV----GPNCEDACRDATCFPN----SQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLS-GCRGESTFECTQDSQ--CDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVN-SVCKNLPGS-YDCECPSG--FQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEEC--------LQGKCICSPPFFVDTLDGNHCKSPCHR----FSCGFNAECTPSNPPQCLCKAGFTGNPLTGC-EDLDECALNP--CKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNC--VSLCNQV--ICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFC--DPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYG-NPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFS--VCGKNAQCINTPGGYDCRCHSDF-VGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEIC-----STIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTC---LDPCQIMSCP-TNE----------KCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQG-HSCNEVSFGMKN------CVPACDLVNCPSGAECVSEGH------------------RGYCRCLPGYSGNP------DDRSGCMIFS---QNKC----SSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVG-KCICP--QGLFVGNPQIEGCRKVSCV-ENEDCPDNEFCDRLSYTC-----------------MDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEV---LCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFENL-CQCPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGG--------QCSCQPG--YEMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRS 1899
            KG    D NEC+  P     G C N+ GSF C C  G   D  G  C DI           +EC +P +A     +A CC++ A +                  +C   PGF      +GK   +DI+EC        +  C NT G+F C C  GF  +  +  C DIDECR +P  CG G +C N  G+++C+C  G  SG      C    + Q  P + + G          +C  +     C C  G    P IS C+DINEC+ S+   C  G  C+N    Y+C C  GY+        P   R  C    +C+  N  C       +GS  C+C+ GF   P+   C DIDEC+   N C     C N+PG+Y C C    + +   + C D     L  N     +C+  K    C C+ G  Y+ K+  +GC DI+EC+        CG +A+C+N+ GSF C C+ G+ GD  I C D+DEC+    +C + A C N +GSY C C +G  Y     +C +    C  +    GN  C N      C C   +V    G  CED   D    PN      C    GL  C+C  G++L  +G +C D++EC          C N  GS+ C CP     +P   GC    +  C  D +   D G++  S+      G   + A  C     C LG   G    +C ++  S Y   CP G  F+ NP T            +   Q++ G CQ   C N          T G   C CP GY +N  T+ C+D++EC+  G   CG G  C N  G+++C CPP         +C+ +R +    +   +N+ C         +  C CS         G     PC +     +  F   C    P       GF  +  TG   D+DEC   P  C+ G +CIN + +++CECP G   +         K + C   DEC               +   C  NA C+    +  C CK G+   S G C   + C ++  IC S+ QCI +     C C  G   N               + CL+          I +C ++ CG N  C       +C C  GF+      C+   + A  +     N  C+       C CN GY   P     V  +    D  KC     C    G   C C  GY  +  ++C+D+DEC+    +C     C NT G + C C   F + +    C  L            +   P +  N  +  C    KG+   D  E       C T  D  + +IC       +         D C++     +  CI  +    C C  G+  + N+    C   ++CS    C  G   ++    E TC    +P  +M+C   NE          +C+ + G   C C  G+         +  + C  + +CA+G H C E     KN      C+        P G  C+ E                       C C  G++ +P      D+R G   FS   QN C    S+     +SE C   +G R   P C         +C     V  K +CP  +G       I+ C+ +  V  N +C +    DR SY C                 ++ C       N +C      ++C CP  +I          L E   +   C F    T    + +CPPG              +T C +   C +          CG   +C     +  C+C  GF+ +  +   C  +                     EC  + +C  G  C N +    C   +  LQ       +    C  +++C    VCG           +C C  G  YE    GC D+NEC ++       C+NT G Y+C CP        G C S
Sbjct:  906 KGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICLDIRLETCFLKYDDEECTLP-IAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCGRG-QCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGG----------ICHNTEGSYRCECPPGHQLSPNISACIDINECELSANL-CPHGR-CVNLIGKYQCACNPGYH--------PTHDRLFCVDIDECSIMNGGCETFCTNSDGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQ-CTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMG--YSGKKGKTGCTDINECEIGAH---NCGRHAVCTNTAGSFKCSCSPGWIGDG-IKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKDG--YTGDGFTCTDLDE-CSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDI--DECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEI----GVGVSKASCC-----CSLGKAWGTPCELCPSVNTSEYKILCPGGEGFRPNPITVILED-------IDECQELPGLCQGGKCIN----------TFGSFQCRCPTGYYLNEDTRVCDDVNECETPG--ICGPGT-CYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNI------GRAWNKPCEQCPIPSTDEFATLCGSQRP-------GFVIDIYTGLPVDIDECREIPGVCENG-VCINMVGSFRCECPVGFFYN--------DKLLVCEDIDECQ--------------NGPVCQRNAECINTAGSYRCDCKPGYRLTSTGQCNDRNECQEIPNIC-SHGQCIDTVGSFYCLCHTGFKTN------------VDQTMCLD----------INECERDACG-NGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDINECVLDPGKCAP-GTCQNLDGSYRCICPPGYS-LQNDKCEDIDECVEEPEICAL-GTCSNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSR-NHSKQECCCALKGEGWGDPCE------LCPTEPDEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGYILEGNE----CVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLR------EDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREG-YCFSEVLQNMCQIGSSNRNPVTKSECC--CDGGRGWGPHCE--------ICPFEGTVAYKKLCPHGRGFMTNGADIDECKVIHDVCRNGECVN----DRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFT----------QHHTACIDNNECTSD------INLCGSKGVCQNTPGSFTCECQRGFS-LDQSGASCEDVD--------------------ECEGNHRCQHG--CQNIIGGYRCSCPQGYLQ------HYQWNQCVDENECLSAHVCGGASCHNTLGSYKCMCPTGFQYEQFSGGCQDINECGSSQAPCSYGCSNTEGGYLCGCPPGYFRIGQGHCVS 2690          

HSP 2 Score: 230.72 bits (587), Expect = 2.215e-58
Identity = 386/1405 (27.47%), Postives = 540/1405 (38.43%), Query Frame = 0
Query:   87 CQHGACLDSQ----CYCNDGYGGK----GCDMPDTNECKY--RPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTN-QVCGINTLCINTHGNFSCECLPGFHGNPH-DGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDP-KISCVDI-------------NECQSSSLYQCGVGAI------CINQSPGYRCE-CPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPN--GVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRD--PCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDE-------------CDKSI--SPTGKC---------GVNAICSNSP----GSFNCVCAK---GFNGDPYIGC-FDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGA----CNCQEPYVGP-----NCEDACRDATCFPN----SQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGE---SCLSSRCVCRRGYERNPAG-DCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCG--SGADCLNNPGSFSCSCPPGQG-GDP-----------FQGSCLPLRS--------ACSSNSQCRENEECLQGKCI-------CSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNP------------PQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLAC---IGS-QCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTC------QCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCIT-QCGQEQCGVNAFCDPNRLSCTCQSGFLG-----DPTLVCMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGY----DGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEIC 1344
            C  G C +++    C+C+ GY GK    GC   D NEC+     C     CTNT GSF CSC+ G+ GDG  C D+DEC      + C Q+A+C N    Y C CK G+ GDG   C D+DEC  N  +CG N  C+N  G + CEC  GF  +     C DIDEC      +   C NL G ++C+C  G   D   G C   V   +    C + +      C  +     C C   F  +P ++ CVD              +   ++   + GVG         + ++ G  CE CP+    + +  C                      P G     +GF+PN   V+ +DIDECQ     C     C+N  G ++C+C          + C D   C         +C        CIC     Y      + C+D+               CD  +  + T K            N  C   P      F  +C     GF  D Y G   DIDEC E   +C    +C N VGS+ C+C  G  Y+   L C E    CQ+   C  NA C N A    C+C+  Y        N  + C++    PN     QC+   G  +C C  GFK + +   C+DI+EC  + CG +  C N +GSF C+C  G      + C           + C  G+   +  S +C C  GYE  P G  CVD+NEC+L         C+NL GSY C CP G+         S     C  +    +    C L  CSN E   KC+          CP G+ ++   + C+D+           G  S     N+     C    G+G GDP           F+  C P  S        +     +C+E + C  G+CI       C  PF    L+GN C             EC+  NP             +C C+ GF   P+  CED++ECA NP      C+N   +Y+C+CP G         C        G  D    Q+ C   IG+  CI             C+ EN    C+ K G  E+  G C++      C  N     SP+   C       CF  ++ N      C + S S+ +P  +    C GGR     C  E C         +L C    GF+      D   V     +  EC ++ G+  HCI        C  GY   P         + +C+      N +C    G  +C+C +GY    DG     C+D+DEC          C+NT GG+ C+C   F  +    C+     T D +LC ++    N   +   C C  GF  D          S A+C+   +C  N  C
Sbjct: 1293 CLSGTCENTKGSFICHCDMGYSGKKGKTGC--TDINECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECS--NGTHMCSQHADCKNTMGSYRCLCKDGYTGDG-FTCTDLDECSENLNLCG-NGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNC-TDVNECLDPTTCISGN------CVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPSVNTSEYKILC----------------------PGG-----EGFRPNPITVILEDIDECQELPGLCQGGK-CINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPP--DYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVC-ENGVCINMVGSFRCECPVGFFYNDKLLVC-EDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTGQCNDRNECQE---IPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDINECERDACG-NGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDINECVLDPGKCAPGTCQNLDGSYRCICPPGY---------SLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCL----------CPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQIC-PFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGY-ILEGNECVD---------TDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENE---CQTKPGICEN--GRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQN-----MCQIGS-SNRNPVTKSECCCDGGRGWGPHC--EICPFEGTVAYKKL-CPHGRGFMTNGADIDECKVIHDVCRNGECVNDRGS-YHCI--------CKTGY--TPDITGTACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQEDG---RSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQH-HTACIDNNECTSDINLCGSKGVCQNTPGSF-TCECQRGFSLD---------QSGASCEDVDECEGNHRC 2579          

HSP 3 Score: 196.052 bits (497), Expect = 6.348e-48
Identity = 323/1194 (27.05%), Postives = 447/1194 (37.44%), Query Frame = 0
Query:  125 GYCTNTLGSFFCSCNEGYEGD-GFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGD-GKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDG--CVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGY--NGDGRFACEPVKVRTTCSSDFDCTNNAQCLP-------NGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIG-CFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPF------CQCLP----GFKLSPNGRSCIDIDECAGNP-CGQDAICENLLGSFVCKCPKGTNGDPLS----GCRGESTFECTQDSQCD---QGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNP-LTGCEDLDECAL--NPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFA-EDSQGNCVSL----CNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSE-CGTNSHCI-YGNPNSCACNIGYFGNPYTGCEVTTSVEDCD--SLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECL--FSVCGKNAQCINTPGGYDCRCHSDFV 1272
            G C  T GS+ C CN+G++ D    C D+DEC+     N C    EC N    Y C C+ G++    + ECRDIDECL N     N  CINT G+F C C  GFH    DG  C D+DEC      +   C N  G+++C C  G                                  Q +S+G  C               DINEC++  +   G    C+N    YRCEC  G     DGR  C    +R+TC   +      QC+           C C       G  CQ      S E      ++C + PG           GT   +   DP +  N      C+ ++    CIC  G  Y        C+DI+EC   +  +  C  N  C N+PGSF C C KGF   P +  C DIDEC  +  I G   +C N  GS+ C+C      DP+   C E  +                    C +  +   CE     AT    S+C    G  +      CQ  P    GF     G  C DI+EC   P   ++ +C N  GSF C+CP G   D         R E+ F    D +C     G   + + C C  G     A    +  EC L N      +C   PG    +  +   G PF        + C  +P        C    C N          T G   C C  G+ ++   +NC DIDEC+ I    CG G  C+N PG F C C  G     ++   + +++       C + +EC +   +C                 CH     +  EC P          G   +P ++ C D++EC L  N C  G  C+N +  YQC C PG                        H +L C+    I+ CS +  G    C   + +  C C+ GFA    Q +C  +     N  IC    QC   P    C C++G + +        + +C   + C      C  G C    G                C C  G+ G           + E  +  CG ++ C        C+C+ G+ G+        T +++C   +  C  +A C    G   C CK GY G  +  C D+DEC    ++CG N QC+N PGGY C C   FV
Sbjct:  465 GRCIPTPGSYRCECNKGFQLDIRGECIDVDECE----KNPCT-GGECINNQGSYTCHCRAGYQSTLTRTECRDIDECLQNGRICNNGRCINTDGSFHCVCNAGFHVT-RDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGF---------------------------------QLASDGRYCK--------------DINECETPGICMNGR---CVNTDGSYRCECFPGLAVGLDGR-VCVDTHMRSTCYGGY---RRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAE----YQALCSSGPG-------MTSAGTDINECALDPDICPN----GICENLRGTYKCICNSG--YEVDITGKNCVDINEC---VLNSLLCD-NGQCRNTPGSFVCTCPKGFVYKPDLKTCEDIDECESSPCING---VCKNSPGSFICECSPESTLDPTKTICIETIKG------------------TCWQTVIDGRCEININGATL--KSECCSSLGAAWGSPCTICQLDPICGKGFS-RIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICLDIRLETCFLKYDDEECTLPIAGRHRMDA-CCCSVG----AAWGTEECEECPLRNSREYEELCPRGPGFATKDITN---GKPFFK----DINECKMIPSL------CTHGKCRN----------TIGSFKCRCDSGFALDSEERNCTDIDECR-ISPDLCGRG-QCVNTPGDFECKCDEG-----YESGFMMMKN-------CMDIDECQRDPLLCRGGI-------------CHNTEGSYRCECPP----------GHQLSPNISACIDINECELSANLCPHGR-CVNLIGKYQCACNPGY--------------------HPTHDRLFCVD---IDECSIMNGGCETFCTNSDGSYECSCQPGFALMPDQRSCTDIDECEDNPNIC-DGGQCTNIPGEYRCLCYDGFMASE------DMKTCVDVNECDLNPNICLSGTCENTKGS-------------FICHCDMGYSGKKGKTGCTDINECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIGDGIK----CTDLDECSNGTHMCSQHADCKNTMGSYRCLCKDGYTGDGF-TCTDLDECSENLNLCG-NGQCLNAPGGYRCECDMGFV 1438          

HSP 4 Score: 183.726 bits (465), Expect = 2.998e-44
Identity = 294/1161 (25.32%), Postives = 421/1161 (36.26%), Query Frame = 0
Query:  208 NTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGF--TGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNC---GQRASC------QIVKSEAFCICEEGW---------AYNPKE----------ISSGCLDIDEC--DKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPY-IGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRC--VCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSC------SCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYC-------------ACPRG-----YEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCREN-EECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGN--PLTGCEDLDECALNPCK-QGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNS-CACNIGYFGNP-YTGCEVTTSVEDCD--SLKCGDNAVCSFASGKPECTCKRGY--DGIPYERCQDVDECL--FSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQC 1297
            N  CI T G++ CEC  GF  +    C+D+DEC  NPC  G +C N  G+Y C C AG     YQ          + +   N + C  N  C  +     C C  GF  T D K +C D++EC   S+    +  +CIN+   ++C C  G+                                           +G  C+DI+EC+ T   C  N  C+N  G Y C+C   L      + C D  +   C    +R  C       + KSE  C   E           A N  E          ++S   DI+EC  D  I P      N IC N  G++ C+C  G+  D     C DI+EC  N  +C     C N  GS+ C C  G  Y P   +C++                                  D C  + C  N  C    G   C+C P   L P    CI   E     C Q  I          +C    NG  L         EC        G  C   +   +C +G+ R     C D+NEC +      N +C N  GS+ CECP+G   +        +G  C      +C   Y D E    +A     +A    V    G   C              CPRG      ++       +DI+EC+ I  + C  G  C N  GSF C C  G   D  + +C  +        +CR + + C +G+C+ +P  F                              +C C  G+      +  C D+DEC  +P   +G IC N   +Y+CECPPG    P  + C      E  A+   HG       +C+N      C  N      +   +C              +  C+ +  G    C  S     C C  G    P         SC+    C +    C GG+C                P    C C  GF+    +       + + +     +  C     +  C C++GY G    TGC   T + +C+  +  CG +AVC+  +G  +C+C  G+  DGI   +C D+DEC     +C ++A C NT G Y C C   + G+ F  C  L+  +E+ +LC N QC
Sbjct:  464 NGRCIPTPGSYRCECNKGFQLDIRGECIDVDECEKNPC-TGGECINNQGSYTCHCRAG-----YQSTLTRTECRDIDECLQNGRIC-NNGRCINTDGSFHCVCNAGFHVTRDGK-NCEDMDEC---SIRNMCLNGMCINEDGSFKCICKPGFQ---------------------------------------LASDGRYCKDINECE-TPGIC-MNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGTDINECALDPDICP------NGICENLRGTYKCICNSGYEVDITGKNCVDINECVLNSLLC-DNGQCRNTPGSFVCTCPKGFVYKPDLKTCEDI---------------------------------DECESSPCI-NGVCKNSPGSFICECSPESTLDPTKTICI---ETIKGTCWQTVI--------DGRCEININGATLKS-------ECCSSLGAAWGSPCTICQLDPICGKGFSRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDA-------TGRICLDIRLETCFLKYDDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDITNGKPFFKDINECKMI-PSLCTHGK-CRNTIGSFKCRCDSGFALDSEERNCTDI-------DECRISPDLCGRGQCVNTPGDF------------------------------ECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGICHNTEGSYRCECPPGHQLSPNISACIDINECELSANLCPHG-------RCVNLIGKYQCACNPGYHPTHDRLFCV------------DIDECSIMNGGCETFCTNSDGSYECSCQPGFALMP------DQRSCTDIDECEDNPNICDGGQCTNI-------------PGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGC---TDINECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIGDGI---KCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKDGYTGDGFT-CTDLDECSENLNLCGNGQC 1422          
BLAST of GH13743 vs. SwissProt
Match: gi|238054385|sp|P35556.3|FBN2_HUMAN (RecName: Full=Fibrillin-2; Contains: RecName: Full=Fibrillin-2 C-terminal peptide; Flags: Precursor)

HSP 1 Score: 244.202 bits (622), Expect = 1.665e-62
Identity = 397/1439 (27.59%), Postives = 554/1439 (38.50%), Query Frame = 0
Query:  112 DTNECKYRPCD-VFGYCTNTLGSFFCSCNEGYEGDG--FHCKDIDECQI-PELANTCVQNAECCNLPAHYVCKCKPGFEGDGKV--ECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNP-HDGCVDIDECRT--NPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPK-ISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGY----------------------------NGDGRFACE-----PVKVRTTCSSDFD--------CTNNAQCL---PNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLE-VNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIG-CFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKR---------------RSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCI--DIDECAGNP-CGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLG-NVCGVNSVCKNLPGSYDCECPSGF-QGNPFTSC---------QSCSGSSCSCLPPYQDIE---------GRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQG----KCICSPPFFVDT----LDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNP-LTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLA--CIGSQCINPCSSVPCGSN---------ANCVAENH------------------AAWCRCKSGFAEDSQGNCVSLC------NQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSG---FLGDPTLVCMPPTQQA-----------------------ECSSECG--TNSHCIYGNPN-SCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDF-VGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQ 1382
            D NECK  P    +G C NT+GSF C CN G+  D    +C DIDEC+I P+L  + +    C N P  + C+C  G+E    +   C DIDEC  N +      C+NT G+F C+C  G   +P  + CVDI+EC    N C  G KC N++G YQC C  G    P +  C       +   GC+ Q       C  S     C+C EG+   P   SC DI+EC+++       G  C N    YRC C  G+                            N  G F C       VK  TT  +D D        C  +A CL    +  C+CR+G+  NG+ C D+DEC +  + C  N+ C+N PG Y C C     G        D C E +N  +   C  V     C CE G  + P   S  C DIDEC    S    C V   C+N PG F+C+C  G+  D   G C DIDECA+   I     LC N  G Y C C    Q +P+ + C + R                SC ++   IG  V  +  C       G  CE      TC P     V +   +  C  G    PN  + I  DIDEC   P   Q   C N  GSF C+CP+G              +  ++D++                         C D++EC     VCG  + C N  G+Y C CP  + Q N   +C         +S +G++C    P+   +         G+     C  C  P      T     C    G+  +  T    DIDEC+ I    C +G  C+N  GSF C CP G   +     C  +    + ++ C+ N +C+      +C C+  F +      +D N C    +  S G   +   S   QC+C  GF  +   T C D+DEC  +PC  G+ C N + +Y C C PG            + + +C   DEC       C   +C N   S  C  N          NC+  N                   +  C C  G+   S+ NC+ +       N  + GS   C  +P G  C C  G V           LS  +   C +  Q+     C T     +C V    +  +  C C        GDP  +C    + A                       EC    G  +N  CI  + +  C C +GY  + YTG     + E      CG N  C+   G  EC C  G++  P   C+D++EC  +      +C+NT G Y+C C   + +    + C  L+   E    C ++      +     C+C  G     P+   EGC     C+T      N  C  I  S    C++  Q +  G       DN Q  C  +
Sbjct: 1073 DINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGI----CVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNG-KCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQ-------CTNSEGSYECSCSEGYALMPDGRSCADIDECENNP--DICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMG--FTPASDSRSCQDIDEC----SFQNIC-VFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADP--INCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTE---IGVGVSRSSCCCSLGKAWGNPCE------TCPP-----VNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQG--------------YYLSEDTRI------------------------CEDIDECFAHPGVCGPGT-CYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKT----ICGNIPGFTFDIHTGKAVDIDECKEIPGI-CANGV-CINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSY--QCICHNGFKASQDQTMCMDVDECERHPCGNGT-CKNTVGSYNCLCYPGF---------ELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSE-NCIDINECDEDPNICLFGS---CTNTPGGFQCLCPPGFV-----------LS-DNGRRCFDTRQS----FCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLD-YTGVRCVDTDECSIGNPCG-NGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGM-ARRPDG--EGCVDENECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECL---DNRQGLCFAE 2389          

HSP 2 Score: 197.978 bits (502), Expect = 1.536e-48
Identity = 393/1456 (26.99%), Postives = 538/1456 (36.95%), Query Frame = 0
Query:   82 TTGRHCQHGACLDS----QCYCNDGY----GGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYE--GDGFHCKDI---DECQIPELANTCVQ-------NAECC-------------------NLPAHYVCKCKPGFEGDGKVECRDIDEC------------------------------------------LTNQVCGINTLCINTHGNFSCECLPGF-HGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAG--LSG------DPYQGACQAQVAPS----------VSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGV--GAICINQSPGYRCECPAGYNGDGR-FACEPVKVRTTCSSDFDCTNNAQCLPNG----SCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYI--GCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGA----CNCQEPYVGPNCEDACRDA-TCFP-----NSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNP----CGQ-------------DAI--------------------------CENLLGSFVCKCPKGTN-GDPLSGCRGESTFECTQDSQCDQGESCL----SSRCVCRRGYERNPAGDCVDLNECLLG-NVCGVNSVCKNLPGSYDCECPSGFQGNPFT---------SCQSCSGSSCSCLPPYQDIE---GRCQLADCSNCEAPAKC----VQITG------GISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLP-------LRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQ----CLCKAGFTGNPLT-GCEDLDECALNPCK-QGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGS----QCINPCSSVPCGSNANCVAENHAAWCRCKSG--------FAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSA--SPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGF-LGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNS--CACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYE-RCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHL-EAVTEDDDLCANQQCGPNAICNLGQCLCASGFK 1315
            TT   C +G C++     +C C  G+     G+ C   D +EC+     + G+C N+ GSF C C  G     DG  C D      C        CV+        +ECC                   +   H +C    G   DG    RDI+EC                                          L N++   N LC NT G++SC C PG+      + C DI+EC +NPC  GA C N LG++ C+C  G  LS       D  +G C   +  S          +  + C        + C+R    L   C  G      ++C D+NEC+       GV     C+N    + CECP G   DG    C  +++   C   +D       +P      +C C  G            EC+    P       L   G         L G P  +   +            C+       C C  G+A + +E    C DIDEC   ISP   CG + IC N+PGSF C C +G+     +   C DIDEC  N  +C R   C N  GS+ C C  G +  PS   C +      SD  C  N  C N      C+C   Y        C D   C       ++QC    G   C C  G+ L P+GRSC DIDEC  NP     GQ             D                            CEN  GSF+C C  G +     +GC      E      CD   SCL    S +C CR G+  N    C+DL+EC  G + C +N+ C N PGSY C C  GF G+ FT         +   C    C  +P     E   G    +D  +C+   +C    + + G      G+ +C C  GYE++    NC DIDEC       C +G  C+N PG + C+CPP    +P    C+        L+     +     N E   G    S    +    GN C++            C P N  +    C    GF  NP+T   ED+DEC   P   QG  CIN   ++QCECP G      T  C      EC A     G   C  +     CI P   +      NC+    +   R  +G        F    +  C +    V    N  C   P+ P    F+ + GN  PG    + +  +     C E    C  G CI Q G                C C +GF   D  LVC    + +   + C  N+ CI  +P S  C C  G+  +P   C       +  ++    + +C    G  +C C  G+     +  C DVDEC    CG N  C NT G Y+C C+  F       C+ + E  +    +C N +C  N I +  +CLC  G++
Sbjct:  622 TTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYC--TDVDECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDG----RDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNPCVNGA-CRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCE--LDTACPRGLARIKGVTCEDVNECEVFP----GVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRME-QCYLKWDEDECIHPVPGKFRMDACCCAVGAAWG-------TECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEE--RNCTDIDEC--RISPD-LCG-SGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLC-RGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCR-NGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECE-IGAHNCDMHASCLNIPGSFKCSCREGWIGNGI-KCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECAD--PINCVNGL-CVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCET------------CPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDID--ECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTY--NVGKAWNKPCEPCPT-PGTADFKTICGN-IPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGS-------------FRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCI-NSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVC--SHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPCG-NGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRC-FNEIGSF-KCLCNEGYE 2006          

HSP 3 Score: 192.971 bits (489), Expect = 5.240e-47
Identity = 332/1254 (26.48%), Postives = 473/1254 (37.72%), Query Frame = 0
Query:  125 GYCTNTLGSFFCSCNEGYEGDG-FHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGD-GKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFH-GNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGF-TGDPKISCVDINECQSSSLYQCGVGAICINQSPG--YRCECPAGYNGDGRFA--CEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYI-GCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRR-SCQSDQECIGNAVCFNGA------CNCQEPYVGPNCEDACRDATC------------------------FPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDI-----------DECAGNPCGQ---DAICENLLGSFVCK---------------CPKGT----NGDPLSGC-RGESTFECTQ-DSQCDQGE---SCLSSRCVCRRGYERN-PAGDCVDLNECLLG-NVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSN----SQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFN------AECTPSNPP---QCLCKAGFTGN-PLTGCEDLDECALNP--CKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSL--CNQVI--CGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECS--SECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYD-GIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNP 1275
            G C  T+ S+ C CN GY+ D    C D+DEC     +N C  N +C N P  Y CKC  GF+    K  C DIDEC+ N V   N  C+NT G+F C C  GF        CVD DEC T    +   C N  G+++C C  G    P    C            C       N  C  S     C C  G   G     CVD +    S+ Y      +C+   PG   + EC    N D  F   C+P   +   S++F          +G C+   G   +G   +DI+EC    + C AN IC N+ G Y C C +   G  P+   R+                                      C+DIDEC   +     C  N +C N+PGS++C C  G+        C DI+EC  N  + G    C N +GS++C+C  G +   + L C +  + +C  + +     V  NGA      C       G  CE    D  C                         PN +C+   G   C+C  G  L   GR C+DI           DEC     G+   DA C  +  ++  +               CP+G      GD L+G    +   EC      C  G+   +  S +C C  G+  +    +C D++EC +  ++CG + +C N PGS++CEC  G++              C   P        C+   C N E          G   C CP G+E++P  ++C DI+EC ++    C +G  C+N  G++ CSC PG    P +  C  +      N    +QC  +E   +  C CS  + +   DG  C        C  N       +CT  N P   +CLC  GF  +  +  C D++EC LN   C  G  C N   ++ C C  G +    T GC+     E GA +                     C  +A+C+    +  C C+ G+  +    C+ L  C+     C  NAQC+ +P    C C EG  G+ +        +CS    C E    C+ G+C+               P    C C+ GF         P +    C    EC   + C++G                                      C+   G   C C  GY+       C D+DEC   +   N  C+NTPG Y+C C  DF  NP
Sbjct:  508 GRCIPTVSSYRCECNMGYKQDANGDCIDVDECT----SNPCT-NGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYC-------TDVDECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTH--MRSTCYGGIKKGVCVRPFPGAVTKSECCCA-NPDYGFGEPCQPCPAKN--SAEF----------HGLCSSGVGITVDG---RDINECALDPDIC-ANGICENLRGSYRCNCNS---GYEPDASGRN--------------------------------------CIDIDEC---LVNRLLCD-NGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNPCVNG---ACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCG-SGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLL------CRGGTCVNTE----------GSFQCDCPLGHELSPSREDCVDINEC-SLSDNLCRNGK-CVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYE--CSCSEGYAL-MPDGRSCADI---DECENNPDICDGGQCT--NIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGE-CENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHN---------------------CDMHASCLNIPGSFKCSCREGWIGNGI-KCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGF--------TCSDVDECAENINLCENGQCLNV-------------PGAYRCECEMGF--------TPASDSRSCQDIDECSFQNICVFG-------------------------------------TCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNP 1566          

HSP 4 Score: 191.815 bits (486), Expect = 1.069e-46
Identity = 368/1450 (25.38%), Postives = 523/1450 (36.07%), Query Frame = 0
Query:  222 CLPGFHGNPHDG-CVDIDECRTNPCGI--GAKCTNLLGNYQCQCPAGLSGDPYQGACQA----QVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAI---CINQSPG----YRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGD-----------YECQCIAPLV-GTPPEQPCRDPCLE-VNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYI-GCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQG-----------ESCLSSRCVCRR---GY--------ERNPAG-------------DCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCL-PLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCK-AGFTGNPLTGCEDLDECALNP--CKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVEC---GADDECHGQL--------------ACIGSQC------------------------------------INPCSSVPCG-SNANCVAENHAAWCRCKSGFAED-SQGNCVSL----CNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCI-YGNPNSCACNIGYFGNP-YTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYER-CQDVDECLFS--VCGKNAQCINTPGGYDCRCHSDFVGN-PFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNT-DCGYNEICSTIAHSGHRFCS-------------DPCQQA--QCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNED-CPAGR----------TCHINF---NGEQTC--LDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECV 1507
            C  GF  N   G C D+DEC+  P GI  G  C N +G+++C+CPAG         C+      + P + + G           C  +     C C  G+     ++  D + C       C  G +   C  + PG     +C C  G         E   VR +      C +    LP G      G +P G          +        +  + +PG                   P++ G        D C    N      C    S   C C  G+    ++ +  C+D+DEC      T     N  C N+PGS+ C C  GF   P    C DIDEC +N  +C +   C N  GS+ C C  G +            ++C    EC    +C NG                           C+ ++G   C C PGF L+PNGR C D+DEC       +  C N  GSF C CP G       G  G    +    S C  G            +   S C C     G+         +N A              D  D+NEC L      N +C+NL GSY C C SG++ +        SG +C  +         C    C N          T G   C CP GY     T+ CEDI+EC++    PC +GA C NN GSF+C C PG         C+  L+  C  N Q    E  + G  + S      TL G    SPC R  C  +  C     P+ L +  G T      CED++EC + P  C  G  C+N   ++ CECP G T D     C   +  +C     +DEC   +              A  G++C                                    IN C + P   +   C     +  CRC SGFA D  + NC  +     +  +CGS   C+ +P    C+CFEG     Y  G   + +C     C      C+GG C+   G  Q             C C  G    P+        +   S     N  C+       C+CN GY   P   GC   T +++C  +  G +  C+ + G  EC+C  GY  +P  R C D+DEC  +  +C    QC N PG Y C C+  F+ +   + C+ +     + ++C   +C       +  C C  G+          GC+    C+    +C  +  C  I  S    C              D C     QC  N+ C+       C C +GFTGD       C   ++C+ N + C  G+           C + F   +  ++C  +D C   +      C    GM  C+C+ G+E ++  G+C     C    +C  G   N       NC P  D    P+G  CV
Sbjct:  261 CRRGFIPNIRTGACQDVDECQAIP-GICQGGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGICETG----------ECSNTVGSYFCVCPRGY-----VTSTDGSRCIDQRTGMCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDG---LPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYK---QDANGDCIDVDEC------TSNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLC-KNGRCVNTDGSFQCICNAGFELTTDG-------KNCVDHDECTTTNMCLNG--------------------------MCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCINSEGSFRCDCPPGL----AVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDA-------SGRNCIDIDECLVNRLLCDNGLCRN----------TPGSYSCTCPPGYVFRTETETCEDINECES---NPCVNGA-CRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSE--CCATL-GAAWGSPCER--CELDTAC-----PRGLARIKGVT------CEDVNECEVFPGVCPNGR-CVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGI-CVNTPGSFECECFEG-----YESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQ-------------CDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGC---TDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDIC-DGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFI--CHCQLGYS---VKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFT----CSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPP--DFQLNPTGVGCV 1572          

HSP 5 Score: 184.496 bits (467), Expect = 2.068e-44
Identity = 325/1226 (26.51%), Postives = 445/1226 (36.30%), Query Frame = 0
Query:  194 RDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGF--TGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCG---QRASC------QIVKSEAFCI---------CEEGWAYNPKEISSGC----------LDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPY-IGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICE-NLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTS-CQSCSGSSC-------SCLPPYQD---------IEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNC------EDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCREN-EECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGN--PLTGCEDLDECALNPCK-QGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQG-NCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTL-VCMPPTQQAECSSECGTNSH-CIYG------NPNSCACNIGY-FGNPYTGCEVTTSVEDCD--SLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSV--CGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQC--GPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEIC 1344
            + ID C  +    +N  CI T  ++ CEC  G+  + +  C+D+DEC +NPC  G  C N  G+Y C+C AG    P + AC       + +   N   C +N  C  +     C C  GF  T D K +CVD +EC ++++    +  +CIN+   ++C C  G+                                          PNG  C D+DECQ T   C  N  C+N  G + C C   L      + C D  +   C    ++  C       + KSE  C          C+   A N  E    C           DI+EC  ++ P      N IC N  GS+ C C  G+  D     C DIDEC  NR +C    LC N  GSYSC C       P     + +  +C+   EC  N  C NGAC                              G   C+C PG KLS  G  CID  +       QD+ CE N+ G+ +    K      L    G     C  D+              C RG  R     C D+NEC +      N  C N  GS+ CECP G   +     C       C        C+ P              G     +C  C  P      T       CPRG     R          +DI+EC+A     C  G  C N  GSF C C  G   D  + +C  +        +CR + + C  G C+ +P  F                              +C C  G+      +  C D+DEC  NP   +G  C+N   ++QC+CP G    P    C      EC   D       C   +C+N   +  C  N    A               D QG   +  C  +  G + QC  S     C C EG    P         SC+    C      C GG+C                P    C C  GF+    +  C+         +EC  NS+ C++G          C C +GY      TGC   T V++C+  +  C  +A C    G  +C+C+ G+ G    +C D+DEC      C  NAQC+NTPG Y C C   F G+ F  C  ++   E+ +LC N QC   P A     +C C  GF            S + +CQ   +C +  IC
Sbjct:  493 QTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNPCTNG-DCVNTPGSYYCKCHAGFQRTPTKQAC-----IDIDECIQNGVLC-KNGRCVNTDGSFQCICNAGFELTTDGK-NCVDHDECTTTNMC---LNGMCINEDGSFKCICKPGFV---------------------------------------LAPNGRYCTDVDECQ-TPGIC-MNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINEC--ALDP--DICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLC-DNGLCRNTPGSYSCTC-------PPGYVFRTETETCEDINECESNP-CVNGACR--------------------------NNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATL----KSECCATLGAAWGSPCERCELDT-------------ACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYET------LCPRGAGFANRGDVLTGRPFYKDINECKAFPGM-CTYGK-CRNTIGSFKCRCNSGFALDMEERNCTDI-------DECRISPDLCGSGICVNTPGSF------------------------------ECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDIN--ECSLSDN-----LCRNGKCVNMIGTYQCSCNPGYQA-------------TPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMP------DGRSCADIDECENNPDICDGGQCTNI-------------PGEYRCLCYDGFMASMDMKTCID-------VNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGC---TDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGI-KCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFT-CSDVDECAENINLCENGQCLNVPGAY----RCECEMGFT---------PASDSRSCQDIDECSFQNIC 1501          

HSP 6 Score: 143.665 bits (361), Expect = 4.133e-32
Identity = 164/589 (27.84%), Postives = 235/589 (39.90%), Query Frame = 0
Query:  150 KDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGD-GKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPK-ISCVDINECQSSSLYQCGV--GAICINQSPGYRCECPAGYNGDG---------RFACEPVKVRTTC---SSDFDCTNNAQC----------------LPNGSCACRK------GFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPC--RDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNG--------ACNCQEPYVGPNCEDACRDATCFPN------SQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAG--NPCGQDAICENLLGSFVCKCPKG 682
            +D++EC   E    C  N +C N    + C+C  G+  D   V C D DEC     CG N  C N  G+F C C  GF   P   C DI+EC  NP     +C N  G+Y+C CP G +    Q  C+     +     C ++      +C+      +C C  G    P    CVD NEC++      G+     C+N    YRCEC  G+             +  C    ++T C   SS  +    ++C                LP G+   +K      G+  +G   +DIDEC+   N C  N  C+N  G + C C            C   D C +        C+  +    C C  G+    +E    C D+DEC      T +     +C N+ G F C C  GF    +  C D +EC     +CG + +C N  GS+SC+C  G   D + L+C++         EC GN  C +G         C C + Y+     + C D     N      + C    G   C C  GF       +C D++EC+   NPC  +  C N  G ++C CP G
Sbjct: 2170 EDVNECL--ESPGIC-SNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCG-NGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRG----MMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKP----GICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPLP-GTAQYKKICPHGPGYTTDG---RDIDECKVMPNLC-TNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPCNYICKNTEGSYQCSCPRGYVL--QEDGKTCKDLDECQ-----TKQHNCQFLCVNTLGGFTCKCPPGFT-QHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDV-------DECDGNHRCQHGCQNILGGYRCGCPQGYIQHYQWNQCVDENECSNPNACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPC--NYGCSNTEGGYLCGCPPG 2724          

HSP 7 Score: 83.5741 bits (205), Expect = 6.976e-14
Identity = 140/494 (28.34%), Postives = 194/494 (39.27%), Query Frame = 0
Query: 1823 EPGCRTDSDCRLG-EVCGAG--------GQCSCQPGYE---MTQSGCSDLNECKNN-ICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALAC-LADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCG-HGSCHPEDHAPKCHCQDGYQLI--GSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRC---------------------VDPCD---GFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKC-ELLECVENA-DCDASKSCLNN----KC---------------VDACQLSGICGLNSRCRMSNHGPVCSCNSGHT--GDPRECEQNLDCPGDGKCDNFVCVK-PHEKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGN-SKVECV 2250
            E  C    +CR+  ++CG+G         +C C  GYE   M    C D++EC+ N +   G TC NT GS+ C CP        G   SP    S +DC D   C L+D+L    KC+              N+I     CSC P ++  P   + GC  ++  C     G    C   + + +C C +GY L+  G +C DIDEC +     +  +CTN  G Y+C C+DG +     + C    +C  NS       C+N +                      VD C+     C + A C+    S KCSC   W GN  IKC +L EC      C  +  C+N     +C               VD C  +     N +C        C C  G T   D R C+   +C     C    C   P    C+ D     D+        D C  P  C VN LC +   +  C+CPP F  N + V CV
Sbjct: 1110 ERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPL-------GHELSP----SREDCVDINECSLSDNLCRNGKCV--------------NMIGTYQ-CSCNPGYQATPD--RQGCTDID-ECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGN-GIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINC-VNGLCVNTPGRYECNCPPDFQLNPTGVGCV 1572          
BLAST of GH13743 vs. SwissProt
Match: gi|384872684|sp|Q01705.3|NOTC1_MOUSE (RecName: Full=Neurogenic locus notch homolog protein 1; Short=Notch 1; AltName: Full=Motch A; AltName: Full=mT14; AltName: Full=p300; Contains: RecName: Full=Notch 1 extracellular truncation; Short=NEXT; Contains: RecName: Full=Notch 1 intracellular domain; Short=NICD; Flags: Precursor)

HSP 1 Score: 226.868 bits (577), Expect = 2.912e-57
Identity = 391/1450 (26.97%), Postives = 550/1450 (37.93%), Query Frame = 0
Query:   89 HGACLDSQCYCNDGYGGKGCDMPDTNECKYRPCDVFGYC-TNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECR-DIDECLTN-QVCGINTLCINTHGNF---------------------------------------SCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDP-YQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVK--VRTTCSSDFDCTNNAQCLPNGS--CACRKGFQPNGVLC-QDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNG--GQY--------DP-----------------------SSLSCQEKRRSCQSDQECIGNAVCFNG----ACNCQEPYVGPNCEDACRDATCFP--NSQCLVQNGLPFCQCLPGFKLSPNGRSC-IDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQG---ESCLSSRCVCRRGYERNPAGDC-VDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQG----------------NPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSN--CEAPAKCVQITGGISY-CACPRGYEMNPRTKNCE-DIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPS-NPPQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTG---DPYTNGCSGSKSVECGADDECHGQLACI------GSQC---INPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQG----QTCQ-GGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLG----DPTLVCMPPTQQAECSSECGTNSHCI-YGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSV--------CGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEG-----CSSAATCQTNTDCGYNEICSTIAHSGHRFCSD---PCQQAQCGPNSFCITDNHQKSCICQDGFTG 1387
            HG  +D  C C  G+ G  C  P  N C   PC   G C   TL  + C C  G+ G    C+  D C     +N C    +C    + Y+C+C PGF G     CR D++EC  N  +C     C N  G++                                        C CLPGF G   +   ++D+C  N C  G  C + +  Y C+CP   +G    +   + Q+ P+  Q G           C  +  G  C C  G+TG+      +I++C S++ +Q   GA C ++   + CECP G  G     C      +   C+   +C  N     NG   C C  G+   G  C QD+DEC    NPC     CLN  G +ECQC+    G   E    + C+   C   A+C     E  CIC  G+     EI++     DEC  S      C  N  C +    F C C KGFNG  ++  +D+DECA     C   A C +   +Y+C C  G  G +        DP                       +   C+     C S Q C     C +      C C +   GPNCE    D    P  +  CL +     C C PG+     G  C ++IDECAG+PC     CE+ +  F C+CP+G + DP   C  E   EC  +  C  G   +     +C C  G+      +C ++ NEC   N C     CK++   Y C C  GF G                N  T     +G  C+C  PY        LA C+   C+    C +     S+ C CP G++     + CE DI+EC     +PC  GA C N  GS+ C C  G  G          R+  S    CR N                          PCH         CT   N   C C  GF G      ED++ECA NPC+ G+ C + + +Y C CP G  G   +  T  C+ S     G   +      C+      GS C   +N C S PC     C        C C  G+   +  N V  C+   C +  +C  + +   C+C  G     + G +C +LS S      ++G      CQ GG C+ +              ++  C CQ+G+ G    D    C P        + C   + C  Y    SC C  GY G+       +  + +C S  C +   C   +   +C+C RG  G+  E   +VD+C   +        C  N  C++  GGY C C   FVG   EG V+ E ++   D    Q C      N   C C +G  G     ++ G     C +   C   ++     IC   A      C +    C   +C     CI+     +C+C   FTG
Sbjct:   79 HGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKS--CQQADPCA----SNPCANGGQCLPFESSYICRCPPGFHGP---TCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCE--ENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNG---------GTCHNTHGGYNCVCVNGWTGED--CSENIDDCASAACFQ---GATCHDRVASFYCECPHGRTG---LLCHLNDACISNPCNEGSNCDTNPV---NGKAICTCPSGY--TGPACSQDVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNE-CISNPCQNDATCLDQIGEFQCICMPGYEGVYCEINT-----DECASS-----PCLHNGHCMDKINEFQCQCPKGFNG--HLCQYDVDECASTP--CKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCQPGYTGHHCETNINECHS-QPCRHGGTCQDRDNSYLCLCLKGTTGPNCEINLDDCASNPCDSGTCLDKIDGYECACEPGY----TGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYH-DPT--CLSEVN-ECNSNP-CIHGACRDGLNGYKCDCAPGWS---GTNCDINNNEC-ESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQ----GQTCEVDINECVK---SPCRHGASCQNTNGSYRCLCQAGYTG----------RNCESDIDDCRPN--------------------------PCHN-----GGSCTDGINTAFCDCLPGFQGAFCE--EDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNTQYHCECRSG-----WTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDE-------------GDKHYCHCQAGYTGSYCEDEVDECSP--------NPCQNGATCTDYLGGFSCKCVAGYHGS-----NCSEEINECLSQPCQNGGTCIDLTNSYKCSCPRGTQGVHCEI--NVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVN-ECLSNPCDPRGTQNCVQRV--NDFHCECRAGHTGRRCESVINGCRGKPCKNGGVCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTG 1380          

HSP 2 Score: 119.013 bits (297), Expect = 1.106e-24
Identity = 175/660 (26.52%), Postives = 255/660 (38.64%), Query Frame = 0
Query:   89 HGACLDS----QCYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNT--LGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECR-DIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSG-------------------------DPYQGACQAQVAPSVSQQG---CNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVD-INECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDG----RFACEPVKVRTTCSSDFDCTNNAQCLPNGS---CACRKGFQPNGVLCQD-IDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTG---KCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGA-------CNCQEPYVGPNCED---ACRDATCFPNSQCLVQNGLPFCQCLPGFK----LSPNGRSCIDIDECAGNPCGQDAICENLLGS--FVCKCPKGTNG 685
             G C+D     +C C   Y G  C++     C   PC   G C  +    SF C C  G++G      DI+EC    + + C   A C N    Y C C+ G+ G     C  DID+C  N  C     C +      C+CLPGF G   +   DI+EC +NPC  GA CT+ + +Y C CP G +G                         + +   C      S  Q     C+++ C     CQ S     CTC +G+TG   ++C + +  C S+    C  G  C   +  Y CEC +G+ G        +CE    +        C +   C+  G    C C+ G+   G  C+D +DEC  + NPC   + C +  G + C+C+A   G+   +   + CL   C    +C  + +   C C  G      EI     ++D+C   + P     KC  N  C +  G + C C  GF G+   G  D++EC  N         C  +V  + C+C  G     +   C+     C+  + C    VC   +       C C   + G  CE+    C    C     C+     P C CL  F       P    C+       NPC     CE    +  + C CP   NG
Sbjct:  803 QGTCIDDVAGYKCNCPLPYTGATCEVV-LAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEV-DINEC----VKSPCRHGASCQNTNGSYRCLCQAGYTGR---NCESDIDDCRPNP-CHNGGSCTDGINTAFCDCLPGFQGAFCE--EDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTG---LNCQNLVRWCDSAP---CKNGGRCWQTNTQYHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHYCHCQAGY--TGSYCEDEVDEC--SPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINE-CLSQPCQNGGTCIDLTNSYKCSCPRGTQGVHCEI-----NVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEG--DVNECLSNPCDPRGTQNCVQRVNDFHCECRAGH----TGRRCESVINGCRG-KPCKNGGVCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTGPECQFPASSPCV-----GSNPCYNQGTCEPTSENPFYRCLCPAKFNG 1422          

HSP 3 Score: 113.235 bits (282), Expect = 6.842e-23
Identity = 318/1167 (27.25%), Postives = 441/1167 (37.79%), Query Frame = 0
Query:  501 PTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGS--YSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGA-----------CNCQEPYVGPNCE--DACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCI-DIDECAGNP--CGQDAICENLLGSFVCKCPKGTNGDPL----------------SGCR--GESTFECT-----------------QDSQCDQGESCL----SSRCVCRRGYERNPAGDCVDLNECLLG-NVCGVNSVCKNLPGSYDCECPSGFQGNP----FTSCQSCS---GSSCS-------CLPPYQDIEGRCQLADC--SN-CEAPAKC-VQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECL----QGKCICSPPFFVDTLDGNHCK---SPCHRFSCGFNAECTPS-NPPQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTG----------DPYTNGCSGSKSVECGADDECHGQLACIGSQC---INPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSN----AQCIVSPSGPTCQCFEGMVGNPYPGGHCSL-LSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYG-NPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQ-DVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQ------CLCASGFKGD----DPNDLVEG-CSSAATCQTNTDCGYNEICSTIAHSGHRFCS---DPCQQAQCGPNSFCITDNHQKSCICQDGFTG-----DAND-PQRGCQREEKCSTNEDCPAGRTCH--INFNG---EQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSD-CAQGHSCNEVSFGM--------------KNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSG 1523
            P+G C     C  + G+  CVC+  F G     C D + C              +  G+  Y+C C  G    P  L+          D  C+ N  C NG            C C   + G +C+  D C    C    QCL       C+C PGF    +G +C  D++EC+ NP  C     C N +GS+ C C + T+  P                   CR  G++T EC                    + C  G +C+    +  C C   +      + VD  EC L  N C     C N  G Y+C C +G+ G         C S +   G++C        C  P+      C L D   SN C   + C      G + C CP GY   P     +D+DEC A+G  PC     CLN  GSF C C  G  G      C    + C SN  C+ +  CL    + +CIC P +     +G +C+     C    C  N  C    N  QC C  GF G+      D+DECA  PCK G+ C++   TY C C  G TG          DP  + C      +  A   C  Q    G  C   IN C S PC     C   +++  C C  G    +  NC    N   C SN      C+    G  C C  G     Y G  C++ +   + SPC   G TC+             G+  F      +C C  G+  DPT +    ++  EC+S    +  C  G N   C C  G+ G   T C++  +  +C+S  C +   C   +    CTC+ G+ G     CQ +++EC  + C     CI+   GY C C   + G   E  +           CA   C  + +C   +      C+C +G++G     D N+ V+  C   A+CQ NT+  Y  +C    ++G R C    D C+   C     C    +   C C  GF G     D N+     CQ    C+   DC    TC   + FNG   E    D C   SC     C+       CLC  GF     TGS   Y     DS  C  G +C + S+G               +N V  CD   C +G  C     + +C C  G++G
Sbjct:   27 PSGTCLNGGRCEVANGTEACVCSGAFVGQR---CQDSNPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFS-GPLCLT--------PLDNACLANP-CRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICRCPPGF----HGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCAC-RATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVD--ECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGY-TGPACS--QDVDEC-ALGANPCEHAGKCLNTLGSFECQCLQGYTGP----RCEIDVNECISNP-CQNDATCLDQIGEFQCICMPGY-----EGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQ--YDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDP--DPCHYGSCKDGVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCLKG---TTGPNCE--INLDDCASNPCDSGTCLDKIDGYECACEPG-----YTGSMCNVNIDECAGSPC-HNGGTCED------------GIAGF------TCRCPEGYH-DPTCL----SEVNECNSNPCIHGACRDGLNGYKCDCAPGWSG---TNCDINNN--ECESNPCVNGGTCKDMTSGYVCTCREGFSG---PNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLA---------PCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQ-NTNGSYRCLCQA-GYTG-RNCESDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANCT---DCVDSYTCTCPVGFNGIHCENNTPD-CTESSCFNGGTCVDGINSFTCLCPPGF-----TGSYCQYDVNECDSRPCLHGGTCQD-SYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNTQYHCECRSGWTG 1091          

HSP 4 Score: 74.3294 bits (181), Expect = 4.020e-11
Identity = 295/1230 (23.98%), Postives = 416/1230 (33.82%), Query Frame = 0
Query: 2804 NSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDC-LLPNQCGENAQCLNQLGGFDCVCRSGCTGDP-------------FQG-----------CQCPTPKDS--CRTKGACL-NPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQG-TSCPDGKSCQVLNHQALCI---------CTKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGF------------------------CGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCIVRGNR------------------EVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVN---NC---GEGAQCQVV--------------------KHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCE-NVCGINALCHTKNHKVICVCPSNMQG----DPFDRCSPNPPEPLETDPCSACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAE-CSEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPC---PGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVG---DPQV-ECHKPPSGIVTEEIIDPCANR-ECGPYSQKVERNGICTCSCLPGYVG 3913
            N+C     C    +   C CP  + G   Q C  D ++C L+PN C     C N  GG++CVC +G TG+              FQG           C+CP  +    C    AC+ NPCN   +C        VN +A+C CP  Y                        TG  C +  +     EC  GA  +PC               H  KC       +N+ G   C     QCL     P     ++    NPCQ   +C D    Q+   Q +C+            D C+ SPC     C        C+CP+G  G      V E  C +T C     C +      C C  G+   +       E   D C P PC  + +C   +    C+C PG  G     C    ET  + C   PC     C   D N  +C C +G  G       P C+ + D  +   C++  C D   G+                        C  G +CE      TCRC EGY  DP   C+ +         + +C  N        C  G C D      GLN          +C C PG+ G     C +  N                    VC+C+ G+ G  PNC+       +C  +    +G C+D       NC     GA C+VV                         C CP G  G   + C++ +       C  SPC   A C+      +C C  G+ G        C +D              ID C  N C     C    +   C C    QG    +  + C+ NP           C   A+C     D   C+CP  + G       P+C T + C +   C+       C+   G     C   ++ C   PC     C+ +  G   C C   Y G          + + C N  +C +      C    G  G N +     + S  C     QK     +L   +  L VD  +      +H   C C  G+ G              E+EV  C PNPC + A C +     SC+C+  Y G    +C  E  +N        CLS     PC++   C       ++  +  +CSC     G   +  V +CH P         +DP +   +C      V++ G  TC+C PG+VG
Sbjct:  264 NNCKNGGACVDGVNTYNCRCPPEWTG---QYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNP----VNGKAICTCPSGY------------------------TGPACSQDVD-----ECALGA--NPC--------------EHAGKC-------LNTLGSFEC-----QCLQGYTGPRCEIDVNECISNPCQNDATCLD----QIGEFQCICMPGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDE--CASTPCKNGAKCLDGPNTYTCVCTEGYTGTH------CEVDIDECDPDPC-HYGSCKDGVATFTCLCQPGYTGH---HC----ETNINECHSQPCRHGGTCQDRD-NSYLCLCLKGTTG-------PNCEINLDDCASNPCDSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYH-DP--TCLSE---------VNECNSNP-------CIHGACRD------GLNG--------YKCDCAPGWSGT---NCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSG--PNCQTNI---NECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQG---QTCEVDI-----NECVKSPCRHGASCQNTNGSYRCLCQAGYTGR------NCESD--------------IDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNP-----------CQNGANC-TDCVDSYTCTCPVGFNGIHCENNTPDC-TESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSY-GTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNTQYHCECRSGWTGVNCD-----VLSVSC-EVAAQKRGIDVTLLCQHGGLCVDEGD------KH--YCHCQAGYTG-----------SYCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGS---NCSEE--INE-------CLSQ----PCQNGGTC-------IDLTNSYKCSCPRGTQGVHCEINVDDCHPP---------LDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVG 1261          

HSP 5 Score: 67.781 bits (164), Expect = 4.070e-9
Identity = 291/1184 (24.58%), Postives = 411/1184 (34.71%), Query Frame = 0
Query: 1926 CLDPCD----ISYCTPLATCNVIQHKAF-CSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGS-CHPEDHAPKCHCQDGYQLIGSNC-QDIDECASGNP--CHNSAKCTNEQGSYQCTCHDGMVGD----PYT----QGCKPKAQCYSNSECSSDTRCQNGRC-------VDPCDGF-CGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLECVENADCDASKSCLNNKCVDACQLS-GICGLNSRCRMSNHGPVCSCNSGHTGDPRECEQNLDCPGDGKC----------DNFVCVKPHEKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSN-CPGSMQCHKSICMHQCQ------------SHNDCAINERCDEGKCL----------------LTCGVDND------CFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQ---DPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEAN-ELCHGKICKEVCRSDSQCQSKE-----ICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVT---NRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGME------------GNPIEH-------------CQPTLV--------------PCSSASDCPQSK-----TCSQGTCVAQCQLQ-GDCLQNEVCNEGLCVQ-----ICN-----SNTQCQAGLV-CIDRQC--VGGCSSNTQCPSES-VCVEGKCQDPCQ---NE--ASVCGECATCTTQNHQLQCQCPRGTSGDPYQS----CRTNYLRCGSTKNQCGSGLN-----CHRGLCAKSCE------ASAECNCGESCHE-----------GFCLQQCQ------IASDCQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCR---NPCNGFECEPNSFCQVNGRNPLCLCDRGYQRL----ASGGCAKTECTTNGQCSRDKS---CE---GGRCINLCSESNSCGKNAECR------MNNHRAQCV---------CPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSC 2902
            CL P D     + C    TC+++    + C CPP + G        C Q + PC    C +G  C P + +  C C  G+   G  C QD++EC S NP  C +   C NE GSY+C C     G     PY       C+    C    + + +  C  G         VD C G  C  G  CV   ++  C C P W G          C E+              VD CQL    C     C  ++ G  C C +G TG+  +C +N+D      C           +F C  PH ++ L+   C+ +  C      +PC + + C  N +    N + +C+CP G+TG +   C +    C L +N C  + +C  ++   +CQ              N+C  N   ++  CL                + C ++ D      C     C+DK+ +  C  PK          H CQ   D C +  C   A C        CVC  G+      V     +P  C     C +        C+P  +    CE N   CH     + CR    CQ ++     +C   +    C  + D  A   C +  C+ +    +       TGS+     D C+ S C     C        C CPEG               NP  H             C P                 PC +   C         TC +G     CQ    +C  N   N+G C+       CN     +   C+  L  C    C   G C  +    S S VC  G     C+   NE   S C   A+C   N   +C C  G +G   +S    CR N    G +   C  G+N     C  G     CE      AS  C  G +C +           GF    C+        S C NG  C++G+    C     CP G    G  C+   N C+   C     CQ +     C C +GY  L        C    C   G+C +  +   CE   G   +N    S SC   A+ R      +  H   CV         C +G+ G+  +    D  D   PN C   A C + LGGF C C +G     + G  C    + C ++     PC   G+C
Sbjct:   98 CLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGK------SCQQAD-PCASNPCANGGQCLPFESSYICRCPPGFH--GPTCRQDVNEC-SQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQ--------YCTED--------------VDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGE--DCSENIDDCASAACFQGATCHDRVASFYCECPHGRTGLL---CHLNDAC----ISNPCNEGSNCDTNPV----NGKAICTCPSGYTGPA---CSQDVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPK------GFNGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCH-YGSCKDGVATFTCLCQPG-YTGHHCETNINECH----SQPCRHGGTCQDRDNSYLCLCLKGTTGPNCEINLDDCASNPCDSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQNTNGSYRCLCQAGYTGRNCESDIDDCRPNPCHNGGS---CTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTC----LCPPGFT--GSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNTQYHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHYCHCQAGYTGSYCE----DEVDECSPNPCQNGATCTDYLGGFSCKCVAG-----YHGSNCSEEINECLSQ-----PCQNGGTC 1198          

HSP 6 Score: 60.077 bits (144), Expect = 6.869e-7
Identity = 368/1610 (22.86%), Postives = 528/1610 (32.80%), Query Frame = 0
Query: 2803 SNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCL-LPNQCGENAQCLNQLGGFD--CVCRSGCTGDPFQGCQCPTPKDSCRTKGACL-NPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQN------------PCQGTSCPDGKSCQV---LNHQALCIC---------TKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDACQPSPCGSKANCNINDEN-QAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGAS-------CEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRN-QDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYY-----------------QCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNN-CGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSH-KICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGD----PFDRCSPNP------PEPLETDPC--------SACGINAD-CDVRP-------NDQV---ICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDP--------CIGTCGVNAECSEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTE--DSACPNHLKCVRE----KCVDPCPGICGRNAECKHTNMSSAQCAHF----QGQKLASFSSL---RRANNPLIVDLLNILGHVMRHNP---------MCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAV-CNVNNNHHARCSCLNDYV---GDPQVECHKPP--SGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGN---------PLIGCNKGPTGTITAEERDPCETCGQHAICHIHNNIAACKCEDNYIDKPPNCRRECVLHEDCPKHLACIQYKCAS------------PCINQ-CGKNADCSVINHDPICRCLPQYFGDPLVKCE--PPKVSQPIDPCLPNP-CGENTEHRKAGSNCICTCLPGFYGDPYTGCNYECL------------------IHDDCPYNRACASNHRCS---NPCIG----NCGVQAICNVIEHNAICSCPEELEGDPFIRCIPAGCRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEG 4241
            S +C     C + N    CVC   F G   Q    D N CL  P +       ++  G  D  C C  G     F G  C TP D+     ACL NPC   G+C                         D+L  T++ C+  P      +G+ C ++  C+ N     G C+   +++ C    RC    H P C    R  +N      C Q    C +   C + +     AC+             PC  + C +G +C+      H+  C+            D C  + C +   C        C CP    G      V E      AC     C   +G   C C+ G+  +      C E  DD C  + C   A C   +    C CP G  G   + C        DAC  +PC   +NC+ N  N +AIC+C  GY G       P C  D D                   C +GA+       C        C+C +GY G                   P+C+ +  +C S    +D  C+D              Q  + QC C PG++G   Y                  C+ + N   C C  G+ G              C YD        VD C +  C  GA+C    +   C C +G TG     C++ +       C P PC   + CK   A   C C PG+ G            H C ++   CH + C             C  +++  +C+C     G       D C+ NP       + ++   C        S C +N D C   P        D +    C CP+ Y         P CL+  +  +   C+   C D           G  G N + +   + C+ NPC     C+   +G  +C C+  + G  PNC+    E   + C N   C+ +    KC  P P   G   E      +++ C +     + +   SFS +           VD+   +    RH            C C  G+ G              E+++  C PNPC +   C +   +  C C+  + G        EC  N  C  G  C    C D        G N + C  N       SC N      G     C  PP  +G   +  ++ C +R C       +  G   C+C  GY G   +CQ +                  V  C    C +   C+  + Q  CEC  G+ G           +    +G   T+  +    C   G    CH         CED   +  PN    C     C  +L     KC +             C++Q C     C  + +   C C P+  G   V CE        P+DP   +P C  N           CTC PGF G+   G   ECL                   H +C   RA  +  RC    N C G    N GV A+ +      IC CP   EG        A C +D+    +  C++                 C +     TC+CL  F G
Sbjct:   28 SGTCLNGGRCEVANGTEACVCSGAFVGQRCQ----DSNPCLSTPCKNAGTCHVVDHGGTVDYACSCPLG-----FSGPLCLTPLDN-----ACLANPCRNGGTC-------------------------DLLTLTEYKCRCPPGW----SGKSCQQADPCASNPCANGGQCLPFESSYIC----RCPPGFHGPTC----RQDVNE-----CSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGE-----DCSENIDD-CASAACFQGATCHDRVASFYCECPHGRTG---LLCH-----LNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTG-------PACSQDVD------------------ECALGANPCEHAGKCLNTLGSFECQCLQGYTG-------------------PRCEIDVNECISNPCQNDATCLD--------------QIGEFQCICMPGYEG--VYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNG------------HLCQYD--------VDECASTPCKNGAKCLDGPNTYTCVCTEGYTGT---HCEVDI-----DECDPDPCHYGS-CKDGVATFTCLCQPGYTG------------HHCETNINECHSQPCRH--------GGTCQDRDNSYLCLCLKGTTGPNCEINLDDCASNPCDSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYH-------DPTCLSEVNECNSNPCIHGACRDGLNGYKCDCAPGWSGTNCDINN--NECESNPCVNGGTCKDMTSGY-VCTCREGFSG--PNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLP-YTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQNTNGSYRCLCQAGYTG-----------RNCESDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNP-CQNGANCT--DCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGL--NCQNL------------------VRWCDSAPCKNGGRCWQTNTQYHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHYCHCQAGYTGSYCEDEVDECSPN---PCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNSYKCSC-PR--GTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCEC---RAGHTGRRCESVINGCRGKPCKNGGVCAVASNTARGFICRCPAGFEG--------ATCENDARTCGSLRCLN--------------GGTCISGPRSPTCLCLGSFTG 1380          
BLAST of GH13743 vs. SwissProt
Match: gi|550544298|sp|Q07008.3|NOTC1_RAT (RecName: Full=Neurogenic locus notch homolog protein 1; Short=Notch 1; Contains: RecName: Full=Notch 1 extracellular truncation; Short=NEXT; Contains: RecName: Full=Notch 1 intracellular domain; Short=NICD; Flags: Precursor)

HSP 1 Score: 225.328 bits (573), Expect = 7.334e-57
Identity = 392/1451 (27.02%), Postives = 550/1451 (37.90%), Query Frame = 0
Query:   89 HGACLDSQCYCNDGYGGKGCDMPDTNECKYRPCDVFGYC-TNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECR-DIDECLTN-QVCGINTLCINTHGNF---------------------------------------SCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDP-YQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVK--VRTTCSSDFDCTNNAQCLPNGS--CACRKGFQPNGVLC-QDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEI------SSGCL---------------------------DIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGC-FDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNG----ACNCQEPYVGPNCEDACRDATCFP--NSQCLVQNGLPFCQCLPGFKLSPNGRSC-IDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQG---ESCLSSRCVCRRGYERNPAGDC-VDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQG----------------NPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSN--CEAPAKCVQITGGISY-CACPRGYEMNPRTKNCE-DIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPS-NPPQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTG---DPYTNGCSGSKSVECGADDECHGQLACI------GSQC---INPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQG----QTCQ-GGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLG----DPTLVCMPPTQQAECSSECGTNSHCI-YGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSV--------CGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEG-----CSSAATCQTNTDCGYNEICSTIAHSGHRFCSD---PCQQAQCGPNSFCITDNHQKSCICQDGFTG 1387
            HG  +D  C C  G+ G  C  P  N C   PC   G C   TL  + C C  G+ G    C+  D C     +N C    +C    + Y+C C PGF G     CR D++EC  N  +C     C N  G++                                        C CLPGF G   +   ++D+C  N C  G  C + +  Y C+CP   +G    +   + Q+ P+  Q G           C  S  G  C C  G+TG+      +I++C S++ +Q   GA C ++   + CECP G  G     C      +   C+   +C  N     NG   C C  G+   G  C QD+DEC    NPC     CLN  G +ECQC+    G   E    + C+   C   A+C     E  CIC  G+     EI      SS CL                           D+DEC  +      C   A C + P ++ CVC +G+ G     C  DIDEC  +    G   LC + V +++C C  G     +   C+     C S Q C     C +      C C +   GPNCE    D    P  +  CL +     C C PG+     G  C ++IDECAG+PC     CE+ +  F C+CP+G + DP   C  E   EC  +  C  G   +     +C C  G+      +C ++ NEC   N C     CK++   Y C C  GF G                N  T     +G  C+C  PY        LA C+   C+    C +     S+ C CP G++     + CE DI+EC     +PC  GA C N  GS+ C C  G  G          R+  S    CR N                          PCH         CT   N   C C  GF G      ED++ECA NPC+ G+ C + + +Y C CP G  G   +  T  C+ S     G   +      C+      GS C   +N C S PC     C        C C  G+   +  N V  C+   C +  +C  + +   C+C  G     + G +C +LS S      ++G      CQ GG C+ +              ++  C CQ+G+ G    D    C P        + C   + C  Y    SC C  GY G+       +  + +C S  C +   C   +   +C+C RG  G+  E   +VD+C   +        C  N  C++  GGY C C   FVG   EG V+ E ++   D    Q C      N   C C +G  G     ++ G     C +   C   ++     IC   A      C +    C   +C     CI+     +C+C   FTG
Sbjct:   79 HGGIVDYACSCPLGFSGPLCLTPLANACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKS--CQQADPCA----SNPCANGGQCLPFESSYICGCPPGFHGP---TCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCE--ENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNG---------GTCHNSHGGYNCVCVNGWTGED--CSENIDDCASAACFQ---GATCHDRVASFYCECPHGRTG---LLCHLNDACISNPCNEGSNCDTNPV---NGKAICTCPSGY--TGPACSQDVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNE-CISNPCQNDATCLDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGRCVDKINEFLCQCPKGFSGHLCQYDVDECAST-----PCKNGAKCLDGPNTYTCVCTEGYTG---THCEVDIDECDPDPCHYG---LCKDGVATFTCLCQPGY----TGHHCETNINECHS-QPCRHGGTCQDRDNYYLCLCLKGTTGPNCEINLDDCASNPCDSGTCLDKIDGYECACEPGY----TGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYH-DPT--CLSEVN-ECNSNP-CIHGACRDGLNGYKCDCAPGWS---GTNCDINNNEC-ESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQ----GQTCEIDINECVK---SPCRHGASCQNTNGSYRCLCQAGYTG----------RNCESDIDDCRPN--------------------------PCHN-----GGSCTDGVNAAFCDCLPGFQGAFCE--EDINECASNPCQNGANCTDCVDSYTCTCPTGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGKCWQTNTQYHCECRSG-----WTGFNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDE-------------EDKHYCHCQAGYTGSYCEDEVDECSP--------NPCQNGATCTDYLGGFSCKCVAGYHGS-----NCSEEINECLSQPCQNGGTCIDLTNTYKCSCPRGTQGVHCEI--NVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVN-ECLSNPCDPRGTQNCVQRV--NDFHCECRAGHTGRRCESVINGCRGKPCRNGGVCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTG 1380          

HSP 2 Score: 116.316 bits (290), Expect = 7.357e-24
Identity = 175/660 (26.52%), Postives = 254/660 (38.48%), Query Frame = 0
Query:   89 HGACLDS----QCYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNT--LGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECR-DIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSG-------------------------DPYQGACQAQVAPSVSQQG---CNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVD-INECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDG----RFACEPVKVRTTCSSDFDCTNNAQCL---PNGSCACRKGFQPNGVLCQD-IDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTG---KCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGA-------CNCQEPYVGPNCED---ACRDATCFPNSQCLVQNGLPFCQCLPGFK----LSPNGRSCIDIDECAGNPCGQDAICENLLGS--FVCKCPKGTNG 685
             G C+D     +C C   Y G  C++     C   PC   G C  +    SF C C  G++G      DI+EC    + + C   A C N    Y C C+ G+ G     C  DID+C  N  C     C +      C+CLPGF G   +   DI+EC +NPC  GA CT+ + +Y C CP G +G                         + +   C      S  Q     C+++ C     CQ S     CTC +G+TG   ++C + +  C S+    C  G  C   +  Y CEC +G+ G        +CE    +        C +   C+       C C+ G+   G  C+D +DEC  + NPC   + C +  G + C+C+A   G+   +   + CL   C    +C  + +   C C  G      EI     ++D+C   + P     KC  N  C +  G + C C  GF G+   G  D++EC  N         C  +V  + C+C  G     +   C+     C+  + C    VC   +       C C   + G  CE+    C    C     C+     P C CL  F       P    C+       NPC     CE    S  + C CP   NG
Sbjct:  803 QGTCIDDVAGYKCNCPLPYTGATCEVV-LAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEI-DINEC----VKSPCRHGASCQNTNGSYRCLCQAGYTGR---NCESDIDDCRPNP-CHNGGSCTDGVNAAFCDCLPGFQGAFCE--EDINECASNPCQNGANCTDCVDSYTCTCPTGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTG---LNCQNLVRWCDSAP---CKNGGKCWQTNTQYHCECRSGWTGFNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEEDKHYCHCQAGY--TGSYCEDEVDEC--SPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINE-CLSQPCQNGGTCIDLTNTYKCSCPRGTQGVHCEI-----NVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEG--DVNECLSNPCDPRGTQNCVQRVNDFHCECRAGH----TGRRCESVINGCRG-KPCRNGGVCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTGPECQFPASSPCV-----GSNPCYNQGTCEPTSESPFYRCLCPAKFNG 1422          

HSP 3 Score: 107.842 bits (268), Expect = 2.829e-21
Identity = 315/1177 (26.76%), Postives = 438/1177 (37.21%), Query Frame = 0
Query:  501 PTGKCGVNAICSNSPGSFNCVCAKGFNG----DPYI----------GCFDIDECAENRFICG-----REALCTNQVGS--YSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCE--DACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCI-DIDECAGNP--CGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESC-----LSSRCVCRRGY-----ERNP----------AGDCVD---------------------LNEC-LLGNVCGVNSVCKNLPGSYDCECPSGFQGNP----FTSCQSCS---GSSCS-------CLPPYQDIEGRCQLADC--SN-CEAPAKC-VQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECL----QGKCICSPPFFVDTLDGNHCK---SPCHRFSCGFNAECTPS-NPPQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTG----------DPYTNGCSGSKSVECGADDECHGQLACIGSQC---INPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSN----AQCIVSPSGPTCQCFEGMVGNPYPGGHCSL-LSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYG-NPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQ-DVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQ------CLCASGFKGD----DPNDLVEG-CSSAATCQTNTDCGYNEICSTIAHSGHRFCS---DPCQQAQCGPNSFCITDNHQKSCICQDGFTG-----DAND-PQRGCQREEKCSTNEDCPAGRTCH--INFNG---EQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSD-CAQGHSCNEVSFGM--------------KNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSG 1523
            P+G C     C  + G+  CVC+  F G    DP             C+ +D      + C         LC   + +   +  C NGG  D  +L+                        C C   + G +C+  D C    C    QCL       C C PGF    +G +C  D++EC+ NP  C     C N +GS+ C C + T+  P      E  +     S C  G +C      +  C C  G+     E N            G CVD                     ++EC L+ N C     C N  G Y+C C +G+ G         C S +   G++C        C  P+      C L D   SN C   + C      G + C CP GY   P     +D+DEC A+G  PC     CLN  GSF C C  G  G      C    + C SN  C+ +  CL    + +CIC P +     +G +C+     C    C  N  C    N   C C  GF+G+      D+DECA  PCK G+ C++   TY C C  G TG          DP  + C      +  A   C  Q    G  C   IN C S PC     C   ++   C C  G    +  NC    N   C SN      C+    G  C C  G     Y G  C++ +   + SPC   G TC+             G+  F      +C C  G+  DPT +    ++  EC+S    +  C  G N   C C  G+ G   T C++  +  +C+S  C +   C   +    CTC+ G+ G     CQ +++EC  + C     CI+   GY C C   + G   E  +           CA   C  + +C   +      C+C +G++G     D N+ V+  C   A+CQ NT+  Y  +C    ++G R C    D C+   C     C    +   C C  GF G     D N+     CQ    C+   DC    TC     FNG   E    D C   SC     C+       CLC  GF     TGS   Y     DS  C  G +C + S+G               +N V  CD   C +G +C     + +C C  G++G
Sbjct:   27 PSGTCLNGGRCEVANGTEACVCSGAFVGQRCQDPSPCLSTPCKNAGTCYVVDHGGIVDYACSCPLGFSGPLCLTPLANACLANPCRNGGTCDLLTLT---------------------EYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICGCPPGF----HGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCAC-RATHTGP----HCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNSHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGY-TGPACS--QDVDEC-ALGANPCEHAGKCLNTLGSFECQCLQGYTGP----RCEIDVNECISNP-CQNDATCLDQIGEFQCICMPGY-----EGVYCEINTDECASSPCLHNGRCVDKINEFLCQCPKGFSGHLCQ--YDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDP--DPCHYGLCKDGVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNYYLCLCLKG---TTGPNCE--INLDDCASNPCDSGTCLDKIDGYECACEPG-----YTGSMCNVNIDECAGSPC-HNGGTCED------------GIAGF------TCRCPEGY-HDPTCL----SEVNECNSNPCIHGACRDGLNGYKCDCAPGWSG---TNCDINNN--ECESNPCVNGGTCKDMTSGYVCTCREGFSG---PNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLA---------PCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEIDINECVKSPCRHGASCQ-NTNGSYRCLCQA-GYTG-RNCESDIDDCRPNPCHNGGSCTDGVNAAFCDCLPGFQGAFCEEDINECASNPCQNGANCT---DCVDSYTCTCPTGFNGIHCENNTPD-CTESSCFNGGTCVDGINSFTCLCPPGF-----TGSYCQYDVNECDSRPCLHGGTCQD-SYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGKCWQTNTQYHCECRSGWTG 1091          

HSP 4 Score: 77.0258 bits (188), Expect = 6.254e-12
Identity = 353/1461 (24.16%), Postives = 489/1461 (33.47%), Query Frame = 0
Query: 2604 VEGKCQDPCQNEASVCGECATCTTQNH----QLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASD-CQNGAECI--EGVCISGCGSNRDCPY------------GEMCEGGQCRNPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQC------SRDKSCEGGRCINLCSES------NSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDC-LLPNQCGENAQCLNQLGGFDCVCRSGCTGDP-------------FQG-----------CQCPTPKDS--CRTKGACL-NPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQG-TSCPDGKSCQVLNHQALCI---------CTKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGF------------------------CGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCIVRGNR------------------EVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVN---NC---GEGAQCQVV--------------------KHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCE-NVCGINALCHTKNHKVICVCPSNMQG----DPFDRCSPNPPEPLETDPCSACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAE-CSEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPC---PGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVG---DPQV-ECHKPPSGIVTEEIIDPCANR-ECGPYSQKVERNGICTCSCLPGYVG 3913
            V  +CQDP    ++ C    TC   +H       C CP G SG     C T  L      N C +G     G C        +C C        C Q    AS+ C NG +C+  E   I GC      P             G    GG C N    + C     C+     P C        L    C+ + C   G C      + + +C  G     C E+      N+C     C    +   C CP  + G   Q C  D ++C L+PN C     C N  GG++CVC +G TG+              FQG           C+CP  +    C    AC+ NPCN   +C        VN +A+C CP  Y                        TG  C +  +     EC  GA  +PC               H  KC       +N+ G   C     QCL     P     ++    NPCQ   +C D    Q+   Q +C+            D C+ SPC     C       +C+CP+G  G      V E  C +T C     C +      C C  G+   +       E   D C P PC  +  C   +    C+C PG  G     C    ET  + C   PC     C   D N  +C C +G  G       P C+ + D  +   C++  C D   G+                        C  G +CE      TCRC EGY  DP   C+ +         + +C  N        C  G C D      GLN          +C C PG+ G     C +  N                    VC+C+ G+ G  PNC+       +C  +    +G C+D       NC     GA C+VV                         C CP G  G   + C+I +       C  SPC   A C+      +C C  G+ G        C +D              ID C  N C     C    +   C C    QG    +  + C+ NP           C   A+C     D   C+CP  + G       P+C T + C +   C+       C+   G     C   ++ C   PC     C+ +  G   C C   Y G          + + C N  KC +      C    G  G N +     + S  C     QK     +L   +  L VD  +      +H   C C  G+ G              E+EV  C PNPC + A C +     SC+C+  Y G    +C  E  +N        CLS     PC++   C       ++  +  +CSC     G   +  V +CH P         +DP +   +C      V++ G  TC+C PG+VG
Sbjct:   53 VGQRCQDPSPCLSTPCKNAGTCYVVDHGGIVDYACSCPLGFSG---PLCLTP-LANACLANPCRNG-----GTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICGCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCA----CRATHTGPHC-------ELPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTG---QYCTEDVDECQLMPNACQNGGTCHNSHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNP----VNGKAICTCPSGY------------------------TGPACSQDVD-----ECALGA--NPC--------------EHAGKC-------LNTLGSFEC-----QCLQGYTGPRCEIDVNECISNPCQNDATCLD----QIGEFQCICMPGYEGVYCEINTDECASSPCLHNGRCVDKINEFLCQCPKGFSGHLCQYDVDE--CASTPCKNGAKCLDGPNTYTCVCTEGYTGTH------CEVDIDECDPDPC-HYGLCKDGVATFTCLCQPGYTGH---HC----ETNINECHSQPCRHGGTCQDRD-NYYLCLCLKGTTG-------PNCEINLDDCASNPCDSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYH-DP--TCLSE---------VNECNSNP-------CIHGACRD------GLNG--------YKCDCAPGWSGT---NCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSG--PNCQTNI---NECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQG---QTCEIDI-----NECVKSPCRHGASCQNTNGSYRCLCQAGYTGR------NCESD--------------IDDCRPNPCHNGGSCTDGVNAAFCDCLPGFQGAFCEEDINECASNP-----------CQNGANC-TDCVDSYTCTCPTGFNGIHCENNTPDC-TESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSY-GTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGKCWQTNTQYHCECRSGWTGFNCD-----VLSVSC-EVAAQKRGIDVTLLCQHGGLCVDEED------KH--YCHCQAGYTG-----------SYCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGS---NCSEE--INE-------CLSQ----PCQNGGTC-------IDLTNTYKCSCPRGTQGVHCEINVDDCHPP---------LDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVG 1261          

HSP 5 Score: 66.2402 bits (160), Expect = 9.730e-9
Identity = 284/1169 (24.29%), Postives = 406/1169 (34.73%), Query Frame = 0
Query: 1939 ATCNVIQHKAF-CSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGS-CHPEDHAPKCHCQDGYQLIGSNC-QDIDECASGNP--CHNSAKCTNEQGSYQCTCHDGMVGD----PYT----QGCKPKAQCYSNSECSSDTRCQNGRC-------VDPCDGF-CGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLECVENADCDASKSCLNNKCVDACQLS-GICGLNSRCRMSNHGPVCSCNSGHTGDPRECEQNLDCPGDGKC----------DNFVCVKPHEKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSN-CPGSMQCHKSICMHQCQ------------SHNDCAINERCDEGKCL----------------LTCGVDND------CFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQ---DPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEAN-ELCHGKICKEVCRSDSQCQSKE-----ICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVT---NRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGME------------GNPIEH-------------CQPTLV--------------PCSSASDCPQSK-----TCSQGTCVAQCQLQ-GDCLQNEVCNEGLCVQ-----ICN-----SNTQCQAGLV-CIDRQC--VGGCSSNTQCPSES-VCVEGKCQDPCQ---NE--ASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCE-----------------ASAECNCGESCHE-----------GFCLQQCQ------IASDCQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCR---NPCNGFECEPNSFCQVNGRNPLCLCDRGYQRL----ASGGCAKTECTTNGQCSRDKS---CE---GGRCINLCSESNSCGKNAECR------MNNHRAQCV---------CPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSC 2902
             TC+++    + C CPP + G        C Q + PC    C +G  C P + +  C C  G+   G  C QD++EC S NP  C +   C NE GSY+C C     G     PY       C+    C    + + +  C  G         VD C G  C  G  CV   ++  C C P W G          C E+              VD CQL    C     C  S+ G  C C +G TG+  +C +N+D      C           +F C  PH ++ L+   C+ +  C      +PC + + C  N +    N + +C+CP G+TG +   C +    C L +N C  + +C  ++   +CQ              N+C  N   ++  CL                + C ++ D      C     C+DK+ +  C  PK          H CQ   D C +  C   A C        CVC  G+      V     +P  C     C +        C+P  +    CE N   CH     + CR    CQ ++     +C   +    C  + D  A   C +  C+ +    +       TGS+     D C+ S C     C        C CPEG               NP  H             C P                 PC +   C         TC +G     CQ    +C  N   N+G C+       CN     +   C+  L  C    C   G C  +    S S VC  G     C+   NE   S C   A+C   N   +C C  G +G   ++C ++   C    N C +G +C  G+ A  C+                 AS  C  G +C +           GF    C+        S C NG  C++G+    C     CP G    G  C+   N C+   C     CQ +     C C +GY  L        C    C   G+C +  +   CE   G    N    S SC   A+ R      +  H   CV         C +G+ G+  +    D  D   PN C   A C + LGGF C C +G     + G  C    + C ++     PC   G+C
Sbjct:  115 GTCDLLTLTEYKCRCPPGWSGK------SCQQAD-PCASNPCANGGQCLPFESSYICGCPPGFH--GPTCRQDVNEC-SQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQ--------YCTED--------------VDECQLMPNACQNGGTCHNSHGGYNCVCVNGWTGE--DCSENIDDCASAACFQGATCHDRVASFYCECPHGRTGLL---CHLNDAC----ISNPCNEGSNCDTNPV----NGKAICTCPSGYTGPA---CSQDVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGRCVDKINEFLCQCPK------GFSGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCH-YGLCKDGVATFTCLCQPG-YTGHHCETNINECH----SQPCRHGGTCQDRDNYYLCLCLKGTTGPNCEINLDDCASNPCDSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEIDINECVKSPCRHGASCQNTNGSYRCLCQAGYTG---RNCESDIDDC--RPNPCHNGGSCTDGVNAAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPTGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTC----LCPPGFT--GSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGKCWQTNTQYHCECRSGWTGFNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEEDKHYCHCQAGYTGSYCE----DEVDECSPNPCQNGATCTDYLGGFSCKCVAG-----YHGSNCSEEINECLSQ-----PCQNGGTC 1198          
BLAST of GH13743 vs. SwissProt
Match: gi|206729936|sp|P46531.4|NOTC1_HUMAN (RecName: Full=Neurogenic locus notch homolog protein 1; Short=Notch 1; Short=hN1; AltName: Full=Translocation-associated notch protein TAN-1; Contains: RecName: Full=Notch 1 extracellular truncation; Short=NEXT; Contains: RecName: Full=Notch 1 intracellular domain; Short=NICD; Flags: Precursor)

HSP 1 Score: 225.328 bits (573), Expect = 7.700e-57
Identity = 410/1482 (27.67%), Postives = 561/1482 (37.85%), Query Frame = 0
Query:   94 DSQCYCNDGYGGKGCDMPDTNECKYRPCDVFGYC-TNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECR-DIDECLT------------NQVCGINTLCINTHGNFSCE----------------------------CLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDP-YQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVK--VRTTCSSDFDCTNNAQCLPNGS--CACRKGFQPNGVLC-QDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGW-----AYNPKE-ISSGCLDIDECDKSIS------PTG----------------KCGVNAICSNSPGSFNCVCAKGFNGDPYIGC-FDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNG----ACNCQEPYVGPNCEDACRDATCFP--NSQCLVQNGLPFCQCLPGFKLSPNGRSC-IDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQG---ESCLSSRCVCRRGYERNPAGDC-VDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQG----------------NPFTSCQSCSGSSCSCLPPYQDIEGRCQLADC--SNCEAPAKCVQITGGISY-CACPRGYEMNPRTKNCE-DIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPS-NPPQCLCKAGFTGNPLTGC-EDLDECALNPCKQGSICINKLATYQCECPPGTTG---DPYTNGCSGSKSVECGADDECHGQLACI------GSQC---INPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQG----QTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGD--PTLVCMPPTQQAECS-SECGTNSHCI-YGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSV--------CGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEG-----CSSAATCQTNTDCGYNEICSTIAHSGHRFCSD---PCQQAQCGPNSFCITDNHQKSCICQDGFTG-----DANDPQRG---CQREEKCSTNEDCPAGR-TCHINFNG 1420
            D  C C  G+ G  C  P  N C   PC   G C   TL  + C C  G+ G    C+  D C     +N C    +C    A Y+C C P F G     CR D++EC              N+V     +C  TH   +CE                            CLPGF G   +   +ID+C  N C  G  C + +  Y C+CP   +G    +   + Q+ P+  Q G           C  +  G  C C  G+TG+      +I++C S++ +    GA C ++   + CECP G  G     C      +   C+   +C  N     NG   C C  G+   G  C QD+DEC    NPC     C+N  G +ECQC+    G   E    + C+   C   A+C     E  CIC  G+       N  E  SS CL    C   I+      PTG                 C   A C + P ++ CVC +G+ G     C  DIDEC  +    G    C + V +++C C  G     +   C+     C S Q C     C +      C C +   GPNCE    D    P  +  CL +     C C PG+     G  C I+IDECAGNPC     CE+ +  F C+CP+G + DP   C  E   EC  +  C  G   +S    +C C  G+      +C ++ NEC   N C     CK++   Y C C  GF G                N  T     +G  C+CL PY        LA C  S C    +C Q     S+ C CP G++     + CE DI+EC     +PC  GA C N  G + C C  G  G          R+  +    CR N                          PCH         CT   N   C C  GF G   T C ED++ECA +PC+ G+ C + + +Y C CP G +G   +  T  C+ S     G   +      C+      GS C   +N C S PC     C     +  C C  G+   +  N V  C+   C +  +C  + +   C+C  G     + G +C + S S       QG    + CQ G      G            N   C CQ+G+ G     LV        ECS S C   + C  Y    SC C  GY      G   +  +++C S  C +   C       +C+C RG  G+  E   +VD+C   V        C  N  C++  GGY C C   FVG   EG V+ E ++   D    Q C      N   C C +G  G     ++ G     C +  TC   ++     IC   A      C +    C   +C     CI+     +C+C   FTG      A+ P  G   C  +  C    + P  R  C   FNG
Sbjct:   84 DYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKS--CQQADPCA----SNPCANGGQCLPFEASYICHCPPSFHGP---TCRQDVNECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCE--ENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNG---------GTCHNTHGGYNCVCVNGWTGED--CSENIDDCASAACFH---GATCHDRVASFYCECPHGRTG---LLCHLNDACISNPCNEGSNCDTNPV---NGKAICTCPSGY--TGPACSQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNE-CVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTG---THCEVDIDECDPDPCHYGS---CKDGVATFTCLCRPG----YTGHHCETNINECSS-QPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKIDGYECACEPGY----TGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYH-DPT--CLSEVN-ECNSNP-CVHGACRDSLNGYKCDCDPGWS---GTNCDINNNEC-ESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQ----GQTCEVDINECVL---SPCRHGASCQNTHGGYRCHCQAGYSG----------RNCETDIDDCRPN--------------------------PCHN-----GGSCTDGINTAFCDCLPGFRG---TFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSG-----WTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAG------------NTHHCRCQAGYTGSYCEDLV-------DECSPSPCQNGATCTDYLGGYSCKCVAGYH-----GVNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEI--NVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVN-ECLSNPCDARGTQNCVQRV--NDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNG 1422          

HSP 2 Score: 175.252 bits (443), Expect = 1.125e-41
Identity = 342/1264 (27.06%), Postives = 494/1264 (39.08%), Query Frame = 0
Query:   84 GRHCQHG-ACLDS----QCYCNDGYGGKGCDMPDTNECKYRP--CDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVC-GINTLCINTHGNFSCECLPGFHGNPHDGCV-DIDECR--TNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISC-VDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFD------CTNNAQCL--PNG-SCACRKGFQPNGVLCQ-DIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNA--VCFNG-ACNCQEPYVGPNCE---DACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFE------CTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGI--SYCACPRGYEMNPRTKNC-EDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQG----KCICSPPFFVDTLDGNHCK---SPCHRFSCGFNAECTPS-NPPQCLCKAGFTGNPLTGCEDL-DECALNPCKQGSICINKLATYQCECPPGTTG---DPYTNGCS----------------GSKSVECGADDECHGQLACIGSQC---INPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLL--SCSSASPCLEQGQTC-QGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPE---CTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVG 1273
            G +C++G AC+D      C C   + G+ C   D +EC+  P  C   G C NT G + C C  G+ G+    ++ID+C     +  C   A C +  A + C+C  G  G   + C   D C++N    G N      +G   C C  G+ G     C  D+DEC    NPC    KC N LG+++CQC  G +G      C+  V   VS        C  +A C        C C  G+ G   + C V+ +EC SS     G    C+++   ++CECP G+ G              C  D D      C N A+CL  PN  +C C +G+   G  C+ DIDEC    +PC   S C +    + C C     G   E    + C    C    +CQ   +   C C +G      EI     ++D+C  S   +G       C +    + C C  G+ G   +   +IDECA N   C     C + +  ++C+C   G +DP+ LS   +   C S+  C+  A     NG  C+C   + G NC+   + C    C     C        C C  GF   PN ++  +I+ECA NPC     C + +  + C C       P +G   E          C    +C Q E   S  CVC  G++       VD+NEC+L + C   + C+N  G Y C C +G+ G      ++C      C P              + C     C   T GI  ++C C  G+    R   C EDI+EC +    PC +GA+C +   S++C+CP G     F G      +   + S C     C+ G     C+C P F      G++C+   + C    C     C       +C C  G+TG     C++L   C  +PCK G  C      Y+CECP G TG   D  +  C                 G   V+ G    C  Q    GS C   ++ CS  PC + A C        C+C +G+   +    +  C    C +   C+  P+   C C  G  G      HC +    C+     + +   C   G C+ Q G               SCTC  GF+G+     +       C +  GT +     N   C C  G     +TG    + +  C    C +   C+ AS       C C  G++G   E   D   C    C     CI+ P    C C   F G
Sbjct:  263 GNNCKNGGACVDGVNTYNCRCPPEWTGQYC-TEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCS-ENIDDCA----SAACFHGATCHDRVASFYCECPHGRTG---LLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTG---PACSQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGP----RCEIDVNECVS------NPCQNDATCLDQIGEFQCICMPGYEG---VHCEVNTDECASSPCLHNGR---CLDKINEFQCECPTGFTGH------------LCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGY--TGTHCEVDIDECDP--DPCHYGS-CKDGVATFTCLCRPGYTGHHCETNINE-CSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEI-----NLDDCASSPCDSG------TCLDKIDGYECACEPGYTGS--MCNINIDECAGNP--CHNGGTCEDGINGFTCRCPE-GYHDPTCLS---EVNECNSN-PCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFS-GPNCQT--NINECASNPCLNQGTCIDDVAGYKCNCLL-----PYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCE--VDINECVL-SPCRHGASCQNTHGGYRCHCQAGYSG------RNCETDIDDCRP--------------NPCHNGGSC---TDGINTAFCDCLPGF----RGTFCEEDINECAS---DPCRNGANCTDCVDSYTCTCPAG-----FSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGF-----TGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTG---PNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGV-----HCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGG-------------YSCTCPPGFVGERCEGDVNECLSNPCDAR-GTQNCVQRVNDFHCECRAG-----HTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCE--NDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTG 1380          

HSP 3 Score: 166.777 bits (421), Expect = 4.682e-39
Identity = 343/1328 (25.83%), Postives = 484/1328 (36.45%), Query Frame = 0
Query:  125 GYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLP-----AHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTG----DPKISCVDINECQSSSLYQCGVGAICI-NQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCA-------CRKGFQPNGVLC-QDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSP--GSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQE-KRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCE---DACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSC-IDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQG---------------NPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSN--CEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGD--------------PFQGSCLPLRSA-------------CSSN-SQCRENEECLQGKCI---------CSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQ---CLCKAGFTGNPLTGCE-DLDECALNPCKQGSICINKLATYQCECPPGTTG------------DPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCS--LLSCSSASPCLEQGQTCQGG----RCITQCGQEQCGVN-----AFCDPN-------------RLSCTCQSGFLG----DPTLVCMPPTQQ--AECSSECGTNSHCI-YGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTED-----DDLCANQQCGPNAIC--NLG--QCLCASGFKGD 1317
            G C    G+  C C   + G    C+D + C    L+  C +NA  C++      A Y C C  GF G   +   D + CLTN      T  + T   + C C PG+ G     C   D C +NPC  G +C     +Y C CP    G      C+  V     + G     C     C        C CR   TG     P + C         S   C  G  C       + C C  G+ G              C  + D      C   G+C        CR   +  G  C +D+DECQ   N C     C N  G Y C C+    G    +   D C    C   A+C    +  +C C  G       ++  C+           +  C   + C  +P  G   C C  G+ G       D+DEC+     C     C N +GS+ CQC  G       +   E     CQ+D  C+     F   C C   Y G +CE   D C  + C  N +CL +     C+C  GF     G  C  D+DECA  PC   A C +   ++ C C +G  G        E   +      C  G +  +  C+CR GY  +      ++NEC     C     C++   +Y C C  G  G               +  T      G  C+C P Y        + +C+   C     C     G + C CP GY  +P   +  +++EC +    PC  GA C ++   + C C PG  G                  G+C  + S              C +N ++C  N    QG CI         C  P+   T +     +PC    C    EC  S   +   C+C  G+ G     CE D++EC L+PC+ G+ C N    Y+C C  G +G            +P  NG S +  +     D   G       + IN C+S PC + ANC     +  C C +GF+     N    C +  C +   C+   +  TC C  G  G+     +C   +  C S  PCL  G TCQ G    RC   C Q   G N      +CD +             +  C C SG+ G     P++ C    Q+   + +  C     C+  GN + C C  G     YTG      V++C    C + A C+   G   C C  GY G+     +++DECL   C     C++ P  Y C C     G      VH E   +D     D +  + +C  N  C   +G   C C  GF G+
Sbjct:   35 GKCEAANGTEACVCGGAFVGP--RCQDPNPC----LSTPC-KNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLD-NACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGK---SCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGP----TCRQDVNECGQKPGL----CRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPC---------SPSPCQNGGTCRPTGDVTHECACLPGFTGQ------------NCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDD-CASAACFHGATCHDRVASFYCECPHGRTGLLCHLNDACI-----------SNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQ--DVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQ--CICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGF----TGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFT--CLCRPGYTGHHCE--TNINEC-SSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFT-CRCPEGYH-DPTCLS--EVNECNS---NPCVHGA-CRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCE--VVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQT---CEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGS-----YCQHDVNECDS-QPCL-HGGTCQDGCGSYRCT--CPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAG-----YTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGV--NCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQG------VHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGE 1262          

HSP 4 Score: 128.642 bits (322), Expect = 1.603e-27
Identity = 182/658 (27.66%), Postives = 259/658 (39.36%), Query Frame = 0
Query:   89 HGACLDS----QCYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNT--LGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECR-DIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSG-------------------------DPYQGACQAQVAPSVSQQG---CNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDG----RFACEPVKVRTTCSSDFDCTNNAQCLPNGS---CACRKGFQPNGVLCQD-IDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTG---KCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQE-----KRRSCQSDQEC-IGNAVCFNGACNCQEPYVGPNCED---ACRDATCFPNSQCLVQNGLPFCQCLPGFK----LSPNGRSCIDIDECAGNPCGQDAICENLLGS--FVCKCPKGTNG 685
             G C+D     +C C   Y G  C++     C   PC   G C  +    SF C C  G++G      DI+EC +    + C   A C N    Y C C+ G+ G     C  DID+C  N  C     C +      C+CLPGF G   +   DI+EC ++PC  GA CT+ + +Y C CPAG SG                         + +   C      S  Q     C++Q C     CQ       CTC +G+TG P    + ++ C SS    C  G  C      YRCECP+G+ G        +CE    R        C +   C+  G+   C C+ G+   G  C+D +DEC  + +PC   + C +  G Y C+C+A   G    +   D CL   C    +C  + +   C C  G      EI     ++D+C+  + P     KC  N  C +  G ++C C  GF G+   G  D++EC  N         C  +V  + C+C  G     +   C+      K + C++   C + +       C C   + G  CE+    C    C     C+     P C CL  F       P    C+      GNPC     CE    S  + C CP   NG
Sbjct:  803 QGTCIDDVAGYKCNCLLPYTGATCEVV-LAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEV-DINECVL----SPCRHGASCQNTHGGYRCHCQAGYSGR---NCETDIDDCRPNP-CHNGGSCTDGINTAFCDCLPGFRGTFCE--EDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTG-PNCQNL-VHWCDSSP---CKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGY--TGSYCEDLVDEC--SPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEI-DECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEI-----NVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEG--DVNECLSNPCDARGTQNCVQRVNDFHCECRAGH----TGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTGPECQFPASSPCL-----GGNPCYNQGTCEPTSESPFYRCLCPAKFNG 1422          

HSP 5 Score: 102.064 bits (253), Expect = 1.724e-19
Identity = 303/1205 (25.15%), Postives = 437/1205 (36.27%), Query Frame = 0
Query:  600 ACNCQEPYVGPNC----EDACRDATCFPNSQCLVQNGLPF-CQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQD-SQCDQGESCL----SSRCVCRRGY-----ER----------------NPAGDCVDLNECLLG---------------NVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNC-EDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQ-CLCKAGFTGNPLTGCEDLDECAL--NPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECH---GQLACI------GSQC---INPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSE-CGTNSHCI-YGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQ-DVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNA---ICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQRE-EKCSTNE--------DCPAGRTCH--INFNGE--QTCLDPCQIMSCPTNEKCMVSDGMP--ICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCN----------EVSFGMKNC---VPACDLVNCPSGAECVSEGHRGYCRCLPGYSGN--PDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQ-----PACSYLECGVGAVCVVRNHVGKCICPQGLFVGN---PQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDP-------CQNEI-------CGENALCTVAGHQHKCQCPPSF------IPSPTPEVLCEKN--DRGDLCPFG 1676
            AC+C   + GP C    ++AC    C     C +     + C+C PG+    +G+SC   D CA NPC     C     S++C CP   +G     CR +   EC Q    C  G +C     S RCVCR  +     ER                 P GD      CL G               N C     C +   +Y+C CP  + G      Q C+          +D++  CQL   + C+    C    GG + C C  G+      ++C E+ID+C +     C  GA C +   SF C CP G+ G                   C  N+ C+                     +PC+    G N +  P N    C C +G+TG   +  +D+DEC+L  NPC+    CIN L +++C+C  G TG       +   S  C  D  C    G+  CI      G  C    + C+S PC  N  C+ + +   C C +GF        V  C    C + A+C+  P+  TC C EG     Y G HC  +      P       C  G C       + GV  F      +C C+ G+ G         T   ECSS+ C     C    N   C C  G  G     CE+  +++DC S  C D+  C       EC C+ GY G     C  ++DEC  + C     C +   G+ CRC   +         H      + + C +  C   A     N  +C C  G+ G                 TN D   NE                C+   C     C        C C++GF+G        CQ    +C++N         D  AG  C+  + + G   +  L PC    C    +C  S+      C+C +G++      +C+V       S C  G SC           +  +  +NC   +  C    C +G  C    +  +C CLPG+ G    +D + C        ++  +C +S  C    G          P C+   C  G  CV   +   C+CP G F G+     +  C    C+    C D   C   SY C  P       CQN +       C     C     Q++C+CP  +      +PS + EV  ++   D   LC  G
Sbjct:   86 ACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGW----SGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHG---PTCR-QDVNECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTG------QYCT----------EDVD-ECQLMP-NACQNGGTCHNTHGGYN-CVCVNGWT----GEDCSENIDDCASAA---CFHGATCHDRVASFYCECPHGRTG-----------------LLCHLNDACI--------------------SNPCNE---GSNCDTNPVNGKAICTCPSGYTGPACS--QDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEG-----YTGTHCE-VDIDECDP-----DPCHYGSC-------KDGVATF------TCLCRPGYTGHHC-----ETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTG---PNCEI--NLDDCASSPC-DSGTCLDKIDGYECACEPGYTG---SMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGY---------HDPTCLSEVNECNSNPCVHGACRDSLNGYKCDCDPGWSG-----------------TNCDINNNE----------------CESNPCVNGGTCKDMTSGYVCTCREGFSGP------NCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQ----TCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPG-FTGSYCQHDVNECDSQPCLHGGTCQDG--CG--SYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHG 1119          

HSP 6 Score: 74.7146 bits (182), Expect = 3.319e-11
Identity = 340/1436 (23.68%), Postives = 480/1436 (33.43%), Query Frame = 0
Query: 2607 KCQDPCQNEASVCGECATCTTQNHQ----LQCQCPRGTSG----DPY-QSCRTNYLRCGST---KNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQ-----NGAECIEGVCISGCGSNRDCPYGEMCEGGQCRNPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAK-TECTTNGQCSRDKSCEGGRCINLCSES------NSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDC-LLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHK---CEDNERCIAQ----RHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQG-TSCPDGKSCQVLNHQALCI---------CTKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGF------------------------CGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCIVRGNR------------------EVCSCQPGYFGGPPNCRPE--------CVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVV--------------------KHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLG-----DPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQG----DPFDRCSPNPPEPLETDPCSACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAE-CSEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCR--PECTEDSACPNHLKCVREKCVDPCPGICGRNA-ECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVG---DPQVECHKPPSGIVTEEIIDPCANR-ECGPYSQKVERNGICTCSCLPGYVG 3913
            +CQDP    ++ C    TC   + +      C C  G SG     P   +C TN  R G T            C  G   KSC+ +  C      + G CL   + +  C      +G  C + V  + CG       G    GG C N    + C     C+     P   C+R Y   +   C     C   G  + + +C  G     C E+      N+C     C    +   C CP  + G   Q C  D ++C L+PN C     C N  GG++CVC +G TG+      C    D C +            +C   A C        CECP    G   +LC     C + P          C   + C  N    +  C  P         +D + C        H  KC       IN+ G   C     QCL     P     ++    NPCQ   +C D    Q+   Q +C+            D C+ SPC     C        CECP G  G      V E  C +T C     C +      C C  G+   +       E   D C P PC  + +C   +    C+C PG  G     C    ET  + C   PC     C   D N  +C C +G  G       P C+ + D  +   C++  C D   G+                        C  G +CE   +  TCRC EGY  DP   C+ +         + +C  N                PC     ++  CR   +  +C C PG+ G     C +  N                    VC+C+ G+ G  PNC+          C+ Q  C  D    +  C+ P       GA C+VV                         C CP G  G   + C++ +       C  SPC   A C+      +CHC  G+ G     D   CRP                    +PC N       C    +   C C    +G    +  + C+        +DPC       DC     D   C+CP  + G       P+C T + C +   C+       C+   G     C   ++ C   PC     C+    G   C C   Y G  PNC+      + S C N  KC +      C    G     C   ++S    A  QG  +A        +  L VD  N           C C  G+ G              E+ V  C P+PC + A C +     SC+C+  Y G   V+C  E            CLSH    PC++   C      ++ N +  +CSC     G   +  V+   PP        +DP +   +C      V++ G  +C+C PG+VG
Sbjct:   56 RCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCL-PFEASYICHCPPSFHGPTCRQDV--NECGQKP----GLCRHGGTCHNEVGSYRC----VCRATHTGP--NCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTG---QYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGE-----DCSENIDDCAS-----------AACFHGATCHDRVASFYCECPH---GRTGLLCHLNDACISNP----------CNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKC-------INTLGSFEC-----QCLQGYTGPRCEIDVNECVSNPCQNDATCLD----QIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDE--CASTPCKNGAKCLDGPNTYTCVCTEGYTGTH------CEVDIDECDPDPC-HYGSCKDGVATFTCLCRPGYTGH---HC----ETNINECSSQPCRHGGTCQDRD-NAYLCFCLKGTTG-------PNCEINLDDCASSPCDSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYH-DP--TCLSE---------VNECNSN----------------PC-----VHGACRDSLNGYKCDCDPGWSGT---NCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSG--PNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYT-----GATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQG---QTCEVDI-----NECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRP--------------------NPCHN----GGSCTDGINTAFCDCLPGFRGTFCEEDINECA--------SDPCRNGANCTDC----VDSYTCTCPAGFSGIHCENNTPDC-TESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGC-GSYRCTCPQGYTG--PNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQ----HGGLCVDAGNTH--------HCRCQAGYTG-----------SYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHG---VNCSEEID---------ECLSH----PCQNGGTC-----LDLPNTY--KCSCPRGTQGVHCEINVDDCNPP--------VDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVG 1261          

HSP 7 Score: 67.781 bits (164), Expect = 4.109e-9
Identity = 328/1371 (23.92%), Postives = 455/1371 (33.19%), Query Frame = 0
Query: 1982 GSCHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKC--TNEQG--SYQCTCHDGMVGDP---------YTQGCKPKAQCYSNSECSSDTRCQNGRC------VDPCDGF-CGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPRECEQNLDCPGDGKCDNFVCVKP-----HEKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGN----SKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAIN-ERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQV--IERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSD---CEANELCHGKICKEVCRSDSQCQSKEICQGISCS---QGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGN----PIEHCQPTLVPCSSASDC---PQSKT--CSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQAGLVCIDRQCVGG--CSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASD------CQNGAECIEGVCISGCGSNRDCPYGEM---------------CEGGQCRNPCNGFECE-----PNSFCQVNGR----NP--------------LCLCDRGYQ----RLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNS-------------CGKNAECRMNN--HRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVD---PCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGT--SCPDGKS---CQVLNHQALCICTKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTA----------CGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFG 3222
            G C   +    C C  G   +G  CQD + C S  PC N+  C   + +G   Y C+C  G  G            T  C+    C   +      RC  G         DPC    C  G +C+    S  C C P + G P  + ++ EC                     Q  G+C     C        C C + HTG    CE+         C N    +P     HE +CL        Q C   E  D C   N C     C    +   C CPP +TG        EC  +P+ C     C  +   +  +C++   +  DC+ N + C    C          F G  C D++    C    +CP+ ++ +     D C +  C   + C    +  +A C C  G+                                   P C  D D     AN   H   C     S  +CQ  +   G  C      C S+P C  D  C +   IG      +    G       D C+ S C  N  C  K ++  C CP G  G+     ++ C  T  PC + + C   P + T  C++G     C++  D    + C+ G C           A   C+ R    G  C +N    S   C  G                 TC  +++   C C +GT+G    +C  N   C S+         C  G C    +   EC    +C  G+    C I  D      C NG  C +G+    C     CP G                 C  G CR+  NG++C+       + C +N      NP              +C C  G+     +     CA   C   G C  D +  G +C  L   + +             C    ECR +       CVCP+G+ G   Q C VD N+C+L + C   A C N  GG+ C C++G     + G  C T  D CR      NPC+  GSC          + A C+C   + G     C+      A       +   +C  S  C+         C +    C    C +   C+   +   C C      +        Q DV     ++C S      G CQ+ C     +CP G +   CQ L H          C  SPC +   C        CECP G  G   D  V   SC   A          C     C +      C C  G+   Y       E   D C+PSPC   A C   L    C C  G  G   + C   EE   D C   PC +   C ++  N   CSC  G  G
Sbjct:   35 GKCEAANGTEACVC--GGAFVGPRCQDPNPCLS-TPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHG-PTCRQDVNECG--------------------QKPGLCRHGGTCHNEVGSYRCVCRATHTGP--NCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFT---GQNCE--ENIDDCPG-NNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNG-WTGEDCSENIDDCASAAC----------FHGATCHDRVASFYC----ECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYT---------------------------------GPACSQDVDECSLGANPCEHAGKCINTLGS-FECQCLQGYTGPRCEIDVNECVSNP-CQNDATCLDQ--IGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECAST--PCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSC-------KDGVATFTCLCRPGYTGHHCETNINECSSQPCRHG----------------GTCQDRDNAYLCFCLKGTTG---PNCEINLDDCASSP--------CDSGTCLDKIDG-YEC----ACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTC----RCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVA--GYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQG---QTCEVDINECVL-SPCRHGASCQNTHGGYRCHCQAG-----YSGRNCETDIDDCRP-----NPCHNGGSCTDGI------NTAFCDCLPGFRG---TFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYC------QHDV-----NECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHW---------CDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCD--VPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGSY------CEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHG---VNCS--EEI--DECLSHPCQNGGTC-LDLPNTYKCSCPRGTQG 1215          

HSP 8 Score: 63.929 bits (154), Expect = 5.162e-8
Identity = 286/1149 (24.89%), Postives = 416/1149 (36.21%), Query Frame = 0
Query: 1224 ECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLG---------QCLCASGFKGDDPNDLVEGCSSAA-----TCQTNTDCGYNE----ICSTIAHSGHRFCSDPCQQAQCGPNSFCITD--NHQKSCICQDGFTG-----DANDPQRG---CQREEKC-----STNEDCPAGRT---CHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSC----NEV------SFGMKNC---VPACDLVNCPSGAECVSEGHRGYCRCLPGYSG----------NPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQP---ACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQI-------EGCRKVSCVENEDCPD----NEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKND-RGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCS-SNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFENLCQCPEGFAGVPTAAQGCVRIPPTCTTDCP--ASSLCFN-GYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQV----PDESGACRSPDQCSSDQDCNDAL-ACLADSLSGAKKCLDPCDISYCTP-----LATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHG-SCHPEDHAPKCHCQDGYQLIGSNCQ-DIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGF-CGIGAKCVVKNHSPKCSCLPRWRG----NPKIKCELLECVENADCDASKSCLNNK-CVDA-------CQLSGI---------------CGLNSRCRMSNHGPVCSCNSGHTGDPRECEQNLD------CPGDGKC----DNFVCVKPH-EKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTG 2243
            EC C  G+ G   E  +++D+C  + C     C++    Y+CRC  ++ G         +  TED D C   Q  PNA  N G          C+C +G+ G+D ++ ++ C+SAA     TC       Y E        + H      S+PC +      S C T+  N +  C C  G+TG     D ++   G   C+   KC     S    C  G T   C I+ N  +   +PCQ      +  C+   G   C+C  G+E       C+V     A S C     C    NE        F    C   V  C    C +GA+C+   +   C C  GY+G          +PD    C   S     +   C    +C+       C+     CS   C  G  C  R++   C C +G    N +I         C   +C++  D  +      +   +    +D C    C     C    +   C+CP  +     P  L E N+   + C  G C+ +  +  +C     C  G     C  +N  CE       G C+D  +               +C C EGF+G            P C T+    AS+ C N G C+ +         G +C+   CL L +T   C   E+ +       CR   +CR  E   +   C C  G++  Q+   D+NEC  + C  G +C NT G Y C C           +   CR P+ C +   C D +     D L G +      DI+ C        A C        C+CP  F G      I C      C   +C +G +C    ++  C C  G+   GS CQ D++EC S  PC +   C +  GSY+CTC  G  G                        CQN   V  CD   C  G KC   +   +C C   W G     P + CE+    +    D ++ C +   CVDA       CQ                   C   + C     G  C C +G+ G    C + +D      C   G C    + + C  P   +    +IN +D   C+     DP  +   C  N  C  +     C+CPPGF G
Sbjct:  242 ECACLPGFTGQNCE--ENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTG---------QYCTEDVDEC---QLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGRTGLLCHLNDACISNPCNEG-----SNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVN--ECVSNPCQ-----NDATCLDQIGEFQCICMPGYEGVH----CEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDP---CHYGSCKDGVATFTC----LCRPGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYH---DPTCLSEVNECNSNPCVHGACRDS-LNGYKCD----CDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGY-------------VCTCREGFSG------------PNCQTNINECASNPCLNQGTCIDD-------VAGYKCN---CL-LPYTGATC---EVVLAPCAPSPCRNGGECRQSEDYESF-SCVCPTGWQ-GQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCR-PNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSG------IHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGF--TGSYCQHDVNECDS-QPCLHGGTCQDGCGSYRCTCPQGYTG----------------------PNCQN--LVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEV--AAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHG--VNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDD---CNPP--VDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVG 1261          
BLAST of GH13743 vs. SwissProt
Match: gi|576011265|sp|A2RUV0.2|NOTC1_XENTR (RecName: Full=Neurogenic locus notch homolog protein 1; Short=Notch 1; Contains: RecName: Full=Notch 1 extracellular truncation; Short=NEXT; Contains: RecName: Full=Notch 1 intracellular domain; Short=NICD; Flags: Precursor)

HSP 1 Score: 225.328 bits (573), Expect = 8.158e-57
Identity = 385/1439 (26.75%), Postives = 555/1439 (38.57%), Query Frame = 0
Query:   90 GACLDSQCYCNDGYGGKGCDMPDTNECKYRPCDVFGYC--TNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGD---------GKVECRDIDECLT----------NQVCGIN----------TLCIN-------THGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDP-YQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVK--VRTTCSSDFDCTNNAQCLPNGS--CACRKGFQPNGVLC-QDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNG--GQY----------DP----------SSLSCQ----EKRRSCQSD-QECIGNAVCFNGA----------CNCQEPYVGPNCEDACRDATCFP--NSQCLVQNGLPFCQCLPGFKLSPNGRSC-IDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDP-LSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDC-VDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQG----------------NPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSN--CEAPAKCVQITGGISY-CACPRGYEMNPRTKNCE-DIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPS-NPPQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQC------------INPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQG----QTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECS-SECGTNSHCI-YGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDEC--------LFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCS-----SAATCQTNTDCGYNEICS---TIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTG 1387
            G  +D  C+C  G+  K C  P  N C   PC   G C   +++  + C C  G+ GD   C+  D C     +N C    +C      Y+CKC  GF G           +  CR+  +CL           N+  G N          + C+N          ++ C CLPGF G   +   +ID+C +N C  G  C + +  Y CQCP   +G    +   + Q+ P+  Q G           C  +  G  C C  G+TG+      +I++C +++   C  GA C ++   + CECP G  G     C      +   C+   +C  N     NG   C C  G+   G  C  D+DEC    NPC     C N  G ++C C     G P  +   + CL   C   A+C     E  CIC  G+     E      +IDEC      +  C  N  C +    F+C C  GFNG+  +   D+DECA     C   A C +   SY+CQC  G  G++          DP          ++ +C        R C +D  EC+    C NG           C C +   G NCE    D    P    +C+ +     C C PG+     G+ C I+IDECA NPC     C++ +  F C CP G +    LS     ++  C   + C  G +    +C C  G+      +C V+ NEC   N C     CK++ G+Y C C +GF G                N  T     +G  C+C+ PY        LA CS   C+   +C +     ++ C CP G++     + CE D++EC    + PC +GA C N  GS+ C+C PG  G          R   +    C+ N                          PCH         C+   N   C C AGF G      ED++ECA NPCK G+ C + + +Y C C PG +G    N         C     C   +     QC            IN C S PC +   C     A  C C  G+   +  N V  C+   C +  +C  + +   C+C  G     + G +C + S S      +QG      C+        G            N   C CQ+G+ G          Q  ECS + C   + C  Y    SC C  GY      G   +  + +C S  C +   C       +C+C RG  G+  E   +VD+C        L   C  N +C +  GGY+C C   FVG   EG V+ E ++   D    Q C    + N  +C C  GF G   + +V+GC      +  TC   ++     IC        +   + +  C   +C     CI+      C+C +G+TG
Sbjct:   80 GNAIDFTCHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLSSVSDYRCRCPPGWTGDS--CQQADPC----ASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCLNEFGSYRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCE--ENIDDCPSNNCRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQLMPNACQNG---------GTCHNTYGGYNCVCVNGWTGED--CSENIDDCANAA---CHSGATCHDRVASFFCECPHGRTG---LLCHLDNACISNPCNEGSNCDTNPV---NGKAICTCPPGY--TGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAG-PRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGYEGLYCET-----NIDEC-----ASNPCLHNGKCVDKINEFHCECPTGFNGN--LCQHDVDECASTP--CKNGAKCLDGPNSYTCQCTEGFTGRHCEQDINECIPDPCHYGTCKDGIATFTCLCRPGYTGRLCDNDINECLSQP-CQNGGQCTDRENGYICTCPKGTTGVNCETNLDDCASNPCDYGKCIDKIDGYECTCEPGYT----GKMCNINIDECASNPCRNGGTCKDKINGFTCVCPDGYHDHMCLSEVNECNSNPCIHGT-CHDGIN--GYKCDCDAGWS---GSNCDVNNNEC-ESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQ----GQTCEIDMNECV---NRPCRNGAMCQNTNGSYKCNCKPGYAG----------RHCETDIDDCQPN--------------------------PCHN-----GGSCSDGINMFFCNCPAGFRGPKCE--EDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYRCECKSG-----WTGVYCDVPSVSCEVAAKQQGVDIAHLCRNSGMCVDTG------------NTHFCRCQAGYTGS-----YCEEQVDECSPNPCQNGATCTDYLGGYSCECVAGYH-----GVNCSEEINECLSHPCHNGGTCIDLINTYKCSCPRGTQGVHCEI--NVDDCTPFYDSVSLEPKCFNNGKCFDRVGGYNCICPPGFVGERCEGDVN-ECLSNPCDPRGTQNC--IQLVNDYRCECRQGFTGRRCDSVVDGCKGLPCRNGGTCAVASNTERGFICKCPPGFDGATCEYDARTCGNLRCQNGGTCISVLKSSKCVCSEGYTG 1379          

HSP 2 Score: 92.8189 bits (229), Expect = 9.797e-17
Identity = 289/1165 (24.81%), Postives = 405/1165 (34.76%), Query Frame = 0
Query: 2484 ADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQAGLV-CIDRQCVGG--CSSNTQCPSESVCVEGKCQDPCQNE-----ASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCISGCGSNRDCPYGEM-----CEGGQCRNPCN-GFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCS-ESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGN---------PDVLCKTQFGCKARP-----EVEAESTGRECGRSAECSLNQECIRGACVDPCATHKC------------EDNERCIAQ--RHKPKCTCKERLLINSAGELICPQ--QDVQCLYE-DQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICTKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLP-----ECQTDQDCPSDQSCNNLKCQDPCPGF----------------CGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDDG------NC------------VDPCPER-CGLNADCRVQNHQVQCFCQPGFKGDP---------------YYQCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQG----DPFDRCSPNP 3543
            ADPC+ + C    +C     Q +C CP G  G     C+  +  CS                   C+  G CL NE  +     Q   +   C+   V C    C+ G  C        E  C+ G     C+       ++ C    TC    +   CQCP   +G   Q C  +   C    N C +G  CH      +C        GE C E   +  C  A+ C +GA C + V    C    +CP+G        +     NPCN G  C+ N    VNG+  +C C  GY              T   C+ D        ++ CS  +N C     C       QC CP G+ G     C +D N+C L N C  +A CL+Q+G F C+C  G     ++G  C T  D C +     NPC   G C  +       ++  CECP  + GN             CK    C   P     +     TGR C +     +   C  G C D  AT  C             D   C++Q  ++  +CT +E   I       CP+    V C    D C S   C  G C +   G  C    +C+      +C    D C+ +PC +   C+       C CP+G       S V E  C +  C  +  C +      C+C  G+      S    +  ++ C  +PC     C  +     C C  G  G       P  +T  + C  +PC ++  C I+D     C+C   Y G      L       C+    C   +      C+ P PG+                C  GA C+       C C+ GY G   R C  D         +  CQ N  C +   C DG      NC            ++ C    C   A+C    +   C CQPGF G                    CI   N   C C PG+ G                Y  H +      PC+N    G  CQ       C+CP G TG     CQ +VR      C  SPC     C       +C C  G+ G   YC      D    S ++  +++ +D   ++C  + +C    +   C C +   G    +  D CSPNP
Sbjct:  142 ADPCASNPCANGGKCLPFETQYICKCPSGFHG---ATCKQDINECSQNP----------------CRNGGQCL-NEFGSYRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTYNCQCPPDWTG---QYCTEDVDECQLMPNACQNGGTCHNTYGGYNC-VCVNGWTGEDCSEN--IDDCANAA-CHSGATCHDRVASFFC----ECPHGRTGLLCHLDNACISNPCNEGSNCDTNP---VNGK-AICTCPPGY--------------TGPACNND--------VDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAG---PRCEIDVNEC-LSNPCQNDATCLDQIGEFQCICMPG-----YEGLYCETNIDECAS-----NPCLHNGKCVDKI------NEFHCECPTGFNGNLCQHDVDECASTPCKNGAKCLDGPNSYTCQCTEGFTGRHCEQDINECIPDPCHYGTCKDGIATFTCLCRPGYTGRLCDNDINECLSQPCQNGGQCTDRENGYI-----CTCPKGTTGVNCETNLDDCASN-PCDYGKCIDKIDGYEC----TCEPGYTGKMCNINIDECASNPCRNGGTCKDKINGFTCVCPDGYHDHMCLSEVNE--CNSNPC-IHGTCHDGINGYKCDCDAGW------SGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSG-------PNCQTNINECASNPCLNRGTC-IDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECP-PGWQGQTCEIDMNECVNRPCRNGAMCQNTNGSYKCNCKPGYAG---RHCETD---------IDDCQPNP-CHNGGSCSDGINMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGN---------------YCQHDINECDSKPCLN----GGTCQDSYGAYKCTCPQGYTG---LNCQNLVR-----WCDSSPCKNGGKCWQTNNFYRCECKSGWTG--VYC------DVPSVSCEVAAKQQGVD-IAHLCRNSGMCVDTGNTHFCRCQAGYTGSYCEEQVDECSPNP 1152          

HSP 3 Score: 80.1073 bits (196), Expect = 7.691e-13
Identity = 276/1140 (24.21%), Postives = 391/1140 (34.30%), Query Frame = 0
Query: 2268 CHKSICMHQCQSHNDCAINERC-DEGKC---LLTCGVDNDC-----FLGHVCLDKM--------CKVG-----CSAPKD----CPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPN--PSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANEL-------CHGKICKEVCRSDSQCQSKEICQGISC--------SQGCRSDPDCTADKACHNNQCIGRSSKRK--------------------------------VTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLV--PCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQAGLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASD------CQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCRNPCNGFECEPN----SFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCE------------DNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPC--QGTSCPDGK----SCQVLNHQALCICTKDPCSISPCGDEAICRAVEGNAI--CECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSC----NNLKCQDPCPGFCG----------------IGASCEVEQHKPTCRCREGYKG 3280
            C  S    +CQ  N CA+  +C + G C   LL   +D  C     F   VCL  +        C+ G      S+  D    CP   +  + Q  DPC +  C     C   E Q  C C  GF        +  C++ P  C+   QC   F      C+   F   +CE   +        +G  C++   +  +C       G +C        S  CR+   C      +N QC    + +                                 V   TG   +   D C+ + C + A C  +     C CP G  G  + H     +  PC+  S+C  +    +  C       G    N+V    L    C    +C   L      C  G +     P   + V     +PCQN+       ATC  Q  + QC C  G  G          L C +  ++C S    H G C        E +C   C  GF    CQ   D      C+NGA+C++G       ++  C   E   G  C    N  EC P+      C+       CLC  GY              T   C  D        IN C  S  C    +C    +   C CP G  G     C  + +DC   N C +  +C++++ G++C C  G TG       C    D C +     NPC   G+C  +       +   C CP+ Y    D +C ++                      EC+ N  CI G C D    +KC+            +N  C +       TCK+       G  IC      C      P+  + I+    NPC  +GT   D      +C +    A+C     PCS SPC +   C+  E      CECP G +G   +  +    C    C     CQ   G   C C PG+  ++     C    DD C P+PC    +C   +N   C CP G  G       P  E   + C  +PC + ANC  +  N   C+C  G+ G       P+C T+  C +  +C    N   CQ P PGF G                 G +C+       C C +GY G
Sbjct:   47 CSSSYFGERCQYPNPCALKNQCMNFGTCEPVLLGNAIDFTCHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLSSVSDYRCRCPPGWTGDSCQQADPCASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNP--CRNGGQCLNEFGSYRCNCQNR-FTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPHGRTG-LLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAG----PRCEIDVNECLSNPCQND-------ATCLDQIGEFQCICMPGYEG----------LYCETNIDECASNPCLHNGKCVDKIN---EFHC--ECPTGFNGNLCQHDVDECASTPCKNGAKCLDGP------NSYTCQCTEGFTGRHCEQDIN--ECIPDPCHYGTCKDGIATFTCLCRPGY--------------TGRLCDND--------INECL-SQPCQNGGQCTDRENGYICTCPKGTTG---VNCETNLDDC-ASNPC-DYGKCIDKIDGYECTCEPGYTGK-----MCNINIDECAS-----NPCRNGGTCKDKI------NGFTCVCPDGYH---DHMCLSEVN--------------------ECNSN-PCIHGTCHDGINGYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDM-----TGAYIC-----TCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCE--IDMNECVNRPCRNGAMCQNTNGSYKCNCKPGYAGRH-----CETDIDD-CQPNPCHNGGSCSDGINMFFCNCPAGFRG-------PKCEEDINECASNPCKNGANC-TDCVNSYTCTCQPGFSGIHCENNTPDC-TESSCFNGGTCIDGINTFSCQCP-PGFTGNYCQHDINECDSKPCLNGGTCQDSYGAYKCTCPQGYTG 1052          

HSP 4 Score: 78.9518 bits (193), Expect = 1.383e-12
Identity = 383/1637 (23.40%), Postives = 553/1637 (33.78%), Query Frame = 0
Query: 1867 ICGAGKTCANTPG-SYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGA-------------KKCLDPCDIS----YCTPLATCNVIQHKA--FCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHG-SCHPEDHAPKCHCQDGYQLIGSNC-QDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVG----DPYT----QGCKPKAQCYSNSECSSDTRCQNGRCVDPCD--------GFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLECVENADCDASKSCLNNKCVDACQLS-GICGLNSRCRMSNHGPVCSCNSGHTGDPRECEQNLDCPGDGKCDN----------FVCVKPHEKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTG----NSKVECVRIPSTCILDSNCP---GSMQCHK---------SICMHQCQSH---NDCAINERCDEGKCLLTCGVD-------------NDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPN--PSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKI---CKEVCRSDSQCQSKEICQGISCSQG-----CRSDPDCTADKACHNNQCIGRSSKRKVT---NRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGN----PIEHCQPTLVPCSSASDCPQSKTCS--QGTCVAQCQLQG-DCLQNEVCNEGLCVQICNSNT-QCQAGL---------------------VCIDRQCVGGCSSNTQCPSESVCVEGKCQ----DPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASD------CQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCR---NPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLA----SGGCAKTECTTNGQCSRDKS-----CEGGRCINLCS------ESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFG-CKARP-EVEAESTGRECGRSAECSLNQECIR-GACVDPCATHKCEDNERCIAQRHKPKCTC---KERLLINSAGELICPQQDVQCLYEDQCPSTLSCID-----------GACQNPCQGTSC--------PDG-KSCQVLNHQALCICTK-----------DPCSISPC---GDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQ--LKCVCPP---GLF----GDPFIQCQPVEETPKD---ACQPSPCGSKAN---CNINDENQA---------------------ICSCWEGYFGNPL-------TGCLPE---CQT---------DQDCPS-------DQSCNNLKCQ 3250
            +C  G  C  TPG + +C C ++   +    C+ P+ C+    C +   C    L  A             K CL P D +     C    TC ++   +   C CPP + GD       C Q + PC    C +G  C P +    C C  G+   G+ C QDI+EC S NPC N  +C NE GSY+C C +   G    +PY       C     C    + S +  C  G     C+          C  G  CV   ++  C C P W G          C E+              VD CQL    C     C  +  G  C C +G TG+  +C +N+D   +  C +          F C  PH ++ L+   C+ D  C      +PC + + C  N +    N + +C+CPPG+TG    N   EC    + C     C    GS QC+           I +++C S+   ND    ++  E +C+   G +             N C     C+DK+ +  C  P    N   C      D C +  C   A C        C C  GF        +  C  +P      K     F C    C+P            LC   I     + C++  QC  +E     +C +G     C ++ D  A   C   +CI +    + T     TG +     D C+ + C     C+ K +   C CP+G   +     +  C        +  D      C    G   + C +   +C  N   N G C  +  +    C+AG                       CID   V G   N   P      E         PC+N    C E     T      C+CP G  G   Q+C  +   C +          C  G   ++   S +CNC      G+  + C+   D      C NG  C +G+ +  C    +CP G    G +C    N C    C+  + C     +  C C  G+  +     +  C ++ C   G C    +     C  G   N C       +S  C     C+ +    +C CP G+ G   Q  V   +     + C    +C      + C C+SG TG       C  P  SC    A     ++   C    +C    +   C C   Y G+    C+ Q   C   P +  A  T    G S EC      +     ++ C +H C +   CI   +  KC+C    + +      +   P  D   L E +C +   C D           G     C+G           P G ++C  L +   C C +           D C   PC   G  A+    E   IC+CP G  G   +      +CG   C     C  +     C C  G+         C  P   PC   PC     C     +   +C CP    GLF       FI       TP D    C+   C   A+   CN N  N A                        CW+ YF +         +GCL +   CQ          DQ C         DQ CNN +C+
Sbjct:   28 MCLNGGRCEMTPGGTGVCLCSSSYFGER---CQYPNPCALKNQCMNFGTCEPVLLGNAIDFTCHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLSSVSDYRCRCPPGWTGD------SCQQAD-PCASNPCANGGKCLPFETQYICKCPSGFH--GATCKQDINEC-SQNPCRNGGQCLNEFGSYRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTYNCQCPPDWTGQ--------YCTED--------------VDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGE--DCSENIDDCANAACHSGATCHDRVASFFCECPHGRTGLL---CHLDNAC----ISNPCNEGSNCDTNPV----NGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGYEGLYCETNIDECASNPCLHNGKCVDKINEFHCECPTGF-NGNLC--QHDVDECASTPCKNGAKCLDGPNSYTCQCTEGFTGRHCEQDINECIPDPCHYGTCKDGIATFTC---LCRPG-------YTGRLCDNDINECLSQPCQNGGQCTDRENGYICTCPKGTTGVNCETNLDDCASNPCDYGKCIDKIDGYECTCEPGYTGKMCNINIDECASNPCRNGGTCKDKINGFTCVCPDGYHDHMCLSEVNECNSNPCIHGTCHDGINGYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDD--VAGYKCNCMLPYTGAICEAVLAPCSGSPCKN-GGRCKESEDYET----FSCECPPGWQG---QTCEIDMNECVNRP--------CRNGAMCQNTNGSYKCNC----KPGYAGRHCETDIDDCQPNPCHNGGSCSDGINMFFC----NCPAG--FRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDS----SPCKNGGKCWQTNNFYRCECKSGWTG-----VYCDVPSVSCEV-AAKQQGVDIAHLCRNSGMCVDTGNTHFCRCQAGYTGS---YCEEQVDECSPNPCQNGATCTDYLGGYSCECVAGYHGVNCSEEINECLSHPCHNGGTCIDLINTYKCSCPRGTQGVHCEINVDDCTPFYDSVSL-EPKCFNNGKCFDRVGGYNCICPPGFVGERCEGDVNECLSNPCDPRGTQNCIQLVNDYRCECRQGFTGRRCDSVVDGCKGLPCRNGGTCAVASNTERGFICKCPPGFDGATCE--YDARTCGNLRCQNGGTCISVLKSSKCVCSEGYT-----GATCQYPVVSPCASRPCYNGGTCQFSPEEPFFQCFCPTNFNGLFCHILDYGFIGGLGKNITPPDNEEICENEQCAELADNKICNANCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWK-YFNDGKCDSQCNNSGCLYDGFDCQKVEVQCNPLYDQYCRDHFQDGHCDQGCNNAECE 1553          

HSP 5 Score: 75.0998 bits (183), Expect = 2.038e-11
Identity = 321/1345 (23.87%), Postives = 460/1345 (34.20%), Query Frame = 0
Query:  852 LNNPGSFSCSCPPGQGGD----PFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQ-CLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTG----DPYT--NGCSGSKSVECGADDECHGQLACI----GSQC---INPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQV--ICGSNAQCIVSPSGPTCQCFEGMVGN--PYPGGHCSLLSCSSASPCLEQGQT----CQGGRCITQCGQEQ------CGVNAFCDPN----RLSCTCQSGFLGDP--------TLVCMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAIC----NLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTG-----DAND-PQRGCQREEKCSTNED-----CPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAE---CVSE----------------GHRGY-CRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQ--------------PACSYLECGVGAVCV--VRNHVGKCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTC------------MDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGI------CAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFENLCQCPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKN------CLQGEICVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDL-NECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLS---GAKKCLDPCDISY-CTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHG-SCHPEDHAPKCHCQDGYQLIGSNC-QDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVG----------DPYTQGCKPKAQCYSNSEC 2060
            L N   F+C CP G        P   +C+   + C +   C         +C C P +   T D      PC    C    +C P      C C +GF G   T  +D++EC+ NPC+ G  C+N+  +Y+C C    TG    +PY   N         C   D+   +  C+    G  C   I+ C S  C +   CV   +   C+C   +        V  C  +   C +   C  +  G  C C  G  G         C+  +C S + C ++  +    C  GR    C  +       C   + CD N    +  CTC  G+ G          +L   P      C++  G+           C C  GY G     CE+   V +C S  C ++A C    G+ +C C  GY+G+  E   ++DEC  + C  N +C++    + C C + F GN    C H      D D CA+  C   A C    N   C C  GF G      +  C                              DPC    C       T      C+C+ G+TG     D N+   + CQ   +C+  E+     CP G T  +N    +T LD C    C    KC+       C C  G+        C++     A + C  G +C +   G   CV       CP G     C+SE                G  GY C C  G+SG     S C + + N+C SN  C     CK   G   C                 C+   C     C+  V  +   C+ P    +    +  C    C     C ++E  +  S  C            M+ C N  C   A+C      +KC C P +         CE +          CQ      + C  G  C  GI      C AG       E+   C +  C++    T   N+         C C  GF+G+      C    P CT      S CFNG    +  +   C    QC  G     C  D N      CL G  C D +                     +C+C  GY  T   C +L   C ++ C  G  C  T   Y C C +                         + C   S+S    AK+     DI++ C     C    +  FC C   + G        C +    C    C +G +C        C C  GY   G NC ++I+EC S +PCHN   C +   +Y+C+C  G  G           P+      + +C++N +C
Sbjct:   79 LGNAIDFTCHCPVGFTDKVCLTPVDNACV--NNPCRNGGTCELLSSVSDYRCRCPPGW---TGDSCQQADPCASNPCANGGKCLPFETQYICKCPSGFHG--ATCKQDINECSQNPCRNGGQCLNEFGSYRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGS---------FQCNCPQGYAG---PRCEI--DVNECLSNPCQNDATCLDQIGEFQCICMPGYEGLYCE--TNIDECASNPCLHNGKCVDKINEFHCECPTGFNGNL---CQH------DVDECASTPCKNGAKCLDGPNSYTCQCTEGFTGRHCEQDINEC----------------------------IPDPCHYGTCKDGIATFT------CLCRPGYTGRLCDNDINECLSQPCQNGGQCTDRENGYICTCPKGTT-GVNC---ETNLDDCASNPCDYG-KCIDKIDGYECTCEPGYTGKM----CNINIDECASNPCRNGGTCKDKINGFT-CV-------CPDGYHDHMCLSEVNECNSNPCIHGTCHDGINGYKCDCDAGWSG-----SNCDV-NNNECESNP-CMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQNTNGSYKCNCKPGYAGR-----HCETD-------IDDCQ-----PNPCHNGGSCSDGINMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSY-------TCTCQPGFSGI-----HCENNTPDCT-----ESSCFNGGTCIDGINTFSC----QCPPGFTGNYCQHDINECDSKPCLNGGTCQDSY------------------GAYKCTCPQGY--TGLNCQNLVRWCDSSPCKNGGKCWQTNNFYRCECKSGWT---------------------GVYCDVPSVSCEVAAKQ--QGVDIAHLCRNSGMCVDTGNTHFCRCQAGYTGSY------CEEQVDECSPNPCQNGATCTDYLGGYSCECVAGYH--GVNCSEEINECLS-HPCHNGGTCIDLINTYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKC 1243          

HSP 6 Score: 73.9442 bits (180), Expect = 4.556e-11
Identity = 217/854 (25.41%), Postives = 309/854 (36.18%), Query Frame = 0
Query: 2803 SNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTG----DPFQGCQCPTP---KDSCRTKGACLNPCN-LRGSCGKQAICKVVNHQALCECPE--CYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSA-ECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLL--INSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICTKDPCSISPCGDEAICRA--VEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFV-PKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQV-QCFCQPGFKGDPYYQCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNPPEPLETDPCSACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNA-DCPSHQACLRNKCVDPCIGTC------GVNAECSEPIDPCQPNPC 3632
            SN C    +C     +  C CPSGF+G     C  D N+C   N C    QCLN+ G + C C++  TG    +P+  C  P+P     +CR        C  L G  G+         + + +CP   C  G   V     + C+  P+     TG+ C     EC L    +  AC +    H       C+         C E +    N+A                 C S  +C D      C+   CP G++  + +    CI        +PC + + C    V G AIC CP G  G   ++ V E S G   C     C    G   C C  G+  P+  + +       + C  +PC   A CL  + + +C+C PG  G   + C    ET  D C  +PC     C ++  N+  C C  G+ GN        CQ D D  +   C N             GA C    +  TC+C EG+ G    Q + + +P P       C        +  C DG     C  R G     R+ ++ + +C  QP   G    QC  R N  +C+C  G  G   NC       +DC   + C  G+C+D       +G +         C+C  G TG   K C I +       C  +PC     CK       C C            P+   DH C S         ++ C +   I+  CH   +   C C +   G     C  N  E  E++PC   G   D         IC+C   + G       P C TN  +C S+    R  C+D   G           A C   + PC  +PC
Sbjct:  147 SNPCANGGKCLPFETQYICKCPSGFHG---ATCKQDINECS-QNPCRNGGQCLNEFGSYRCNCQNRFTGRNCEEPYVPCN-PSPCLNGGTCRQTDDTSYECTCLPGFSGQNC------EENIDDCPSNNCRNGGTCVDGVNTYNCQCPPDW----TGQYCTEDVDECQL----MPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAA-----------------CHSGATCHDRVASFFCE---CPHGRTGLLCHLDNACIS-------NPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDV-------NECLSNPCQNDATCLDQIGEFQCICMPGYEG---LYC----ETNIDECASNPCLHNGKC-VDKINEFHCECPTGFNGN-------LCQHDVDECASTPCKN-------------GAKCLDGPNSYTCQCTEGFTGRHCEQDINECIPDP-------CH-------YGTCKDGIATFTCLCRPGYTG--RLCDNDINECLSQPCQNGG---QCTDRENGYICTCPKGTTG--VNCETNL---DDCA-SNPCDYGKCIDKI-----DGYE---------CTCEPGYTG---KMCNINI-----DECASNPCRNGGTCKDKINGFTCVC------------PDGYHDHMCLSE--------VNECNSNPCIHGTCHDGINGYKCDCDAGWSG---SNCDVNNNE-CESNPCMNGGTCKDM----TGAYICTCRAGFSG-------PNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPC 837          
BLAST of GH13743 vs. SwissProt
Match: gi|17380387|sp|P07207.3|NOTCH_DROME (RecName: Full=Neurogenic locus Notch protein; Contains: RecName: Full=Processed neurogenic locus Notch protein; Flags: Precursor)

HSP 1 Score: 223.402 bits (568), Expect = 3.275e-56
Identity = 373/1377 (27.09%), Postives = 528/1377 (38.34%), Query Frame = 0
Query:   60 PDCYRGSDEANSQIKCTKDCLYTTGRHCQHGACLDSQ------CYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGS----FFCSCNEGYEGDGFHCKDIDECQIPELAN--TCVQNAEC-CNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVC-------GINTLCINTHGNFSCECLPGFHGNPHDGC-VDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPV-----KVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLC-QDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNG-----------------------DP----------YIGC---FDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNG----ACNCQEPYVGPNCEDACRDATCFP--NSQCLVQNGLPFCQCLPGFKLSPNGRSC-IDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCL----SSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGF-QGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGIS--YCACPRGYEMNPRTKNCE-DIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLP-LRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKS---PCHRFSCGFNAECTPSN---PPQCLCKAGFTGNPLTGCEDLDECAL-NPCKQGSICINKLATYQCECPPGTTGDP---YTNGCSGSKSVECGADDECHGQLACI------GSQC---INPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGN--PYPGGHCSLLSCSSASPCLEQGQ--TCQ------GGRC---ITQCGQEQCGVNAFCD--PNRLSCTCQSGFLGD----PTLVCMPPTQQAECSSE--CGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIP-------------------YERCQDV-----------------DECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVH 1281
            P+  RG+D A     CT          CQ+G    +Q      C C+  Y G  C+    N C    C   G C  T  +      C C  G++      + + E  +P   +  TC+    C       Y C C  G+ G+          C T  +C       G     +    +F+C C PGF G   D C  DI+EC++NPC  G  C N  G+YQC CP G +G      C  +  P      C+   C    +C+ +     C C +GF G  K    + ++C     + C  G  CI+    Y C CP  +   GRF  + V     +    C +   CTN        SC C  G+   G+ C  + D+C+  +  C   + C++  G + CQC     G        D C    C   A C          C     Y   + S    DIDECD+  SP   C  N IC N+PGS+ C C++GF G                       DP          + G     DIDEC  N   C  +  C +++  + C C  G     +   CQ     CQS Q C    +C +     +C C   Y G +CE    D    P    +C+       C C PG+     G  C   I+EC  NPC  D  C++ +GS+ C+C  GT     SG   E        + C+ G +C+    S +C C  G+        VD  EC + + C  N VC +    Y CECP GF   +  +    C+ + C         EGRC+                  GI+   C CP GY      K CE DIDEC +    PC  G  C +   +FSC C PG  G   + +    + + C +   C +       KC+C  PF      G  C+S   PC    C   A+CTPS+      C CK G+TG      ED+DEC+L +PC+ G+ C+N   +Y+C C  G  G      T+ C+       G   +  G  +C+      G  C   IN C S PC + A C    ++  C C  GF+  +       C +  C +   CI   +G  C C  G  G    Y    C    C + + C EQ    TC       G +C   +  CGQ  C   A C    ++ SC C +G+ G      T+ C     +   S    C   +   YGN + C C+ G     Y G      +++C S  C +   C    G  EC C++G+ G                     ++R  +                  D+C    C  N  CI+  GG++C C   FVG   EG ++
Sbjct:   47 PNTVRGTDTALVAASCTS-------VGCQNGGTCVTQLNGKTYCACDSHYVGDYCEH--RNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFD------ESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGE---------RCETKNLCASSPCRNGATCTALAGSSSFTCSCPPGFTG---DTCSYDIEECQSNPCKYGGTCVNTHGSYQCMCPTGYTGKD----CDTKYKP------CSPSPCQNGGICRSNGLSYECKCPKGFEG--KNCEQNYDDCLG---HLCQNGGTCIDGISDYTCRCPPNFT--GRFCQDDVDECAQRDHPVCQNGATCTNTHGSY---SCICVNGWA--GLDCSNNTDDCK--QAACFYGATCIDGVGSFYCQCTKGKTGLLCH--LDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSE---DIDECDQG-SP---CEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNP--CLNDGTCHDKINGFKCSCALG----FTGARCQINIDDCQS-QPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNSFKCLCDPGYT----GYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGT-----SGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVD--EC-ISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCV-------NEGRCE-----------------DGINEFICHCPPGY----TGKRCELDIDECSS---NPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGY--KCVCKVPF-----TGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCD--EDIDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTCKDYGNSHVCYCSQG-----YAGSYCQKEIDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDIN 1299          

HSP 2 Score: 192.586 bits (488), Expect = 7.135e-47
Identity = 428/1669 (25.64%), Postives = 592/1669 (35.47%), Query Frame = 0
Query:  121 CDVFGYCTNTL-GSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECR-------DIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNG---DGRFA-CEPVKVRTTCSSDFDCTNNAQCLPNG---SCACRKGFQPNGVLC-QDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQR--------ASCQIVKSEAFCICEEGWAYNPKEISSGCLD----IDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQ--VGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNG----ACNCQEPYVGPNCE---DACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSC-IDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQ------------------SCSGSSCSCLPPYQDIEGRCQLADCSN--CEAPAKCVQITGGISYCACPRGYEMNPRTKNCE-DIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLP-LRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKS---PCHRFSCGFNAECTPS-NPPQCLCKAGFTGNPLTGCE-DLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPS--GPTCQCFEGMVGNPYPGGHC--SLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSS-ECGTNSHCIYG-NPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDE-CLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAIC----NLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQ----------RGCQREEKCSTNEDCPAGRTCHI-----NFNGE--QTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMK-NCVPA------------CDLVNCPSGAECVSEGHRGYCRCLPGYSG------------NPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPA---CSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEG-------CRKVSCVENE-------DCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSF 1654
            C   G C   L G  +C+C+  Y GD  +C+  + C      N         N      CKC  GF+   +  C        D   CL    C + TL       ++C C  G+ G   + C   + C ++PC  GA CT L G                                              S+   C+C  GFTGD      DI ECQS+    C  G  C+N    Y+C CP GY G   D ++  C P            C N   C  NG    C C KGF+  G  C Q+ D+C    + C     C++   DY C+C     G    + C+D   E  C QR        A+C        CIC  GWA          LD     D+C ++      C   A C +  GSF C C KG  G   + C   D C  N   C  +A+C      GSY+C C  G +     + C E    C     C  N +C N      CNC + + GP CE   + C    C     CL   G   C C+PGF     G  C IDIDEC  NPC  D  C + +  F C C  G  G                            +RC              +++++C     C    +C +    Y CECP G+ G   TSC+                    +   C C P Y     + Q+ +C +  C+    C Q   G  YC C  G       KNCE +++EC +    PC +GA C++   S+ C C PG  G   + +    + S C++N  C +       KC C P  F D     HC S    C    C     C    N   C C  G+TG     CE D+DEC+ NPC+ G  C +KL  + C+C PG TG          +  E   DD                C + PCG+   C+ + +   C CK  F      + +  C    C + A+C  S +    +C C  G     Y G +C   +  CS +SPC        G  C+               P    C C  G+ G    +        +C+S  C     C+ G    SC C  G+ G     CE  T + +C S  C + A CS       CTC  G+ GI    CQ  DE C  S C     CI+   GY+C C + + G   +  +         + C +  C   A C    N   C C SGF G   ++ V                                 D C Q+ C   + C    HQ SC C  G+TG   D Q          +G    + C+ N  C      H+      + G   Q  +D CQ   C     C    G   C C  GF+      +C++     A + C  G +C++       +C P             C    C +   C+       C C PG+ G            NP   +G +   Q    +N  C     C+  +  R C+     C+   C  G  C +R     CIC  G +  N ++ G       CR  +CV  +       +CP     +      +D C    C + A C      ++C CP  +
Sbjct:   67 CQNGGTCVTQLNGKTYCACDSHYVGD--YCEHRNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFD---ESLCEIAVPNACDHVTCLNGGTCQLKTL-----EEYTCACANGYTG---ERCETKNLCASSPCRNGATCTALAG----------------------------------------------SSSFTCSCPPGFTGD--TCSYDIEECQSNP---CKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSP----------CQNGGICRSNGLSYECKCPKGFE--GKNCEQNYDDCLG--HLCQNGGTCIDGISDYTCRCPPNFTG----RFCQDDVDE--CAQRDHPVCQNGATCTNTHGSYSCICVNGWA---------GLDCSNNTDDCKQA-----ACFYGATCIDGVGSFYCQCTKGKTG---LLCHLDDACTSNP--CHADAICDTSPINGSYACSCATGYK----GVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFT----GTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTG----------------------------ARCQ-------------INIDDCQ-SQPCRNRGICHDSIAGYSCECPPGYTG---TSCEININDCDSNPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHC-QDRVGSYYCQCQAG----TSGKNCEVNVNECHS---NPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGY--KCEC-PRGFYDA----HCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKR---CELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTG----------QKCETNIDD----------------CVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLG-----YTGRYCDEDIDECSLSSPCR------NGASCLNV-------------PGSYRCLCTKGYEGRDCAI-----NTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKH---CE--TDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGI---NCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKL---------NKCDSNPCLNGATCHEQNNEYTCHCPSGFTGKQCSEYV---------------------------------DWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCN-NGTCKDYGNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQ----NCELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSNPCSNAGTLDCVQ--LVNNYHCN----CRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQDCDSNPCRVGNCVVADEGFGYRCECPRGTLGEHCEIDTLDECSPNPCAQGAACEDLLGDYECLCPSKW 1445          

HSP 3 Score: 90.1225 bits (222), Expect = 5.766e-16
Identity = 380/1509 (25.18%), Postives = 531/1509 (35.19%), Query Frame = 0
Query: 1494 ACDLVNCPSGAECVSEGHRGY-CRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRS----CQPA-----CSY-LE------CGVGAVCVVRNHVGKCICPQGLFVG---NPQIEGCRKVSCVENEDCPDNEFCDRLSYTC--------------MDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGD-LCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTH------CEEGRVCITGKCQDPCTETCGPNALCSPEFENLCQCPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSH-GQCARGEQCS-NGMCLKLCHTDK-NCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGG---------QCSCQPGYEMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAK--KCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQLIGSNCQD-IDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKA-QCYSNSECSSDTRCQNGRCVDPCDGFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLECVENADCDASKSCLNNK-CVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPRECEQNLDCPGDGKCDN----FVCVKP---HEKSCLVDINCNDDQVCSRSECK-DPCQQPNACGVNALCASKNHQQVCSCPPGFTG----NSKVECVRIPSTCILDSNCPGSMQCHKSICM-----HQCQSHND-CAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVG---------CSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENF-----LCDASFCKPVCFAD-SDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRK---VTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNP----IEHCQPTLVPCSSASDCPQSK-----TCSQGTCVAQCQLQGDCLQNEVCNEGLCV-QICNSNTQCQAG--LVCIDRQCVGGCSSNTQCPSESVCVEGKCQD-PCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQI-ASDCQNGAECIEGVCISGCGSN----RDCPYGEMCEGGQ---CRNPCNGFECEPNSFCQVNGRNPLCLCDRGYQ----RLASGGCAKTECTTNGQCSRDKS-----CEGGRCINLCSESNSCGKNAECRMNN-------HRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTG 2871
            ACD V C +G  C  +    Y C C  GY+G           ++N C+S + C     C    G  S    C P      CSY +E      C  G  CV  +   +C+CP G + G   + + + C    C     C  N     LSY C               D C   +C     C      + C+CPP+F      + + E   R   +C  G   T    S  C    IC +G     CS+NT       C  G  CI G     C  T G   L       LC   +     P  A       P    +   +  C  GY   +C+    +C +G  C  NG+C+    + + NC QG      F  P C T+ +      C   G         +C C PG+  TQ    D++EC++N C    TC +    + CSC                               A   +GA+    +D C    C     C+       C CPP + G      I        C+   C  G C  + ++ KC C  GY   G  CQ  I+EC S NPC     C +  GSY C C  G  G    + C+    +C+SN                PC+     GA C+   +S KC C+P + G          C +N D   S  C NN  C+D      + G    C    +   C        D  EC  N  C  +G+C++    F+C  P     K C +DI+          EC  +PCQ          C  K +   C C PG+TG     +  +CV  P  C     C   +  +K +C        C+S  D CA N   +E KC  +       FL   C  K+   G         CS    C N  SC+N                    +     C+C +G+      +         CQ    C +       LC   F    C  D ++C +    +G  C +   S + C       GI+C     +D DCT     +   CI   +      +   +G+   +  + C  + C   A C  +N++  C CP G  G      ++ C  +  PC + + C Q K      CS G     C +Q    Q+    +GL + Q+CN+ T    G   VC   Q   G    + C  E      +CQ  PCQN         TC       +CQC +G  G   Q+C  N   C    N C +G  CH  +   SC          SC  G     C+I   DC+ GA    G CI   G      +    G  CEG       NPC+         C     N  C C  G+           CA++ C   G C+  +S     C  G     C  S     +  CR+ N          +C CP G  G   + C +D  D   PN C + A C + LG ++C+C S   G
Sbjct:  142 ACDHVTCLNGGTCQLKTLEEYTCACANGYTGE-------RCETKNLCAS-SPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHGSYQCMCPTG-YTGKDCDTKYKPCSPSPCQNGGICRSN----GLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSC----ICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGL-------LCHLDDACTSNPCHADAICDTSPI---NGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQG------FTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEI-DIDECQSNPCLNDGTCHDKINGFKCSC-------------------------------ALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININ------DCDSNPCHRGKCIDDVNSFKCLCDPGY--TGYICQKQINECES-NPCQFDGHCQDRVGSYYCQCQAGTSG----KNCEVNVNECHSN----------------PCNN----GATCIDGINSYKCQCVPGFTGQ--------HCEKNVDECISSPCANNGVCIDQ-----VNGYKCECPRGFYDAHC------LSDVDECASN-PCVNEGRCEDGINEFICHCPPGYTGKRCELDID----------ECSSNPCQH------GGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNP--CGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSN-----FLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCLN--------------------VPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYT-CTCPLGFSGINCQ---TNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQS--PCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTCKDYGNSHVCYCSQGYAG----SYCQKEI----DECQSQPCQNGG-------TCRDLIGAYECQCRQGFQG---QNCELNIDDC--APNPCQNGGTCHDRVMNFSC----------SCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSNPCSN---AGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQDCDSNPCRVGNCVVADEGFGYRCECPRGTLG---EHCEIDTLDECSPNPCAQGAACEDLLGDYECLCPSKWKG 1447          

HSP 4 Score: 81.2629 bits (199), Expect = 2.796e-13
Identity = 349/1411 (24.73%), Postives = 507/1411 (35.93%), Query Frame = 0
Query: 1626 DPCQNEICGENALCTVAGHQHK----CQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQD--PCTETCGPNALCSPEFENLCQCPEGFAGVPTAAQGCVRIPPTCTTD---CPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGG---QCSCQPGYEMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQV----PDESGACRSPDQ--CSSDQDCND---ALACLADSLSGAKKC---LDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQLIGSNC-QDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQN-GRCVDPCDGFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPRECEQNLD------CPGDGKCDNFVCVKPHE-------KSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSN-CPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVD------NDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNP--SPVVACTREPITCQGN-KQCPENFLCD--ASFCKPVCFADSD-CEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSD-PDCTADKACHNNQCIGRSSKRKVTNR---TGSIIAHLADPCSVSYCGANAECRTKNH--QALCSCPEGMEGNPIEHCQPTLVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQ------CQAGLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNE-----ASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCE-----------------ASAECNCGESCHE-----------GFCLQQCQIASD------CQNGAECIEGVCISGCGSNRDCPYGEMCE-------------GGQCRNPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKT--ECTT----NGQCSRD----------KSCEGGRC---INLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGS 2901
            +PC +  C     C V     +    C+CP  F      E LCE        P      TC +   C    + +     A   +   CE   +C +  C++   CT   G ++         C CP GF G             TC+ D   C ++   + G C+    S+ QC     C  G   K C T            K C P     S C+ G +C + G   +C C  G+E       + ++C  ++C  G TC +    Y C CP N       D+   C   D   C +   C +   + +C+  +      C    D C  + C   ATC       +C C     G   +    C     PC        S  P + +  C C  GY+  G +C +DIDEC  G+PC ++  C N  GSY+C C  G  G        P+ +   N EC S   CQN G C+D    F              +C C+P + G    +CE+                    +D CQ S  C  +  C    +G  CSC  G TG    C+ N+D      C   G C + +     E        SC ++IN  D   C R +C D         VN+          C C PG+TG     C +  + C  +SN C     C   +  + CQ          C  G     C V+      N C  G  C+D +    C         Q C   +  D C ++ C  N +C        C C RGF      S V  C   P   +G  +     F+C     +    C  D D C +N   HG  C +   + S CQ    C      Q C ++  DC  +   +   CI + +  K   +   TG       DPC+ + C   A+C   ++     C+C  G  G    +C   +  CS +S C    +C       +C          +C +G   + C  NT       CQ G  C+D      C          +CV+G     C+ +     +  C   ATC+   +   C CP G SG    +C+TN   C  T++ C +G +C  G+   +C                   S  C  G +CHE           GF  +QC    D      C+NGA C +      C  +     G++C+             G   R  CN      N  C+  G + +C C +GY   A   C K   EC +    NG   RD          +  +G  C   I+ C+  N C     C        C CP G  G     C ++++DC  P  C  N  C++++GGF+CVC+ G     F G +C    + C +     NPC+  G+
Sbjct:   98 NPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGF-----DESLCEI-----AVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNLCASSPCRNGATCTALAGSSSF-------TCSCPPGFTG------------DTCSYDIEECQSNPCKYGGTCVNTHGSY-QC----MCPTGYTGKDCDTKY----------KPCSP-----SPCQNGGICRSNGLSYECKCPKGFEGKNCE-QNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDAC--TSNPCHADAICDTS--PINGSYACSCATGYK--GVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTG--------PRCETNIN-ECESHP-CQNEGSCLDDPGTF--------------RCVCMPGFTG---TQCEID-------------------IDECQ-SNPCLNDGTCHDKINGFKCSCALGFTG--ARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDD--------VNSF--------KCLCDPGYTG---YICQKQINEC--ESNPCQFDGHCQDRVGSYYCQ----------CQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGF-TGQHC--EKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFS-CQ----CMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTG---RYCDEDIDECSLSSPCRNGASCLNVPGSYRC----------LCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSC----------LCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSG---INCQTNDEDC--TESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWT-GKLCDVQTISCQDAADRKGLSLRQLCN------NGTCKDYGNSHVCYCSQGY---AGSYCQKEIDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCA-PNPCQNGGTCHDRVMNFSCSCPPGTMGII---CEINKDDC-KPGACHNNGSCIDRVGGFECVCQPG-----FVGARCEGDINECLS-----NPCSNAGT 1311          

HSP 5 Score: 75.8702 bits (185), Expect = 1.184e-11
Identity = 291/1223 (23.79%), Postives = 406/1223 (33.20%), Query Frame = 0
Query: 3364 VCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNN-CGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHE-CPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQG----DPFDRCSPNPPEPLETDPCSACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRN-KCVDP-----CIGTCGVNAECSEPIDPCQPNPCGLNSVCESN-VNGLALCRCQNDYIGSP-PNCRPECTEDSACPNHLKCVREKCVDPC---PGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSD------------CPYGLACLSHKCKDPCEHNQACGINAV-CNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPCETCGQHAICHIHNNIAACKCEDNYIDKPPNCRRECVLHEDCPKHLACIQYKCAS-PCINQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQPIDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPE-----ELEGDPFIRCIPAGCRSDSECPSTEACIDRECR--------------DPCPFQT-CGVNAECETRSHLSTCICLEGFEGNP----YEGCTQYECKRHEECPSTLACRDFKCVDPCD---------------CAVGANCRVSNHKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINS-RCVD-----------------------PCISNPCKNGATCTVNKHEIFCACPNGFLFIGDFECKAPERPECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQKAGCQSNSE---CPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGN 4489
             CSC PG+ G            + C YD        ++ C +N C  G  C        C CP G TG   K C    +P     C PSPC    +C+      +C C  GF G        C  +++ C  H   +   CID      GI+           C CP N  G    D  D C+     P+       C   A C    +    C C   + G        +C  N D     AC     C+D      C  T G         D C  NPC  +++C+++ +NG   C C   Y G        EC + S C ++  CV       C    G  G   E       S  C + +G  L    + R                       C C+ GF G              E ++  C+ NPC ++  C ++     C C   + G         C +N D            C   +A  S +C  P     +C IN   C+ N  H  +C    D V   +  C    +G + ++ I+ C +  C       +R G   C C  G  G        C VN              V+ C  N C +   C    +  KC+C PG+ G     C K     I++        C  + +C    N   C+C   + D        C+   D          +CAS PC+N+      C    ++ IC C P Y G    +CE       ID C  NPC          +   C C+PG     YTG   E  I DDC            +NPC GN G   I  V  +  +C  P      E + DP   C    C+++++C  +   +D  C               D C   + C   A C        C+C +G+EG       + C  + C+    C   +      CVD  D               C  GA C    +  TCTCP GF+G               + C+ N E     +C+N   C+D                        C SNPC NGATC    +E  C CP+GF                 +  +C  +        +D C    C   A C+   H   C C   + G    V Q   CQ  ++     L + C N  C+D               N HV  C C  GY G+
Sbjct:  202 TCSCPPGFTG------------DTCSYD--------IEECQSNPCKYGGTCVNTHGSYQCMCPTGYTG---KDCDTKYKP-----CSPSPCQNGGICRSNGLSYECKCPKGFEG------KNCEQNYDDCLGHLCQNGGTCID------GIS--------DYTCRCPPNFTGRFCQDDVDECAQRD-HPV-------CQNGATC-TNTHGSYSCICVNGWAG-------LDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQN-EGSCLDDPGTFR-----------------------CVCMPGFTG-----------TQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTG-------ARCQINIDDCQSQPCRNRGICHDSIAGYSCECP-PGYTGTSCEININDCDSNPCHRGKCI---DDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKN------CEVN--------------VNECHSNPCNNGATCIDGINSYKCQCVPGFTGQH---CEKNVDECISSP-------CANNGVCIDQVNGYKCECPRGFYDA------HCLSDVD----------ECASNPCVNE----GRCEDGINEFICHCPPGYTGK---RCE-----LDIDECSSNPCQHGGTCYDKLNAFSCQCMPG-----YTGQKCETNI-DDC-----------VTNPC-GNGGT-CIDKVNGYKCVCKVPFTGRDCESKMDP---CASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSG---------------INCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCHCPSGF-----------------TGKQCSEY--------VDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDV-QTISCQDAADRKGLSLRQLCNNGTCKD-------------YGNSHV--CYCSQGYAGS 1178          
BLAST of GH13743 vs. nr
Match: gi|1325309800|ref|XP_023336514.1| (LOW QUALITY PROTEIN: uncharacterized protein LOC111707614 [Eurytemora affinis])

HSP 1 Score: 3148.99 bits (8163), Expect = 0.000e+0
Identity = 2414/6798 (35.51%), Postives = 3145/6798 (46.26%), Query Frame = 0
Query:    1 MVVFLPISSGQLVGRQPNDLSIDKGVFFLNVEDGFFGCQVNASVDVLQLFEISKLCDGVPDCYRGSDEANSQIKCTKDCLYTTGRHCQHGACLDSQCYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQ------------------------------------SCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVC-FNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGR-SCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGE-STFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGN----VCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSN---CEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQ-GKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKS-VECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQ--GCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQ--IEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSS-----QCPPGQI--------CKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCS-PEFENLCQCPEGFAGVPTAAQGCVRIPPTCTTDCPAS-SLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVC------------------------GAGGQCSCQPGYE---MTQSGCSDLN---------------------ECK-NNICGAGKTCANTPGSYICSCPTNQVPDE-------SGACRSPDQCSSDQDC-NDALACLADSLSGAKKCLD--PCDISYCTPLATCNVIQHKAFCSCPPKFRGDPT----------------NPKIGCYQVEY-------PCEGFTCGHGS-CHPEDHAPKCHCQDGY---------------------------QLIGSNCQD------------------------------IDECASGNPCHN-----SAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCD--GFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDP----------------------------------RECEQNL---------------DCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVC-----SRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGN---SKVECVRIPSTCILDSNCPGSMQCHKSICMH-----QCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQ-CGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGN--PIEHCQPTLVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQAGLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCE-ASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCRNPCNGFECEPNSFCQVNGRNPLCLCD-----------RGYQRLAS------------GGCAKTECTTNGQ------------------------------------------CSRDKSCEGGRCINLC-SESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDR-------------------NDCLLPNQCGENAQCL-----------------------------------------NQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECY-GGNP--------------DVLCKTQFGCKARPEVEAESTGRECGRSAECSL--------------------------------------------------NQECIR--GACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTS-CPDGKSCQVLNHQALCICT---------------------------KDPCSISPCGDEAICRAVEGNAICE-CPEGTRGDPLDSCVKEESCGTTA-CGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDA-CQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLK--CQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVC--DDGNCVDPCPE--------------------RCGLNADCRVQNHQVQCFCQPGFKGDP-------------------YYQCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRA-QEKCHCLPGFLGDPPY---CRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNPPEP---LETDPC--SACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECS--------------------------------EPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKP--EAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTI-TAEERDPC--ETCGQHAICHIHNNIAACKCEDNYIDKPPNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKC-EPPKVSQPI----DPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRCIPAGCRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQYECKRHEECPSTLACRDFKCVDPC--DCAVGANCRVSNHKTTCTCPPGFTGDPYSR--------DDPPRPPILTV----------------------------------GCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFL--------FIGDFECKAPE---------------------------------------RPECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQKAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQYECLVDSDCPYTLACPNRECIDPC--QCAANAECSVQNHKASCTCLPGFQGNAYTGGCS--PILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTS---NGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSC-LEIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQ----VECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQC----------------------------------PIGMF-----VGNGGSCIAAPSLVG--------CESSSKCKADQACLNAKCVSPC--NCGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCSTFECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEPV---------------------------------------EAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPT----------------------------------DTILG---------CVKDDECPKDSACINRMCKDPCD--CGRGAECFLTGHRPVCRCPEGTKGNPLIE----------------CTPIGCQSDNECQDPDVCA-----------PNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRR--IVCECPKGYFTNENNQCL-----------------------------------TLTPIVVG--------CTSDDECGDARACINAICKDPC--ACGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKT----CPAGSG--------------------LILNEFEECVCPPGFVLDSQGICAPCRFDVGFIIENGRCICDY--TKGFVLDLSGKKCVCP-ENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPPPVDIDRPEIVVNCLSDGVGVGLT----------ISDPRYHGLIYVKGHSQDPNCRLR--------------VDE-----GQNGQ-RIDFHVKFGTCDLAYDEDGYAHFI 5833
            ++  L +S+ Q              VFF+NVE+GFFGCQVNAS + LQ+F ISKLCDGV DCY+GSDE   ++KC+ +CLYTTGR C +GACLDSQCYCNDG+GGKGC MPD NECKYRPCDVF +CTNT+GS+ CSC  GY GDG  CKDIDEC +P LA  CV NAECCNLPA Y+CKCKPGFEGDG VEC DIDECL    CG+N LC N  GN++C C  G+ GNP+DGCVDIDECR++PCG GA+C N  G + C+CP+G  GDPY  +C AQ A S +  G NA+                                     CG++A C  +     C C +G TGDP   C D +EC S+    CG GA+C N +PG+ CECP G++G+GR  CE  +VRT C ++FDCTNNAQC+ NG C+CR GF P G LC DIDEC +T   CG N+ C N PG + C C++  +G PP  PCR+PC  V C   A C+  ++EA+C+CE+GW Y+PK + +GC+D+DEC  +      CG N+IC+N+ GSF C C  GF G+P + C DIDEC  N   CG    C N  GSY C C +G    P         + C  + +C GNA C     CNC EP  GPNCE  C +  C  NSQC + NG P C C  G++ +  G+  CIDI+EC GNPCG+ A CEN  G++ C CPKG NGDP   C+GE    +C+    C QGE C   +CVC+RG++R  +G C D+NEC L      VCG+N  CKNLPGSYDCECP G+ GNPF SC  C+G  C C  PY  +   C LA C N   C   A+C+ I GG+SYCACP G+ ++P   +C DIDECQA    PCG GA C N  GSFSC CP G  GDP+ G C   ++ CS +  CR NE+C++ G+CIC PP+F DT DG  CKSPC RF CG NAEC+P+NPPQCLCK G++GNPLTGC+D+DECA N C   + C+N+  +Y+C+CP GT GDPY  GC G+ +  EC +D +C GQLAC  S CINPCSS+PCG NA C+ E+HAAWCRCK+G+ E+ +G C S+C  VICG NAQCI+SP GPTC C +G +GNP+PGG C    CS+A+PC  Q  +C  G+C  +C Q  CG+NA CD +   C CQ GF+GD   +CMPP     C+  CG NSHCIY  PN C CN GY GNPY GC      + C   KCG+NA C   +G  EC+CK G+ G P+  C D++EC  ++CGKNA CINT G YDCRC ++F GNPFE C   E +    DLC + QCGPNA+C  GQCLC  GFKGD   DLV GC S +TC  N DCGYNEIC ++   G   C D C   QCGPNS C+TDNH  +CIC +GF G+   P+ GC +E  C   EDCP    C IN +G+++C++PC+IMSC   E C V D  P C C+S   +N LTG C++     C   + C     C   S G+  C   C L NCP  + C +  H+G+C+CL G++GNP+DR+GC + S+++C S+A+C+E EVC  S   R C PAC+ + CG  AVC+ +NHV KC CP G F G+P   I GCR VSC+ N DCP  +FCDRLSYTCMD C ++ CG NA+C     + KC CPP   P P  EV C   D     P  Q    C +S+      C  GQ+           G C  G   +  C    +C+  KC++ C ++CGPN  CS    +  CQC +GF   P  ++ C+R    C TD   S S C NG C   C S   C  GEQC++ MC+  C + + C   ++C    C+ GCR++ +C   EVC                        G   +CSC  G+      Q GC  +                      +CK N+ C  G+ C N     +C    N +  E          C   + C   + C N    C    +S    C D   C+ S C P ATC+ +     C CPP   GDP                  P + C   E        PCE   CG  S C  +DH P C C D +                           Q+  + C D                              +++C   + C N     +A CTN  G+YQC C  G V D     C+P  QC S++EC S   C NG+C +PC+  G CG  A C   NH+P CSC  R +GNP ++C  LECV N+DC + ++C+ NKCVD C L  +CG N+ C+ +NH   C C  G TGDP                                  REC  N                 CP    C N  CV+  E  C  D++C +   C        EC+D C  P  CG NA+C SK+H+ VC+CP GF GN    KV C RI   C  + +C G   C K++C+       C S++ CA NE C+ G C                                           DPC   + CG NA C V      C C   F  NP+  V C R P TC  N  CPE   C    C P C  D +C  NE C   +C   CR D+ C    +C    C  GCR++ DC     C NN+C+                    DPC+V  CG NA C+  NH+A CSCP     N  P+  C    V CSS + CP+ + C    C   C     CL NEVC+ G+C  +C  +  C +  +C    CV GC S   C +   C++ +C DPC +  + CG  A C+ +NH   C+CP G SGDP +SC    ++C S  + C +G  C  GLCA +CE +S+ C   E C  G C   C   S+C     C +  C++GC S+ DC   E C   QC++ C    C   + C V+   P+C C             G  RL S             G   T C++N                                            C +D  C GG+C + C S S+ C  +AECR++NHRA C+CP G  GN   EC                       N C LPN CG NAQC                                          + +GG+DC C++GCTGDPF GC C          G  ++PC+    CG  A C+V  +QA+C CPE    G+P              D  C     C +   ++  S    CG +A CS+                                                  +  C++  G C++PC++  C+ N++CI   HKP+C CK  L+IN  G L CP + V+C  ++ CPS  +C  G C+NPC     CP GK CQVLNH+A C+C                            K+PC    C D   C      A+C+ CPEG   D    C+K   C + + C    AC                              +PCT   C    +C VV ++ +C+        P  +C    + P  + C+   C       + D +   C        +P  GC  EC  + +C  D+ C+  K  C   CPGFCG  + C    H P C C+ G+ GDP   C V R P  P  P P       C S  +C  D GN +  CP                      CG N+ CR+   +  C+C P F+G+P                     +C+V  N + C+C+ GY       +    I E  P    C  G         CG+ A+C++      C+C  G TGNP++ C +      + PC PSPCG N  C   RA Q  C C  G+ GDP     C+ ECL +  C     C   KC+DPC   CG+ A+C  ++H  IC C     GDPF RC   PP P   L  DPC  S CG N  C V+ N + IC+C +DY GDP + CRPECL N DC   +AC+ +KCVDPC G CG+NAEC                                 EP DPC P+PCG NS C        +C C+  Y G+PP+CRPEC  +S C   L C+ ++CV PC G+CG +A+C                                         V+ HNP+C+C  G+IGDP++  C R+P  E       PCEP+PCGS A    +N    C C +D  GDP++ CRPEC++NSDC    AC+ +KC DPC     CGINA C V  NH   C+C   Y G+   ECHK P G+++EE  DPC N  CG +S++      C C+C  GY G+PP+C+P CVV+S+C    AC+N  C DPC    CG N  C V SH   C C P Y+G+P   C K P   I   +  DPC    CG ++ C    +   C C   Y   PPNCR ECV++++CPK  AC+Q KC  PC   CG NADC+V NH  IC+C P Y GDP  +C + P+V QPI    DPC P+PCG N E +       CTC+ G++GDPY+ C  EC  + +CP N+AC SN +C +PCI  CGV A C VI H A C+C     GDPF +C        S+ P     +  E  DPC    CG N+EC        C CL G+  +P     + EC    +CP + AC   KC DPC   C   A C+V NH   C+CP  +TGDP+            PP+P I  V                                   C  N ECP + ACI +RCVDPC S  C   A CT   H   C CP G+          I +     PE                                       RPEC+ + ECP HLAC+ ++C DPC   +CGVNA+CTV  H P+C C L Y GDP + CQ           + E        +PC  + CG N+       V +CSCL  Y G P  +CR  EC+V SDC    AC  ++C DPC   C  NA C V NH   C C PG+ G+ ++ GCS  P+ EP V +                     NPC    PCG +S C+    +     AC+C   Y     N   EC+   E           C   + C N  CI+PC     C   A+C V +H   C CP G TGDP+  C  ++ T      E  D           PC     PCG  A C + N    CTC   + G+P   C   EC+ + DCP D+AC++NKC+DPC   TCG  A+C +  H+  C C  G  G+ I +C      V   ++ D  D + C   +Q                 + +N    C C+P  +G         P      C +  +C    ACI + +C++PC     C  +  C+V + +P    +C C                                  P G +     VG   +C   P  +G        C   S+C ++ AC++ KC  PC   CG+GA C VI H  IC C   + G+P   C ++           +       ++PC   + CG NA C+ R+  + C C  GY GDP+ +C   ECL + +C   K C   +C+DPC+    C  NA C V  H  +C CP G  GDP   C   P   E V                                         EC ++S+C SS ACI   C +PC  +  C  +A C V + VP    IC C  G+  D    C  + T                                    + G         C  + EC  D AC+   C DPC   CG  A C +  H P C C  G +G+P                   C P  C  +  CQ  +  A           P   C P C++ S C S+  C        C  TC +     VR    +C C  GY  +    C                                    +  P + G        CT + +C   +AC    C DPC   CG NA C ++NH P+C C   FYGDP + C+ +         TT   +   C P       PCG +AICQ       C+C P   GNPY+ C   EC  N+EC  D ACI ++C+DPC     C   A C V NH   C C  GY G    SC+++       +  P  T  I     +PC    PCG NA C   +    R   C C+PGY GD  + C P  T    CPA                        ++N    C C  GFV D    C         ++    C  +           +G  C C  +   I     C   PEC ++  C+  + C   NR C DPC    CG  AY    +H   C C  G+ GDP   C  +           +PEI+  C     GV             I  P   G  Y++     P C L               VD      GQN + ++ FH     CD  +  D ++  +
Sbjct:   10 LLTLLGLSTAQRKNE----------VFFVNVEEGFFGCQVNASSEFLQIFTISKLCDGVSDCYKGSDEDQKELKCSNNCLYTTGRRCMNGACLDSQCYCNDGWGGKGCSMPDENECKYRPCDVFAHCTNTIGSYSCSCFPGYTGDGRSCKDIDECAVPALAEKCVANAECCNLPAEYICKCKPGFEGDGLVECLDIDECLLPGSCGVNALCSNYAGNYTCTCQEGYAGNPYDGCVDIDECRSSPCGEGARCINQFGGFVCECPSGSKGDPYT-SCGAQNACSSNPCGLNARCYQEGGFTRGYRCECPQGFTGNPTQQCIDIDECIRSPCGKHATCVNTEGSYQCACEQGLTGDPFTGCSDTDEC-SAHANPCGSGAVCRNTNPGFVCECPPGFSGNGRTGCEATEVRTLCKTNFDCTNNAQCI-NGECSCRPGFTPKGTLCLDIDECAATPGICGTNAACRNTPGSFSCSCLSSFMGNPPNVPCREPCQGVTCSDHAFCRPEQNEAYCVCEDGWTYDPKNLKAGCIDVDECAAN-----SCGENSICTNTKGSFICQCKPGFTGNPLVRCIDIDEC-RNPATCGFGVSCQNTPGSYQCACPSGSVVSPDRPGECLAVKQCAQNDDCPGNAFCSVEKVCNCPEPNQGPNCESPCTNVFCAANSQCTLVNGEPRCMCHQGYQPAGQGKPGCIDINECLGNPCGKGAFCENTQGNYRCSCPKGQNGDPNVICQGEIEAVQCSDSKPCPQGELCSQGKCVCQRGFQRESSGLCRDINECALATSEKPVCGLNGFCKNLPGSYDCECPPGYNGNPFQSCDRCNGPDCGCQAPYSQVGENCVLAGCKNKGDCSEGAECISIAGGVSYCACPAGFNVHP-DGSCVDIDECQATSR-PCGFGALCENKVGSFSCVCPRGTTGDPYSGLCSANQAQCSRDRDCRPNEKCVEPGQCICPPPYFSDTTDGGKCKSPCERFQCGINAECSPTNPPQCLCKTGYSGNPLTGCQDVDECAGNVCGPDARCLNEPGSYKCQCPKGTKGDPYLQGCKGTPAKSECQSDKDCPGQLACQASVCINPCSSLPCGENAVCIPEDHAAWCRCKAGYEENQKGKCTSMCENVICGINAQCIISPQGPTCACSQGTIGNPFPGGSCVPEICSAANPC-PQPLSCVSGKCRERCDQSSCGINAACDADTNKCFCQEGFVGDGNFLCMPPILPPICAPGCGANSHCIYSVPNQCVCNEGYTGNPYQGCSTPLDTKVC---KCGENAECLKENGDQECSCKIGFSGNPFVGCNDINECSDNICGKNAVCINTIGSYDCRCQTEFRGNPFEACFPEEPLV--GDLCDSVQCGPNAVCAAGQCLCQPGFKGDA-EDLVNGCKS-STCSNNLDCGYNEICQSV--KGSYRCIDACSNIQCGPNSRCVTDNHHSTCICSEGFAGNPLIPREGCSKEVTCKKQEDCPPEHVCSINISGKRSCVNPCKIMSCGNFEICSVKDNKPNCHCSSTHVRNPLTGLCELASVPSCTDSNQCGPDQVCQADSLGVLRCTAVCQLFNCPPNSLCRATNHQGFCQCLNGFTGNPNDRTGCSLISRDQCVSDAQCSEEEVC--SLATRKCIPACNKINCGPQAVCITQNHVPKCTCPPGKFTGDPNDLINGCRAVSCLGNADCPPTKFCDRLSYTCMDVCTSDTCGLNAVCLPEQQKPKCSCPPGTKPDPLAEVKCSVLDNCSTRPCHQ-SAICITSAIGYTCSCHQGQVGDPYNTGCFPEGSCPNG---DKDCPGKSICVDSKCKNICYDSCGPNTECSIVNRQAQCQCLKGFIPSPLDSRTCIRDSQGCKTDTDCSGSTCQNGQCRFACRSPSDCLIGEQCTDSMCMISCISSQQCPSNQVCSSGICQIGCRSNENCPASEVCINFQCINPCNKEGACGPNAECRVSGKNVECSCPVGFAGVPTPQQGCVRIPSRCPSGTCQPEHLCQGGMCHFQCKINSNCARGEKCQNGVCVKVCHSDRNCLQGEICIDSTCQPGCNKEEDCRPGEVCQNGNCICDVGFISTPAGCQDINECENSICHPSATCSNVPGSFKCICPPGLVGDPFVKGCTRPNECTTNNDCKPTLACMLDESGFRKCINPCERSQCGPNSNCEVQDHTPFCRCFDKHVGNPSSPLGCTKVECESNNDCSEDKVCQVANNRCIDACTLVNCGKGTCSAVNHTPECRCEPGFIFSVNQCVDIDECQNNPCEPTALCTNTVGAYQCRCPPGTVAD-LNGKCQPSDQCLSDNECPSTATCNNGKCQNPCEIPGSCGADAICTPVNHNPMCSCPARTKGNPNVRCTPLECVSNSDCTSERTCVRNKCVDVCSLPNVCGQNTECKATNHVSRCFCKPGFTGDPTLGCTQLQLCTAEEQCPSGMLCSFGICSPPCKSSRECLDNQICVGGTCASKCQDSSQCPLLHSCQNGFCVQ--ESRCSTDVDCGEQDTCIGRDNGLFECEDVCSGPVICGRNAICTSKSHKAVCTCPDGFFGNPNDEKVGCQRI--QCSKNGDCRGDTVCSKNLCIQPSVSGSCTSNSGCASNEVCERGDC------------------------------------------NDPCTDKRTCGLNAQCAVTNHNKVCSCPPDFTGNPA--VECVRIPSTCYANTDCPETMACTEGICMPSCQTDDNCALNERCLQGLCMLTCRVDNDCFLGHVCLNKMCVVGCRANTDCPESNTCINNRCV--------------------DPCTVDACGPNANCQVVNHRAQCSCPPAYIPNPTPVVGCVKQPVSCSSNAQCPERQVCDGKFCKNVCFNDKTCLVNEVCDNGVCKPLCRHDDDCNSEEICQGVTCVLGCRSAQTCGANQACMDNQCSDPCSSNIA-CGTNALCSVENHLPVCKCPLGLSGDPTKSCTQPIVKC-SASSDCAAGSTCVDGLCASTCEDSSSSCLLNEVCVSGSCRIVCNSNSECGTDQVCKDRFCVAGCTSDNDCGSTEACIQNQCQDACASRRCGSCADCTVSNHKPVCTCPDNMVGNPTQACSGQLRLCSPLFPCPPGSDCQSGVCTTSCSSNANCRCGEQCTEGICRQECTAGVSCTQGHLCRGAVCVPGCQTNADCGQDSHCLGGQCSDPCTSPSSGCAASAECRVSNHRAVCICPQGLQGNPAIECKRVECTQDGDCESNKQCKEGSCINPCALPNACGVNAQCKTIRHAKDCSCPNGFIGNPNIECAKDKNHCLSNPCGANSICQSLVGGYDCRCKTGCTGDPFTGCLC---------GGPLVDPCS-GAVCGLGAECRVQLNQAVCICPESAPNGDPLVECNKDKVGQCSSDSDCSADLSCASGKCIDPCSLRAACGENALCSVVLHKPRCECPQCYVGRPHVRCRPSNDCDNVPTRPQVAEREDCQDDTDCSDSTACVKSTGQCLNPCSSKSCDLNKQCIVTNHKPQCQCKYSLVINQEGALTCPDRQVECRQDNDCPSNQACDQGRCKNPCDNQRICPSGKDCQVLNHKATCVCIEGCNPSVSICLKDRGCPPHQACVNFQCKNPCDDITCPDNTPCEVENHKAVCKFCPEGFIIDANYGCIKGVGCRSNSECPSKQACTN------------------------SKCANPCTVGKCLPNQDCEVVTHRAQCI------DVPRCECTSSRDCPSTSFCRDCEC-------VPDTDAQTC--------DPYEGCTDECSENAECKDDEYCDRNKGSCVPVCPGFCGQNSDCRSANHNPICSCQPGFSGDPDVGCSVIRPPSNPCIPSP-------CGSDALCEVDRGNPICSCPRGKTGNPFVRCIPDGEKCTGNLCGPNSGCRMLGDRPVCYCLPRFEGNPPAIPCMKPAKQCKPNPCGSNTECVVVNNVQRCTCKLGYREAVNTIQGCVPIVE--PVLALCEPGP--------CGDNAECEITDIGEDCTCKPGYTGNPFQGCTL------QNPCTPSPCGPNTECAENRAGQVVCSCRSGYQGDPTSQQGCKAECLDNSACAPSLACIGSKCLDPCPGSCGVFAVCRVEDHNPICSCSQGFSGDPFTRCLQTPPTPQPSLPEDPCNPSPCGTNTQCRVQGN-RAICTCIRDYQGDPTVGCRPECLLNYDCSPDKACVNSKCVDPCPGACGINAECQVLNHNAVCVCKDRYYGDPFQQCSLTPGVINPPEPSDPCSPSPCGPNSECRI-TESRPVCSCKPGYYGAPPSCRPECVSNSDCQQSLACINQRCVSPCVGVCGISAKCD----------------------------------------VVNHNPICSCPTGYIGDPFS-ACNRRPDVEPPRPVSDPCEPSPCGSRANHEVRNGICVCSCPDDLFGDPYLGCRPECLLNSDCSKSQACVQNKCMDPCI--DTCGINAECTV-LNHVPTCTCQRSYTGNAFEECHKQPEGVISEE--DPCGNNFCGSFSEQRVAGNQCICTCQTGYFGSPPNCRPECVVSSECSQDKACLNQRCEDPC-PGRCGVNARCNVISHHPICSCLPDYEGDPFRNCQKKPATIIPPIQPTDPCFPNPCGPNSACRPLGSTPMCSCNPGYQGSPPNCRPECVINDECPKTQACVQQKCKEPCDGACGLNADCTVRNHLAICKCRPGYDGDPFRQCTKVPEVIQPIEAPRDPCYPSPCGANAECQSNQRAASCTCIRGYFGDPYSQCRPECTTNTECPANKAC-SNLKCVDPCINICGVDARCQVINHIATCTCNPGYRGDPFRQC--------SQIPVEP--VVEEPTDPCYPNPCGPNSECRPEGSRPVCSCLLGYFDSPPN--CRPECLLSSDCPLSQACVQNKCKDPCPGTCGANAECKVVNHNPICSCPNRYTGDPFFNCIKEPEVYLPPPQPHIPCVPSPCGPNAMCREVNGHEACTCIQGYIGSPPNCRPECVLNAECPSNKACIQNRCVDPC-SGACGYNARCTAVNHNAICVCPAGYTGDPFNGCSLIPEAITNPPEVVDPCNPSPCGANAECSQFNRAGACKCIPEHIGDPYVGCRPECLINTECPNHLACVQKKCQDPCPG-SCGVNAQCTVRNHNPICTCNLGYSGDPLSSCQL----------IPEVDPIEAETEPCDPDPCGPNSQHKEINGVCVCSCLPTYIGTP-PDCRP-ECVVSSDCSQLTACLEQKCRDPCPGSCGNNARCQVVNHNPICQCPPGYTGDPFS-GCSKIPVTEPTVVERP------------------VNPCQ-PNPCGPYSQCKNSQEI----AACSCLPNYIGIPPNCRPECVINAE-----------CSKDKACLNEKCIDPCPGS--CGPNAECQVVNHQPICKCPVGYTGDPFRECRRDVQTTTVRTTEFLD-----------PCEP--TPCGANALCRSLNRAGACTCEPGYFGDPYLACRP-ECVLNQDCPTDRACVNNKCIDPC-PGTCGINAICITNRHMPVCTCLDGYTGDAITQCSLVPTGVPVVEELDPCDPDPCGPHSQK----------------KEQNGVCVCSCEPDKIG--------SPPNCRPECLVSSECSQSTACIGQ-KCRDPCPGL--CGRNAECRVTNHNP----ICSCLRGYEGDPFSGCNIIPVTTERVTAPIVTDPCEPDPCGRYAQCRNVGEIAACSCLPGYIGSPPNCRPECLIHSECASNLACIDEKCRDPCPGACGSGAECSVIMHNAICRCQAGFEGDPFTGCRRITTIPPPRTSTQR-------IEPCN-PSPCGTNARCMERNGAAACLCIDGYFGDPYTECRP-ECLVHSDCVSIKACQNMKCIDPCISGI-CAPNAVCTVQNHFPTCTCPNGYSGDPFSACKLNPLPTEAVVSDPCEPNPCGSNSNPPRQIGGRCDCSCQSTMIGSPPNCRPECLVNSECQSSQACIGNHCVDPCPGL--CGLNANCRVTNHVP----ICVCHPGFDGDPFSQCFVINTTPAKPEIIDPCRPSPCGVNAECREQRGAASCTCIQNLFGDPYVECKPECTTNPECKSDLACVQNKCIDPCPGVCGVHATCRVNYHTPSCICDPGYEGDPFRSCNFKTTIPPRTEVVDPCNPTPCGDNAICQARNRAAACQCIPEYFGDPYVACRPECVVNSDCPSDKACQRNKCIDPCPGTCGINAQCTVRNHLAMCSCIPGYEGDPFMSCRFRPKTEAAIAEDPCNPNPCGPYSNPPRSLGVECKCSCLPEMTGTPPNCRPECTVNQDCSTDKACQLQKCADPCFGLCGINAFCRVQNHIPICVCNKNFYGDPFLQCQRIT-------TTTRPEVIEPCNP------SPCGINAICQSNTRAASCSCIPDYIGNPYIECKP-ECVVNTECPRDLACIGQKCKDPCP--GVCGVFASCFVTNHLPLCKCDQGYTGDAFVSCQRIT------TLPPRITESI-----DPC-TPSPCGENALCNTRN----RAAACTCIPGYFGDPYVACRPECTINSECPATEACRNYKCTDPCPGLCGTNAVCRVVNHIATCSCNQGFVGDPFVSCQFIPPTFAPVVVEDPCNPNPCGPNSTPPRSNGDTCQCTCQPQMIGSPPNC--RPECVINNECSSDKAC--INRKCEDPCPGL-CGSNAYCNVRNHIPICICNRGFNGDPFYQCNRV------ETTTSQPEIINPCNPSPCGVNAECRQQNLAAACICLPGLQGNPYIECK---PECTLNTECQDHLACVQQKCVDPCPGVCGQNARCKLQFHNPTCICDFGFYGDPFSSCV 6400          

HSP 2 Score: 2200.63 bits (5701), Expect = 0.000e+0
Identity = 2079/6531 (31.83%), Postives = 2766/6531 (42.35%), Query Frame = 0
Query:  178 VCKCKPGFEGDGKVEC----------RDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNP--------------------CGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQ--QGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISC----VDINECQSSSLYQ-----------CGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPG-DYECQCIAPLVGTPPEQPCRDPC-LEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFI-------CGREALCTNQVGSYSCQC---YNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFK------------LSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCV-----------------------CRRGYERNPAGDC---------VDLNECLLGNVCGVNSVCKNLPGSY-DCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNP---------RTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPS-NPPQCLCKAGFTGNPLTGC----------EDLDECALNPCKQGSICINKLATYQCECPPGTTGD---------------PYTNGCSGSKSVE-----CGADDECHGQLACIGSQCI------------------------NPCSSVPCGSNAN------------CVAENHAAW--CRCKSGFAED-------SQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNR--LSCTCQSGFLGDPTLVCMP--------PTQQA--------ECSSECGTNSHC-IYGNPNSCACNIGYFGNPYTGCE-VTTSV------EDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQD-------------------VDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGC----VHLEAVTEDDDLCANQQCGPNAICNLGQ-----CLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSP------TPEVL--CEKNDRGDLCPFGQCQTTCASSS-----QCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFE-NLCQCPEGFAGVP-------TAAQGCVRIPPTCT-------TDC-----PASSLCFNGY-------CMPECTSHGQCARGEQCSNGMCLK----LCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPC--------------DISYCT--------PLATCNV-----------------------------IQHKAFCSCPPKFRGDPTNPKIGCY--------------QVEYPCEGFTCGHGSCHPEDHAPKCHCQDGY--------QLIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKC----------ELL---------------------------------------ECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPR-ECEQ---------------------NLDCPG------DGKCDNFVCVKPH--EKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQ--PTLVPCSSASDCP-QSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQAGLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTK-------NQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCISGC-------GSNRDCPYGEMC------EGGQCR---------------NPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQEC---------VVDRNDCLLPNQCGENAQCLNQLGGF-DCVCRSGCTGDP-------FQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEV-----------EAESTGR----------------------ECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKE----------RLLIN---SAGELICPQQDVQCLYEDQC------------PSTLSCIDGACQNPCQGTS-CPDGKSCQVLNHQALCICTKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSC-----------VKEESCGTTACGPNMACQELYG-QPVCECIPGFVPKYP-VSLGCVEPAD-------------DPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQC-QPVEETPK----DACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPL--------------------------------------PQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYYQC---------IVR-------------------GNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQI----IVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPY-CRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCS--PNPPEPLET-DPC--SACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECS-----------------------------EPI----DPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGI------------------------------------------------CGRNAECKHTNMSSAQCAHFQGQKLASF--------------SSLRRANNPLIVDLLNILG-----HVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAP-PDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPCET--CGQHAICHIHNNIAACKCEDNYIDKP-PNCRRECVLHEDCPKHLACIQYKCASPCI--NQCGKNADCSVINHDPICRCLPQYFGDPLVKC----EPPK---VSQP-------------IDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGC-NYECLIHDDCPYNRACASNHRCSNPCI-GNCGVQAICNVIEHNAICSCPEELEGDPFIRCIPAGCRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYE-GC--------TQYECKRHEECPSTLACRDFKCVDPCD----CAVGANCRVSN----HKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCI-SNPCKNGATCTVNKHEIFCACPNGFLFIGDFECKA--PERPE-CVSDPECPLHLACISERCLDPC-TSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQKA-----GCQSNSECPLSEACINRKCQDPCPFEE-CGRNADCSTNRHVPMCSCLTGYEGNPYEECRQYECLVDSDCPYTLACPNRECIDPCQ-----CAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQAC-FDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQD----HMGKCACPAGMTGDPYVSCLEIVT---GCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQYE----------CIQHNDCPNDKACIDNKCVDPCLETT-CGQRALCKSEFHISHCFCPPGLQGNPIVRC-----FQVECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISE----GRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPC----NCGTGALCDVINHTPICYCPPKYSGNPQIACE----------KLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRS----HQSTCECPPGYQGDPFVKCSTFE------CLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMI-CKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPC----DCGRGAECFLTGHRPVCRCPEGTKGNPLIECTPI---GCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPCACGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKTCPAGSGLILNEFEECVCPPGFVLDSQGICAPCRFDVGFIIENGRCICDYTKGFVLDLSGKKCVCPENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPPPVDIDRPEIVVNCLSDGVGVGLTISDPRYHGLIYVKGHSQDPNCRLRVDEGQNG-QRIDFHVKFGTCDLAYDE 5826
            +C C PGF+GD   +C            ID C  +  CG+N  C    G  SC C+    G+P+  C    EC TNP                    CG+ A C        C C  G  GDP++        P  ++    CN   CG NA+CQ  +    C C   + GDP ++C    V  ++C S    Q           CG+ A C  ++    C C  GY GD   +C                                F+P        D C    NPCG  S      G + +C C+  + GTPP   CR  C +  +C    +CQ+ K    C                              G CG+NA C        CVC K F GDP++ C  I        I       CG  A+C +   + SC C   Y G  Y        E +  C  + EC  +  C           +G  C+D C    C   + C V N LP C+C  G+             L P  R    ID C  +PCG++A+C     +  C C  G  GDP   CR E    CT +S+C   E+C + +C                        C +G+  +P   C         V + +    N CG NS      G    C C     G+P      C  ++  C      I  +C+      C + A C  +   I  C C RG+  +P          T   E I+ C     +PCG  A+C     + +C C PG  G+P+    +  +  C+ N++C+++  C+Q KC+                 PC    CG NA C    + P C+C  GF G+P + C            +D C  +PC   +IC  +     C+C P   GD               P    C  +K ++     CG +  C          CI                        +PC   PCGS               C+ +   +   CR +  F  D       SQ  C   C   +CG NA C V    P C C  G  G+P+    CSL++ +S           +       C    CGVNA C       SC C+  ++G+P + C P        P   A         C   CG  S C +  +  SC+C+ GY GN +  C+ VTT +      + C+   CG NA+CS  +G   CTC   Y G PY  C+                    VD C   +CG NA+C        C C   + G+PF  C    + +E V E+D  C    CGPN+     Q     C C    KG  PN   E       C  N+DC  ++ C+      +R C DPC    CG N+ C   NH   C+C   + GD   P   C  E       +                 +DPC+   C  N +C   +    C C  G   N      +    C  + +CA   +C +       C   C  V C   A C    H   C+C PGY+G+P        F+     +      +EV             C+   CG  AVC  RN    C C    F G+P +  CR   CV N +CP N+ C R    C+DPC   +CG NA C V  H   C C  S+I  P       P+++   E +D  +  P GQ       +       C PG +     C   C+ N+ C + + C   KC DPC   CG NA C       +C C   + G P       T  Q  ++I   C         DC      AS  C   Y       C PEC S+ +C     C N  CL     +C    +C          C+PG   ++      +          P  ++TQ      + C  + CG+   C++  G+  C+C      D   ACR   +C+ + DC    AC  +      KC+DPC               I  CT        P + C +                             I     CSC P+  G P N +  C+              + + PC G    +  C+   H P C C  GY         L  S   ++ +  S +PC  +A CT    +  CTC   M G+PY + CKP  +C  N EC+S+  C   +C DPC G CGI A C V+NH P C C P + GNP   C          E++                                       ECV N+DC + K+C  NKC+D C   G CG+N+ C + NH P C+C  G+ GDP  EC Q                     N   P       D  C   +   P      C+ + +C  D+ C + +C DPC  P  CG+NA C+ +NH  +C C  G+TGN    C R  +T             ++ I + Q  + + C  N  C E +   +C   +D ++G+  ++  CK  C+   +CP  Q+C+N  C DPC    CG  A C V      C C  G+  +    VAC R  IT Q     P   +     C P     + C +N +C  +     C+   +         ++C   C ++P+C +DK C N +CI                    DPC    CG NAECR  NH+A CSC  G  G+P   C+  P ++    A D P     C   +   +    G C                    C   ++     C   C  N+ CPS+  C+  KCQDPC     +CG  A C  +NH   C C  G  GDP+  C          +       + CG    C     A SC    E   G    E  C  +C I  +C +   C+   C+  C        S R   +   C      EG   R               +PCN   C  N+ CQ   R   C C   Y       C + EC  N  C  DK+C+  +CI+ C    +CG NAECR+ NH   C C  G+ G+    C         VV+ + C  PN CG N+    Q+G   DC C     G P            CP+ K     K  C +PC   G CG  A C V NH  +C C   Y G+P   C          EV            AE T R                      EC  ++EC  ++ CI   C DPC    C  +  C    H P C C            R++        E++ P     C     C            P        AC+  C   + CP  K+CQ  N + +     DPC  + CG  A C  V     C C  G  GDP  +C            +E+ C    CGPN +    YG Q  C C+P  +   P     CV  +D             DPC P  CG  A C V  +   C+C  G  GDPF QC +P   TP+    + CQPSPCG+ A C   +   A C C    FG+P   C PEC  + DC    +C   KC DPCPG CG  A+C V+ H P C C  GY GDP+  C +     PP+  +                                      P+C  N DCP+ K C +  CVDPCP  CG NA C+V NH   C C  G+ GDP+  C         +V                    G+R  CSC P   G PPNCRPECV+  DCP D  C+  +C DPC   CG  A C+V  H P+C C  G  G+P+  C +    I+     QPC PSPCG NA+C  +     C C+  + G+P   C+PEC+ + ECP H  C  + C+DPC  VCG+ A C  +NH  +C C    +G+ F  CS    P  P E  DPC  + CG NA C  R      C C  +Y GDPY+ CRPEC  NADCPS +AC    CVDPC G CG+NAEC                              EPI    DPC PNPCG NS     +     C C  + IGSPPNCRPEC  +S CP+   C+  KC DPCPG+                                                CG NAEC   N ++A C    G +   +              ++L    N  I     + G      V  H P C C  G IG+P++  C   P        PC PNPCG+NA+   +     C C  ++ GDP+  C+PECVVNSDC    AC  +KC DPC     CG NA C V   H   C+CL +YVGDP   C   P  +++    DPC    CG  +        C C+C P Y G P  +C+P CV+NSDCP  +AC N  C DPC   VCG N  C V+ H   C C PGY GN L+ C + P         DPC    CG +AI     +   C C       P   CR EC +  DC   LACI+ KC  PC+  NQCG NA C V NH   C C P Y G+    C    EPPK   V+ P              DPC+P  C      R      +C C PG  GDPY  C    C    +CP  +AC     C NPCI   CG++AIC V  H A C CP    GDP+  C    C  D +CP   AC + +C DPC    C VNA C  RSH + C C+  + G+PY  GC         + EC+   +CPS LAC +  C +PC     C V A C V N        C C  G+ GD  +      PP+  +GC+ N+EC +   C    CV+PCI +NPC   A C VN H + C CP+G        C A  P  P  C    +C    ACI   C +PC T+  C   A C        C C    VGDPY +C K       C  + ECP S+ACIN++C DPC  +  C R+A C+T+ H P+C+C  GY G+PY +C + EC VD+DCP    C    C++PC      C   AEC V  H+A C C  G QGN      S          +C+ D DC   QAC F      P      C   + C   +  P+    C C  G   +G   CIR  E +E  C+   DCPP   C  A C +PC +Q PC     C VQ+        C CP      P   C   VT    C SD++C D   C +G+C++ C    DPCG  A C +  H + CTCPI + GNP  +C +            C  +++CP+  ACI+ +C++PC  T  C   A CK + H   C CPPG  G+P V C       V CQ D +C   E C+ R   C   C   SC   A C   NH+ TCFC P   G+  + C      +  GCR D +CP+   CI      G C + C+V NPC S+  C   +        C+CP G+       CI     V C  +  C  D AC++ +CV+PC     C   A C V NH   C CPP + GNP ++C           + ECR D DC D+  C +  C +PC+  + C + A C   +        C C  G+  D    C   +      C  ND+CP  + C+  +C+DPC     CG NAQC V  H   C+CPPG  G+P I C P           C+ D++C    ACI + C NPC   DPC + A C      P R    C+C  G+  D   SC       ++GC +D ECP+D AC N+ C +PC     C R A+C +  H+P CRCP G  G+P I C PI    C  D +C     C  N  C   C  ++PC                S C V+D+ PVR +VC CP GY +++N+ C TLTPI+ GC++DDECG   AC+N ICKDPCACG +A C + +H+PVCTC+DG+ G+P++ C ++ C+ + +C  +H C N  C PVCGP + PCGG+AIC   NH+ VC+CPPGL+G+P V+C  V+C  + +C  D+AC N  C DPC+I++ C + A+C V +H+ +C CPPG+EGT+G +C +V +GC  DS+CPSQTACI++ C NPC +A+PCG NAKCTVLDTLP+RTM C+C+ GY+G+A+I+CTPV TCP G GLILN  +ECVCPPG  LD+QG C  C  ++GF++  GRC+CD +KG V    GK C+CP    +   GIC    EC +D +C+  +YCE  N TCGDPC++WPCG  AYGTP DHRC C+CIEGY G+P + C P+ +  P   D  RP++ VNCLSDGV V + + D  ++G++YVKGHS D  CR  +D  Q G   IDF V+FGTC L +++
Sbjct: 5629 ICVCHPGFDGDPFSQCFVINTTPAKPEIIDPCRPSP-CGVNAECREQRGAASCTCIQNLFGDPYVECKP--ECTTNPECKSDLACVQNKCIDPCPGVCGVHATCRVNYHTPSCICDPGYEGDPFRSCNFKTTIPPRTEVVDPCNPTPCGDNAICQARNRAAACQCIPEYFGDPYVACRPECVVNSDCPSDKACQRNKCIDPCPGTCGINAQCTVRNHLAMCSCIPGYEGDPFMSCR-------------------------------FRPKTEAAIAEDPCNP--NPCGPYSNPPRSLGVECKCSCLPEMTGTPPN--CRPECTVNQDCSTDKACQLQKCADPCF-----------------------------GLCGINAFCRVQNHIPICVCNKNFYGDPFLQCQRITTTTRPEVIEPCNPSPCGINAICQSNTRAASCSCIPDYIGNPY-------IECKPECVVNTECPRDLAC-----------IGQKCKDPC-PGVCGVFASCFVTNHLPLCKCDQGYTGDAFVSCQRITTLPP--RITESIDPCTPSPCGENALCNTRNRAAACTCIPGYFGDPYVACRPE----CTINSECPATEACRNYKCTDPCPGLCGTNAVCRVVNHIATCSCNQGFVGDPFVSCQFIPPTFAPVVVEDPCNPNPCGPNSTPPRSNGDTCQCTCQPQMIGSPPNCRPECVINN-ECSSDKACINRKCEDPCPGLCGSNAYC-NVRNHIPICICNRGFNGDPFYQCNRVETTTSQPEIINPCNP---SPCGVNAECRQQNLAAACICLPGLQGNPY----IECKPECTLNTECQDHLACVQQKCV----------------DPCPGV-CGQNARCKLQFHNPTCICDFGFYGDPFSSCVRTTTPPAVTRPVDPCNPSPCGSNAICSERNHAAACQCIPEYFGDPYVACRPECVVNSDCPSDKACQRNKCIDPCPGTCGINAACRILNHIPTCSCIEGYIGDPFTSCRLVPIPIEPVVAEDPCIPNPCGSYTTPPRNIGGRCDCMCLPQMIGSPPNCRPECQFNADCPLEKTCSQNRCNDPCPG-LCGFNAVCKVRNHVPICICNPGYEGDPF--SQCSLITTTS-----------RPVEVYYPCSPSPCGVNADCTERNGAASCICRLDYIGNPYIECKPECISNSECPRNLACVNEKCRDPCPGICGAFSSCSVQNHAPSCSCDPGYTGNAFIACQRVTTPIIPTQRPDPCNPSPCGLNALCSDRNGAAACTCIEEYFGDPYVACRPECTINADCPSDKACQRNKCVDPCP-GLCGVNAECRVINHIPTCTCIEGYEGDPFSNCRLRPIPIEPVVEEDP-CEPNPCGPNSQFPQRQGDECKCACLPDMKGFPPNCRPE-------CIINSDCQSDQACT------NRKCQDPCP-GLCGINAICRVRNHIPICVCNRNYNGD---PFTQCDPERTTPARPEI----------------IDPCRPSPCGVNAECRERNQAAACTCLPGLFGNPYI---ECKPECTINQECASNLACMQ-----NKCADPCPGV-CGIQATCEVNNHYPICKCNPGYTGDP--------FTSCSLKTTPPPVVTEVVD----------PCNPSPCGSNAVCQNRNRAAACQCIPEYF-GDPYV-ACRP-ECVVNSECPLNKACQR--NKCIDPCPG-VCGINAQCDVRNHIPTCICFDSYIGDPFTECRLRPQIIEAIEADDPCEPNPCGQYSNPPRVNGDRCDCSCRPGMLGLPPNCHPECTLNSDCPDDKACQNQKCIDPCPGVCGVNANCRVRNHIPICACNRNYIGDPFSTCNPTTTTQRPIQIIQPCNPSPCGINADCTERNQAASCKCIRDYTGNPYVECKPECISNQECPSNLACVNQHCLDPCPGVCGAHASCFVTNHSPQCKCDPGFEGNAFYSCQRIT--------TPPPQITQRP----DPCNPSPCGSNALCSDRNGAAACTCIEEYFGDPYVACRP--ECTINADCPSDKACQRN------KCIDPCPGLCGINAECRVINHIPTCTCIEGYIGDPFSNCRLQPIPIEPVIDERDPCDPNPCGPNSYPPQTINGDCKCSCLPEMTGSPPNCRPECFINSDCPSDKACISRKCQDPCPGLCGVNAYCNVRIHVPICICNQGYIGDPFSSCNLPPSTLPNVIDPCSPSPCGTNAVCTERNLAAACTCLPEMFGNPYIE-CKP--ECTINQECASNLACIQNKCADPCPGVCGIQATCEVRNHYPNCQCNPGYEGNPFSACYPKTTLPPKLEVIDPCNPTPCGSNAVCQNRNRAAACQCIPEYFGDPYVACRPECVVNSDCPSDKACQRNKCIDPC--PGTCGINALCTVRNHIPTCTCFQGYLGDPFVECRQPPLIIEPVVEEDPCNPNPCGPNTLPPRLNGDRCDCSCLPLMIGSPPNCRPECVHNQDCPTDKTCRQQKCVDPC--PGLCGLNAYCSVRNHVPICICNQGYTGNPFESCQRPTTT-------------NRPIEIVQPCNPSPCGRNAECSEQRGAASCSCISD-YIGNPYIE--CKPECTVNAECPRDQACLNQHCVDPCPGV-CGAFASCHVTNHLPTCKCDPGYFGDA--FVACQR--ITTQAT---PTEIV---DPCNP-----TPCGSNAICSDRNRAAACQCIPEYFGDPY---VACRPECTTNPECPSDKTCQNMKCI--------------------DPCP-GLCGVNAECRVVNHRATCSCFPGYTGDPFTACRLPPQIIEPIVAEDDPCDPNPCGPNSSPPR-NYGGQC-----------------QCSCLPEMIGSPPNCRPECVINSDCPSDKACINRKCQDPC---PGLCGINARCEVRNHLPLCICLNGYIGDPFFQCNRPITTTPRPEIINPCQPSPCGINAECQERNGAASCTCLPEMF-GNPYIE--CKPECSINPECSDDKACVRNKCVDPCPGVCGTYASCRTISHQPRCTCDPGYEGDPFRYCTRITTAFIPVEVVDPCNPTPCGSNAVCQNRNRAAACQCIPEYFGDPYVAC-RPECVVNSDCPSDKACQRNKCIDPCP--GTCGINAECRVLNHVPSCTCIVGYIGDPFSACRQPPLIVEPVVEEDPCN-PNPCGANSNPPRQIGDRCDCSCLPEMIGSPPNCRPECVVNSDCPSDKACINRK--CQDPC--PGLCGINANCNVRNHVPICICIPGYVGDPFSQCNRPLTTPRPIEVVQPCNPSPCGINAECTDRGLAASCSCIRDYIGNPYVECKPECTVNSECPRDKACINNKCGDPCP-GVCGAHATCYVTNHVPMCKCDPGYTGDGFISCRIITTLPPRQPEVVDPCNPSPCGSNANCQARGTAAACQCIPEYFGDPYVACRPECTTNAECPSDKACQ--NQKCV-----DPCPAANCGINAKCSVVNHIPNCVCDPGYIGDPFQACRLPPLPIEPDIAEEDPCVPNPCGPNSSPPRNYGGQCQCSCLPEMIGSPPNCRPECVVNSDCPSEKACINRKCQDPC-PGLCGVNAYCNVRNHVPICICNQGYIGDPFSQCYRPTTTTPRPEIINPCQPSPCGTNAECQERN-GAASCRCLPELFGDPYVECKPECTINPDCAYTLACVRNKCIDPCPGICGSHATCSVQNHSPICTCDPGYVGDPFTSCYIRPTAPPPLEIIDPCNPTPCGSNAVCSDRNRAAACQCIPEYFGDPYVACRPECVINADCPTNKQCRNMKCVDPCPGLCGSNAYCQVANHIPICVCNQGYIGDPFVSCRKEPLPIEPVVEEDPCYPNPCGPNSNPPRQIGDRCDCSCLPEMIGSPPNCRPECVVNSDCPSDKACINRKCQDPCPGLCGVNAYCRVRNHVPICVCNQGYIGDPFSSCNLPPSTILPVEVAQPCNPSPCGINALCNDISGATSCTCIRDYTGNPYIECKPECVVNAECPRHLACVNQHCVDPCPGVCGVYATCSVQNHFPVCRCDPGYEGNAFVACSRFTTPLAPTEVIDPCNPTPCGENAICTDR-QRAAACQCIPEYFGDPYVACRPECTINADCPSTKACQNLHCVDPCPGVCGINAECRVINHIPSCTCIPGYRGDPFTACSSIPSTVEPIIAEVDPCNPNPCGPNSNPPRQIGDRCDCSCLPEMIGSPPNCRPECVINSDCPSDKACINRKCQDPCPGLCGVNAYCNVRNHVPICICNQGYIGDPFSNCYTPPTTTFRPVDPCRPSPCGINAECSDRNGAAA-CTCLPGLQGNPYVECKPECSINPDCPTTLACVQNKCIDPCPGVCGVGASCTVQTHRPNCRCDPGLIGNPFS-ACYPPPTTPPPPRDPCNPNPCGANADPAVRGNRCECTCRPEFFGDPYSGCKPECVVNSDCTMDKACSRNKCIDPCPG--VCGFNAECRVLT-HSPVCTCLPNYVGDPFRGCSLEPEPVIS----DPCVPNPCGAGAITRRVGDDCECTCPPEYRGDPYVECKPECVINSDCPDTMACRNLHCYDPC-PGVCGRNAVCEVRRHSPVCSCLPGYIGNALVECTQPPRPDPVV--VDPCNPNPCGINAIARPSGSYCQCTCPSGLQGDPYSECRPECTIDSDCSTTLACIEQKCKDPCVYNNQCGINAICEVRNHRANCICPPGYEGNAYQLCTPIREPPKPECVTDPECPLHLACIGQKCRDPCIPEQCAATAICRVNNHRAVCVCPPGLEGDPYRACIEPGCKSDFECPLTQACIQ-KECQNPCIYEQCGIEAICEVRTHQAKCVCPPSYLGDPYQVCRKPECIVDDDCPQVLACENEKCVDPC---ACAVNANCIVRSHRARCQCITSYIGDPYNTGCYPVPEPDIAEPECRVDSDCPSRLACLNEHCQNPCTTLSPCGVNAECTVQNTLPQRTMICMCLAGYVGDANTLCS--LPPVPVLGCKSNNECGNDEICREGNCVNPCIVANPCATTANCEVNTHRLTCTCPSGTTGDPFTNCYAILPRPPRRCKVSGDCSNPDACILTLCTNPCFTNNPCDQTAVCKPYNRTAYCYCTAGLVGDPYQLCFKPIEPRPECTEDPECPDSQACINQRCIDPCIVQNPCARDAICTTHVHHPVCTCAEGYGGDPYTQCYRPECRVDNDCPLDKTCIQEHCVNPCTSTQTPCGRGAECRVDFHQARCVCPVGLQGNPLVACIS---------VECQVDQDCRDDQACEFLSQTCVPVCKQDTCTQDATCTPANHQPQ----CTCNPGARGSGFVACIRPPEVVEAECKVDDDCPPRYACIQAQCTDPCLSQ-PCHPTQTCTVQNSSPIRTVICTCPEDTFIGPNGDCKPKVTPRPSCLSDNDCPDSHKCLDGSCRDACL--VDPCGSNAICKSRLHASSCTCPIGYTGNPKVQCLKITPDLVEPLEPGCRDNSECPDYNACINRQCLNPCAVTDPCATNAYCKVQNHEPVCTCPPGYIGDPRVSCTPPVPVLVGCQSDDECPQTEACNNR--DCVDPC---SCGVNAQCFVSNHKPTCFCPPGFTGNPEIKC------VPVGCRSDPECPNTEVCIISNNGIGDCVDACVVNNPCASNAICYSTN----HQAACKCPPGLEGDPYKQCI----RVECRINDDCSQDSACISNRCVNPCLYENPCAPSATCTVQNHIAKCTCPPGWVGNPLVSCSPKESPSVPDPEPECRVDGDCPDNTACLNERCENPCIALSPCDVTAICSVVNSLPFRTMICSCREGWVPDTDTSCRPVDLPAPSGCSRNDDCPNGQACINRKCMDPCD----CGSNAQCFVEGHRPVCRCPPGFVGNPLIACEP---------VGCQNDNECRDGEACISRECVNPCLVQDPCGRFAEC-----YPARHKANCQCIPGYEGDPFVSC------EVIGCRQDPECPQDKACRNKDCINPCLYENPCARNADCLVANHKPECRCPIGFTGSPFIACVPIPTPECVEDKDCPSRHGCIDN-KCELLCETRAPCTH-------------PSVCSVIDSFPVRTMVCTCPDGYVSDDNSSCKTLTPILAGCSTDDECGQPDACVNKICKDPCACGDHAFCRVISHKPVCTCEDGYEGNPDVACIQIECRLDDDCLDSHACRNEKCRPVCGPGNAPCGGEAICTATNHEAVCSCPPGLKGDPKVTCFAVDCTSDIDCPGDKACYNGLCVDPCSITNPCSEPAECTVADHKPNCECPPGFEGTKGTACSRVDIGCRSDSECPSQTACINQECINPCAVADPCGENAKCTVLDTLPVRTMVCICITGYQGNAAIRCTPVPTCPPGRGLILNAADECVCPPGHYLDNQGNCVRCPVELGFVLNGGRCLCDSSKGLVPSEDGKACICPPGMELGPGGICVPILECVIDDDCSNIKYCELNNNTCGDPCVRWPCGVNAYGTPLDHRCVCKCIEGYIGNPVDGCVPVPIKPPTKTDFPRPDLTVNCLSDGVLVDINLRDKNFNGVMYVKGHSNDERCRQAIDVQQTGIDNIDFKVQFGTCGLFHND 11742          

HSP 3 Score: 523.087 bits (1346), Expect = 5.229e-144
Identity = 777/2991 (25.98%), Postives = 1140/2991 (38.11%), Query Frame = 0
Query:   48 QLFEISKLCDGVPDCYRGSDEANSQIKCTKDCLYTTGRHCQHGACLDSQCYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHC---------KDIDECQIPELANTCVQNAECCNLPAHY----VCKCKPGFEGDG---KVECRDIDECLTNQ-------------VCGINTLCINTHGNFSCECLPGFHGNPHDGCVD----------IDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPY-QGACQAQVAPSVSQQGCNAQS---------CGQNALCQRSSNGLICTCREGFTGDPKISCV----------DINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEP-VKVRTTCSSDFDCTN-------------NAQCLPNGS---CACRKGFQPNG-VLCQD--------IDECQSTENPCGANSICLNVPGDY-ECQCIAPLVGTPP-------------------EQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKE---ISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENR------------------FICGREALCTNQVGSYSCQC---YNGGQYDPSS-----LSCQEKRRSCQSDQECIGNAVCFN----GACNCQEPYVG-------PNC--------EDACRDATCFP--------NSQCLVQNGLPFCQCLPGFKLSPNGR----------SCIDIDECAGNPCGQDAICENLLGSFV-CKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSR-----------------------CVCRRGYERNPAGDCVDLNECLLGNV-------CGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTK----NCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAEC-TPSNPPQCLCKAGFTGNPLTGCE------DLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNC----------VSLCNQVICGSNAQCIVSPSGPTCQCF--EGMVGNPYP--GGHCSLLS-CSSASPCLEQGQTCQGGRCITQC-GQEQCGVNAFCDP--NRLSCTCQSGFLGDPTLVCMPPTQ--QAECSS----------------------ECGTNSHCIYGNPNS-CACNIGYFGNPYTGCEVTTSVED-----------------CDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFS------------------VCGKNAQCINTPGGYDCRCHSDFVGNPFE-GCVHLEA--VTE-----DDD-----LCANQQ----------CGPNAICNLGQ--------CLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQ-CGPNSFCITDNHQKSCICQDGFTGDANDPQRGC-----QREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMS-CPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLA----DSDCAQGHSCNEVSFGM-KNCVPACDLVN-CPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPP-----SFIPSPTPEVLCEKNDRGD-------LCPFGQCQTTCASSSQCPPGQIC--------KSGICA--------------------AGCSSNTHCEEGRVCITGKCQDPC-TETCGPNALCSPEFE-NLCQCPEGFAGVPTAAQGCVRIPPTCT----------TDCPASSLCFNGYCMPECTSHGQCARGEQCS----NGMC--------------------LKLCHTDKNCLQGEICVDK-----------------------FCEP-------------GCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSD-LNEC-KNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISY-CTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCH----CQDGYQLIGSNCQDIDECASGNPCHNSAKCTNEQG----SYQCTCHDGMVGDPYTQGCKP-----KAQCYSNSECSSDTRCQNGRCVDPCDGFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPRECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPS-TCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLD-KMCKV------GCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCF-ADSDCEANELC----HGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSY-CGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVC 2561
            Q    +  C  +P+ Y G      + +CT +    + + CQ+  C+D     N G   K              C V  +  N      C C+ GY GD F            DI E + P + N C  N+   + P +Y     C C P   G     + EC    +C + +             +CG+N  C   +    C C  G+ G+P   C            I+ C+ +PCG  A+C    G   C+C   L GDPY +   +  + P  +      ++         CG +A C   ++  ICTC  G+ GDP  SC            I+ C  +    CG  A+C +++    C+C   Y GD   AC P   +   C ++  C N             NA C        C C +G+  +  V C+         ++E     NPCG NS      GD  +C C+  ++G+PP                    + C+DPC  + CG  A C++      C+C +G+  +P     +    +   E  +  +P+  CG+NA+C++  G+ +C C + + G+PYI C    EC  N                    +CG  A C+ Q     C+C   Y G  +   S     L+  E    C     C  NA+C +     AC C   Y G       P C          AC++  C          N++C V N +P C C+PG++  P                ++D C  NPCG ++     +G    C C     G P   CR     EC  +S C   ++C++ +                       C+C +GY  +P  +C          V       CG+N+ C +  G+  C C  G QGNP+  C+     +  C      ++ +C       C   A C  +      C C  G   NP +                   PCG+ AD         C+C P   GDP+ G     +  C  NS C  ++ C + KCI                 PC    CGFNAEC   ++ P C C   + G+P  GC         D C  NPC  G+I        +C CPP   GDPY          EC  + +C   +AC    C +PC  V CG NA C    H+  C C  G+  ++   C          V  CN   CG NA  I  PSG  CQC    G+ G+PY      C++ S CS+   C+EQ       +C   C    QCG+NA C+   +R +C C  G+ G+   +C P  +  + EC +                      +C   + C   N  + C C  G  G+PY  C       D                 C   +CG  A+C   + + +C C   Y G PY+ C+   EC+                     C  NA CI       C+C + ++G+P+  GC  +    + E     D D      C N+           CG NA C +          C+C +G+ GD              C++N +CG +EIC          C +PC  A  C   + C  + H+ +C C  G TG   DP   C     +   +C  + DC     C +       C +PC   + C     C   +    C C +G     L G  D YQ C        +C +   C +    + + C+  C + N C   A C +  H   C C  GY G+P  +       + +C  + +C   + C + +    C    +   CG GA C V  H  +C+CP GL  GNP +  C  V C  ++DC D++ C+ LS TC+  C+ + C ++A CT A HQ +C C P      F+    P  + E   + D        C   QC   C S   C P Q C        ++ IC                       C S+  C +   C+ G C+D C  + CG NA+C      + C CP G+ G P     C++I P             ++CP  + C N  C+  C     CA    C       +C                    L  C +D  C Q E C ++                       FC P             GCR+D +C   EVC             ++ +G  D ++ C  NN C +   C +T     C CP     D    C    +C  + DC+   AC+++      +C++PC     C P ATC V  H A C+CPP + G   NP + C   E P              D  P+C     C D    +   C+  + C + +PC  +A C+        +  C+C +G V D  T  C+P      + C  N +C +   C N +C+DPCD  CG  A+C V+ H P C C P + GNP I CE + C  + +C   ++C++ +CV+ C +   CG  + C  + H   C C  G+ GDP                    V      C  D  C  D+ C   +C +PC   N C  NA C   NH+  C CP GFTG+  + CV IP+  C+ D +CP    C  + C   C++   C     C          +   C  G+V  D   CK       GCS   +C    +C+N  C+DPC    CG +A C+VI  +  C C+ G+  NP   VAC +  I C+ +  C ++  C    C+PVC   ++ C    +C    H  +C   C    +   K  C  + C+    SD DC  DKAC+N  C+                    DPCS++  C   AEC   +H+  C CP G EG     C    + C S S+CP    C    C+  C +   C +N  C
Sbjct: 8698 QARGTAAACQCIPE-YFGDPYVACRPECTTNAECPSDKACQNQKCVDPCPAANCGINAK--------------CSVVNHIPN------CVCDPGYIGDPFQACRLPPLPIEPDIAE-EDPCVPNPCGPNS---SPPRNYGGQCQCSCLPEMIGSPPNCRPECVVNSDCPSEKACINRKCQDPCPGLCGVNAYCNVRNHVPICICNQGYIGDPFSQCYRPTTTTPRPEIINPCQPSPCGTNAECQERNGAASCRCLPELFGDPYVECKPECTINPDCAYTLACVRNKCIDPCPGICGSHATCSVQNHSPICTCDPGYVGDPFTSCYIRPTAPPPLEIIDPCNPTP---CGSNAVCSDRNRAAACQCIPEYFGDPYVACRPECVINADCPTNKQCRNMKCVDPCPGLCGSNAYCQVANHIPICVCNQGYIGDPFVSCRKEPLPIEPVVEEDPCYPNPCGPNSNPPRQIGDRCDCSCLPEMIGSPPNCRPECVVNSDCPSDKACINRKCQDPCPGL-CGVNAYCRVRNHVPICVCNQGYIGDPFSSCNLPPSTILPVEVAQPCNPS-PCGINALCNDISGATSCTCIRDYTGNPYIECK--PECVVNAECPRHLACVNQHCVDPCPGVCGVYATCSVQNHFPVCRCDPGYEGNAFVACSRFTTPLAPTEVIDPCNP-TPCGENAICTDRQRAAACQCIPEYFGDPYVACRPECTINADCPSTKACQNLHCVDPCPGVCGINAECRVINHIPSCTCIPGYRGDPFTACSSIPSTVEPIIAEVDPCNPNPCGPNSNPPRQIGDRCDCSCLPEMIGSP-PNCRP----ECVINSDCPSDKACINRKCQDPCPGLCGVNAYCNVRNHVPICICNQGYIGDPFSNCYTPPTTTFRPVDPCRPSPCGINAECSDRNGAAACTCLPGLQGNPYVECKPECSINPDCPTTLACVQNKCIDPCPGVCGVGASCT-VQTHRPNCRCDPGLIGNPFSACYPPPTTPPPPRDPCNPNPCGANADPAVRGNRCECTCRPEFFGDPYSG----CKPECVVNSDCTMDKACSRNKCI----------------DPCPGV-CGFNAECRVLTHSPVCTCLPNYVGDPFRGCSLEPEPVISDPCVPNPCGAGAITRRVGDDCECTCPPEYRGDPYVEC-----KPECVINSDCPDTMACRNLHCYDPCPGV-CGRNAVCEVRRHSPVCSCLPGYIGNALVECTQPPRPDPVVVDPCNPNPCGINA--IARPSGSYCQCTCPSGLQGDPYSECRPECTIDSDCSTTLACIEQ-------KCKDPCVYNNQCGINAICEVRNHRANCICPPGYEGNAYQLCTPIREPPKPECVTDPECPLHLACIGQKCRDPCIPEQCAATAICRVNNHRAVCVCPPGLEGDPYRACIEPGCKSDFECPLTQACIQKECQNPCIYEQCGIEAICEVRTHQAKCVCPPSYLGDPYQVCRK-PECIVDDDCPQVLACENEKCVDPCACAVNANCIVRSHRARCQCITSYIGDPYNTGCYPVPEPDIAEPECRVDSDCPSRLACLNEHCQNPCTTLSPCGVNAECTVQNTLPQRTMICMCLAGYVGDANTLCSLPPVPVLGCKSNNECGNDEICR------EGNCVNPCIVANPCATTANCEVNTHRLTCTCPSGTTG---DPFTNCYAILPRPPRRCKVSGDCSNPDACILTL-----CTNPCFTNNPCDQTAVCKPYNRTAYCYCTAG-----LVG--DPYQLCFKPIEPRPECTEDPECPDSQACINQRCIDPCIVQNPCARDAICTTHVHHPVCTCAEGYGGDPYTQC-----YRPECRVDNDCPLDKTCIQEHCVNPC--TSTQTPCGRGAECRVDFHQARCVCPVGL-QGNPLV-ACISVECQVDQDCRDDQACEFLSQTCVPVCKQDTCTQDATCTPANHQPQCTCNPGARGSGFVACIRPPEVVEAECKVDDDCPPRYACIQAQCTDPCLSQP-CHPTQTCTVQNSSPIRTVICTCPEDTFIGPNGDCKPKVTPRPSCLSDNDCPDSHKCLDGSCRDACLVDPCGSNAICKSRLHASSCTCPIGYTGNPKVQ--CLKITPDLVEPLEPGCRDNSECPDYNACINRQCLNPCAVTDPCATNAYCKVQNHEPVCTCPPGYIGDPRVSCTPPVPVLVGCQSDDECPQTEACNNRDCVDPCSCGVNAQCFVSNHKPTCFCPPGFTGNPEIKCVPVGCRSDPECPNTEVC------------IISNNGIGDCVDACVVNNPCASNAICYSTNHQAACKCPPGLEGDPYKQCIR-VECRINDDCSQDSACISN------RCVNPCLYENPCAPSATCTVQNHIAKCTCPPGWVG---NPLVSCSPKESP-----------SVPDPEPECRVDGDCPDNTACLNERCE--NPCIALSPCDVTAICSVVNSLPFRTMICSCREGWVPDTDTS-CRPVDLPAPSGCSRNDDCPNGQACINRKCMDPCD--CGSNAQCFVEGHRPVCRCPPGFVGNPLIACEPVGCQNDNECRDGEACISRECVNPCLVQDPCGRFAECYPARHKANCQCIPGYEGDPF-------------------VSCEVIGCRQDPECPQDKACRNKDCINPCLYENPCARNADCLVANHKPECRCPIGFTGSPFIACVPIPTPECVEDKDCPSRHGCIDNKCELLCETRAPCTHPSVCSVIDSFPVRTMVCTCPDGYVSDDNSSCKTLTPILAGCSTDDECGQPDACVNKICKDPCA---CGDHAFCRVISHKPVCTCEDGYEGNPD--VACIQ--IECRLDDDCLDSHACRNEKCRPVCGPGNAPCGGEAICTATNHEAVCS--CPPGLKGDPKVTCFAVDCT----SDIDCPGDKACYNGLCV--------------------DPCSITNPCSEPAECTVADHKPNCECPPGFEGTKGTACSRVDIGCRSDSECPSQTACINQECINPCAVADPCGENAKC 11489          
BLAST of GH13743 vs. nr
Match: gi|1101398104|ref|XP_018910035.1| (PREDICTED: uncharacterized protein LOC109039134 [Bemisia tabaci])

HSP 1 Score: 2959.47 bits (7671), Expect = 0.000e+0
Identity = 2330/6659 (34.99%), Postives = 3156/6659 (47.39%), Query Frame = 0
Query:   97 CYCNDGYGGK---GCDMPDTNECKYR-PCDVFGYCTNTLGSFFCSCNEGYEGDGFH--CKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRT-NPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNG--DGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGA-CNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFK-LSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLS-GC-RGESTFECTQDSQCDQGESCL------SSRCVCRRGYERNP-AGDCVDLNECLLGN---VCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAP--AKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQ-GKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCS------GSKSVECGADDECHGQLACIG---------SQCINPCSSVPCGSNANC-VAENHAAWCRCKSGF-AEDSQGNCVSL-----CNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCG-QEQCGVNAFCDP--NRLSCTCQSGFLGDPTLVCMPPTQQAECSSE-CGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSVCGKN-AQCINTPG-GYDCRCHSDFVGNPFEGCVHLEAVTEDDDLC-ANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSC-ICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMS-CPTNEKCMVSDGMPICL---------------------------------------CNSGFEKNKLTGSCDVYQG-------CLADSDCAQGHSCNEVSFGMKNCVPACDLV-NCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGL----FVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFENL-CQCPEGFAGVPTAAQGCVRIPPTCTTD-CPASSLC--------------FNG----YCMPE--------CTSHGQCARGEQCSNGMCL---------KLCHTDKNCLQGEICVDKFCEPG-CRTDSDCRLGEVCGAGGQCSCQPGY---EMTQSGCSD-LNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQ-------CSSDQDCNDA---------LACLADSLSGAKKCLD-PCDISYCTPLATCNVI-QHKAFCSCPPKFRGDPTN--------------PKIGC--YQVEYPCEGFTCGHG-SCHPEDHAPKCHCQDGYQ---LIGSNCQDIDECASGNPCHNS-----AKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCD--GFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKC-----------ELL---------------------------------------ECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPRE--------------------CEQNLDCPGDGKCDNFVCVKPHEKS--------CLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQAGLVCIDRQCVGGCSSNTQCPSE----SVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGF------CLQQCQIASDCQNGAECIEGVCI----SGCGSNRDCP---YGEMC--------------------EGGQCRNPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDR--------NDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGC--QCPTPKDSCRT----KGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICTKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCV------------KEESCGTTACGPNMACQELYGQPVCECIPGFVPKYP-------------VSLGCVEPA-DDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVE------ETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRV----PKPPIRPLP-------------------------------QCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYY-----------------------------QCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDP-PYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNP---PEPLETDPC--SACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAEC------------------------------SEPID----PCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNE----GCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEII--DPCANRECGPYSQKVERNGICTCSCLPGYVGAPPDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPT--GTITAEERDPCET--CGQHAICHIHNNIAACKCEDNYIDKPPNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVS-----QPIDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRCIPAGCRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQYECKRHEECPSTLACRDFKCVDPCD--CAVGANCRVSNHKTTCTCPPGFTGDPY--------SRDDP--PRP--------------PILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFLFIGDFECK-----APERPECVSDPECPLHLACISERCLDPC--TSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQKAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCS-TNRHVPMCSCLTGYEGNPYEECRQYECLVDSDCPYTLACPNRECIDPCQCAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSCLEIVTG---CKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQVECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVG---CESSSKCKADQACLNAKCVSPCN---CGTGALCDVINHTPICYCPPKYSGNPQIACEKL---------ECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKC------STFECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPCD---CGRGAECFLTGHRPVCRCPEGTK-GNPLIEC-------TPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCH---------------VVDTSP---------------VRRI--------------------VCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPCA----CGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCS---TVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVEN----HQVDCTCPPGYEGTRGNSCKK----VVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKTCPAGSGLILNEFEECVCPPGFVLDSQGICAPCRFDVGFII-ENGRCICDYTKGFVLDLSGKKCVCPEN--HSINDNGICEEEPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPPPVDIDRPEIVVNCLSDGVGVGLTISDPRYHGLIYVKGHSQDPNCR--LRVDEGQNGQRID-FHVKFGTCDLAYDEDGYAHFILVI-GHAKLMTYKSQAYRIRCIYSTGEQNISHGFNVSILTTAGTIANTGPPPTCIMRICNSNGEDISQAEIGDKLMLKVEVSPGEIYGGFARNCIARTVDETNEETVYTVTDDNGCATDPSIFKDWEYNRDKGYLSAVFDAFKFPNSNTIKFKCNIRVCFGQCQPQNCAGRNAFGRRRRE--------SEHEIAGTVYTGQLREEIKIESNAILAIERKAKRLQ---DNLQNRYIGNEEVCVSKIGFIIALVITALLALVAVAIAVSCWLMAYRRRPRTEGPLPHPPEFPNPLFTTPEPLAEPTPDY 6128
            C C  GY G    GC   D NEC+Y+  C +   CTN  G   C C  GYEGD +   C DI+EC    L N C  NA C N P  + C C  GF GD    C D+DEC+    CG+ + C+NT+G+FSC+CLPG+ G P   C+DI+EC   N CGI AKC N  G+Y C CP G SG   Q  C+       +   C+A  CG+NA+C  +    +C+CR+ +TGDP   CVDI+EC       CG  A+C N  PG+ C CP G+ G  D   ACE V V   C+ + DC  +A+C+  G C C  GF+  G LC DIDEC S   PCG  S+C N  G ++C CI   VG PP+ PC+ PC ++ CG+ A C+  + +A+CICEEGW ++P ++S+GC+DI+ECD+     G+CG+N+IC+NS G FNC C +G++G+P+  CFDIDEC +N   CG  ALC N VGS+ C C      DP   +      +C+ D++C GNA+C++   C+C EP +G +C + C   +C  N++C++ N  P C C PGF   +P+G  C+DIDEC  NPC   A+C N  GSF CKCP GT GDP   GC + +    C  ++ C   E C+       S C+C+RGY R+   G C D+NEC       VCGVN++CKNLPGSYDC+CP G  GNPF SC+ C+ S C C  PYQ + G C LA C N + P  A+C+ I G +SYCACP+G+        CEDIDEC  I    CG GA+C+N  G + C C  G  GDP+   C P +  C ++  C+ NE+C+Q G+C+C PPF  D +DGN CKSPC   SCG NAEC P +PP+C+C+ GFTG+PL GC D+DEC  +PC  G+ CIN+  +Y+C+CP G TG+   + CS       ++  +     EC     C G         +  ++ CS   CG NA C +       C C   F   D    C +      C    CG  A C++  S  +CQC  G VGNP          CSS S C +  +TC   +C+  C  +  CG+NA C+P  +R  C+C + ++G P   C   +  +  SS+ C  NS C    P++  C  G+  NP         +++ + L C ++  C   + KP C C+ GY          V+E    +C  N  +C+N      +  C+     +P E             LC AN+ C  + + +   C+C    +           S+ + C  ++ C  +  C       +  C +PC    C   S C  ++H+  C  C  GF+ D+   + GC R   C  NE+C     C  N      C +PC + + C     C V +  P+C+                                       C  G   +  TG+C    G       C +DSDC +  +C +       C   C L   C   AEC    HR  C+C PGY G+P  +  C +     C +NA+C+  E C     Q  C     +  C   A+C   NH   C C +G     +VG  ++    + SC  N DCP ++ CDRL+  C++PC  + CG NA+C    H   C+C   F  +P                       C S  QC                ++  C     CI GKC +PC   CGPNA+C   F    C+C  G++G PT   GC+     C  + C   +LC                G     C+PE        C  +  C      +   CL         K CH  KN           C P  C  ++ C L  +     +C+C PGY     T  GC +  N C+ N CG G  C +   +  C CP   + +   +C +P +       C  + DC            +    D  +  +     PCD + C P A C++  + K  C+C     GDP +              P   C  ++   PC G  CG G SC  E H P+C C  G     LI      +    S NPC  +       C+  +    C+C    +GDP + GC+   +C  NS+C S+  C +  C DPC     CG+GA C+ K+H   C C   + G+P I+C           E L                                       +C+ ++DC  + +C+  KC+D C  SG CG  ++C + +H P+C+C  G  G+P E                    C  N  C         VC   ++ +        C+++ +C     C  ++C+DPC    ACGVNA C + NH  VC CP   +G+  V C             P S  C  S           C  N RC   K          C  G+  +  +CK  C    +CP SQ+CIN +C DPC    CG NA C  I     C C  G++ +P   + C   P      ++ P+    D + C P     S C +N +C       VC     C      +   C   C    +C  D+AC   +C                     DPC+ S CG NA+C   NH   CSC  G EG+         V CSS     Q+   +     + C     C   +      C+     N               GGC      PS+      C+   C+DPC     VCG  A C   NH  QC C  G  G+P+QSC+    +    KN C S +     +C  S +  A C    SC   F      C  +C  + +C     C+   C+      CG    C    +  MC                    E  +  NPC    C  NS C +  R  +C C  G   L +    + EC+ +  C    +C   +C + C ++  CG N++C + NH+  C C  G+ G+    C   R         D   P  CG NA C+N  G   CVC SG  G+P  GC  +C +  D   +       C++PC    +CG +A+C V  H+ +C C + + G+P + C       + P                            ++PC    C  N +C     +  C+C  + + N       P+   +C     CP+  +C++  C NPCQ T                            CG  A C     N IC CP    GDP   C                SC  + CGP+  CQ +  +PVC CIPGF+   P               L CV+    DPC P  CG  A C V+ +   C C  G  GD F+ C P+       ET  D C  SPCG  A C      +  C C   Y GNP   C PEC  + +C   ++C   KCQDPCPG CG  + C V  H P C C +G  GDP+  C +       PK    P P                               +C  + +CPS + C +  C+DPC   CG+ A C V NH   C C P   GDP+                               C V G   VCSC P + G PP+CRPEC+I  DCP +  C+  +CV+PC  +CG  A+CQV+ H   CSC  G TGNP+ +C  I +     PC PSPCG NA C+  +    C C+P + G+P   CRPEC+ D +C S+  C   KC DPC + CG  A+C   NH   C C     GDPF  C+P P    E    DPC  S CG N+ C  + N+Q +CSC  +Y G P   C+PEC++N +CP ++AC   KC +PC G CG+ A C                              S PID    PC P+PCG NSVC   +   A C C + +IG+ PNCRPECT  S C     C+  KC DPC G C  NAEC+                                        V  H P+C+C+EG+ GDP+++      I +P   +    PC P+PCG+NA+C +    G+C+C   Y GDP+  CRPEC +NS+CP   AC + +C +PC     CG +A C+V N H   CSC     G+P   C    S  V  + +  D C    CGP S     NG   CSC PG +G+PP C+P C+V+++CP   ACI + C DPC    CG N  C V +H   C C PG+ G+P   C   P   G + + E +PC+   CG ++ C +      C C ++Y+  PP+CR  C +  +CP HLACI  KCA PC   CG NA CSVINH P+C CL  Y GDP   C   +VS        DPC P+PCG N   +      IC C+  + G+PY GC  ECL+  DCP N AC  N +C +PC G CG  AIC V  HN IC+CPE   GD F  C     +SDS    +          PC    CG NA C   ++ + C CL  F G+P +   + EC    +CP   AC   KC DPC   C   A C V NH   C+CP    GDP+           DP  P P                +   C  N +CP   AC + +C DPC  + C   A C    H+  C CP GF       CK     A  R EC SD EC    AC+S  C +PC  +S  CG+NA+C V  H P+CAC+  ++G+    CQ+AGCQ NS C   EACIN +C +PC F +CG NA+C   N H   CSC   + G+P  +C + +C  + DCP  LAC N+ C++PC CA NA C V +H  +C C PGF GN Y    S ++ P+     CKQD DCPSR  C  GDC++PC+ ++PCG ++ C+V +T+P RT++C C  GY  + + +C R    +E GC+   +C  S+VC N  C+NPC    PC+  A+C   +H   C CP G+ GDP+V+C +       C  D +C    AC N  CQ+PC    + CG  A+C  S HR VC CP +W G+P  +C++ EC  + DC  DKAC++N C+DPC ETTCG+ A CK + H + C CP G QG+P++ C  V CQ + DCAD+E CD     C+ +C  ++C + A C A NH+ TC C P   G+    C+    P    C  D DCPS+ ACI++ RC+NPCL  + C  +Q C+V+DT P R+VVC+CP        GSC           C SS +CK ++ C    C   C    CG  A C    H  +C CPP Y G+P   C  L         EC  D+DC     C    CV+PC     C  NA C    H+  C CPPG+ GDP V+C      +T  C +N ECP  + C+   C+ PC     CG NA C+V  H   C C PG  G+P  GC         V+ +C  DS C SS  C +  C NPC   D C  +A C   +        C+C  G+  +    C  +       C  D EC  D  C N  C +PC    C   A C++  H   CRCPE    GNP + C           C+ D +C     C  N  CV  C    PC ++A C  L    +   TC                VV  SP               + RI                    +C C +G+  N +  C +     +GC +D EC   +AC+N+ C DPC     CG +A C    +R  C C  G+ GDP   C  +GC++N++C     CIN  C   C  +H PC  ++ C+  NH  +C CPPG  GNPYV C      EC+ +++C    AC N  CQ+PC     C   A+C V +      + C CP GY  +   +CK     + +GC+ DSDCP   AC++  C +PC     C   A+C V D  P    TC C PG+EGD +I+C  +  CPA  G I  E  ECVCP G+ L++   C PC  + G+ I EN RC C   +GF+++  G+ CVCP    +  + NG C    EC  D NC   ++C    + C D C    CG  A+    +H+  C CI GY GDP +VC           D  RP++VV+CLSDGV V + I++  ++G++YVKGHS+D +CR  + V +    QR + F V FG+C L Y ++G A F+LVI  H KL+TYK+QAY I+C+YSTGEQN++ GFNVS+LTTAGTIANTGPPPTC M+I    G++I+ AEIGD LML+V+V P  IYGGFAR+CIA+T++++ E   Y VTD+NGCATDPSIF DW+YN D   L A F+AFKFP+S+ I+F+CNIRVCFG+CQP +C G NA+G+RRR         S  +++  +  GQLREEI I+SNAIL +ER  +R+    D  + +    E++C+S IGFIIAL++TALLALVAVA+AVSCWL+AYRRRP   GPLPHPPEFPNPLFTTPEP+AEP+PDY
Sbjct:  221 CDCQTGYQGNPYNGCV--DLNECEYKGACGLGALCTNLPGGHHCECPRGYEGDAYRGVCTDINEC----LHNVCGINAICRNEPGTFQCSCPQGFAGDPFSSCTDVDECMATP-CGVKSECVNTNGSFSCKCLPGYSGEPEKKCLDINECDNPNQCGINAKCMNTPGSYVCVCPEGFSGH-GQIYCE-------NVNECSANPCGENAVCTDTVGSFVCSCRQDYTGDPYRKCVDIDECAILD-KPCGQNAVCENTDPGFTCTCPQGFAGKPDPSVACEQVDVSVLCAVNSDCAEHAECI-EGQCFCLNGFKAQGSLCHDIDECLSL--PCGPFSVCNNTQGSFQCSCIPGNVGAPPKIPCKPPCDDIKCGEHAFCKNNEQDAYCICEEGWTFSPADVSAGCIDINECDQVHGVNGQCGLNSICTNSLGGFNCECQQGYSGNPFKQCFDIDECQQNP--CGEGALCENTVGSFECSCPPDWLPDPDPSTKCVPILTCKVDKDCPGNAICYDKKFCHCPEPNIGSDCVNPCDAVSCGTNAECVISNNEPSCVCSPGFTGTTPDG--CVDIDECDNNPCPIGAVCHNEPGSFSCKCPGGTVGDPFKQGCSQAKIQIGCGPENPCPGSELCIRDDFLEESVCICQRGYLRDAKTGKCRDVNECTELRDKPVCGVNAICKNLPGSYDCQCPPGSNGNPFNSCEECNSSECQCKHPYQLLNGECVLAGCDNGQCPNGAECITIAGQVSYCACPKGFRRQ-EDGVCEDIDECAEIAQA-CGYGAECINKRGGYECLCNQGTSGDPYI-LCSPAQIKCFNHHDCQANEKCIQPGECVCPPPFITDRMDGNKCKSPCEMLSCGINAECNPHDPPRCVCRPGFTGDPLLGCIDIDECVNSPCVAGAKCINEHGSYRCDCPKGVTGEGCADRCSRNPCGENTRCRDVNNGYECSCLPGCSGDPLKGCNCETNRLDACSGHVCGKNALCRMTSGSEPECYCPLEFPVGDPDSECFAKRIPVDCRVSGCGKGAHCVLVGSDYSCQCPPGTVGNPN-KDCIPEKECSSNSDC-QSDKTCSNHQCLDVCSVKGACGLNALCEPVNHRPKCSCPTCYIGTPKTGCYLDSNCSSLSSQKCSLNSDC----PSNLTCIDGFCKNP------CLYIDNKNILNCTNHKKCHVQNHKPVCICETGYA---------VNEYGDLICSPNKVECLNNDDCPSNLACYKSKCSDPCE-----------HTLCSANKTC--SVLAHQPVCMCTKDCQP----------STLSICMRDSGCPPDLACR------NYLCINPCANFSCPARSPCNVEDHKPVCKFCPVGFSADS---KFGCVRAVGCVDNEECALNMACINN-----QCQNPCHMNNPCTNQHDCQVQNHQPVCVKVCSCHKNSNCGPNHYCDGCHCVIDPASRTQSPLPGCEHCPPGVRCDPFTGACMKMNGTAKYPHPCQSDSDCLEIEACYD-----GQCGDLCALAGTCAPSAECQVYKHRPVCKCPPGYEGDPAVK--CFLPEPLSCVTNADCSFMEACINKICQHPCD---VHNPCAQNAICSNTNHGASCGCIEGYEGNAYVGCTEVAAKSQRSCQYNGDCPSDKVCDRLNRICVNPCFEDSCGLNAVCIPVNHGTDCRCLAGFHGNP--------------------YLGCTSIVQC---------------HNDNECNADEACINGKCSNPCR--CGPNAICEVYFHKANCKCLTGYSGNPTI--GCIAPTNPCNPNPCGYQALCEVDEGNPICFCPKGMTGNPFKTCIPEGDECSPNPCGPYSGCRVVHGAAVCYCLPEYEGDPPSKPCHLPKN----------PCSPSPCGPNTQCSL--LSDGFAKCTCLPGYVESPNTIRGCVEKRNRCEPNPCGHGAIC-DPNQAQSCFCPEPLIGNPYRSCTAPSKTLCLPGPCGQNADCYVVGGTEQCYCKMTFTGDPYTSCRPGRSSPCDPNPCGPFAECSISPEGKQHCACLSGMAGDPMSGCSGPECRSNKDCSPTQACLGWKCLDPCPG-ACGIGASCRVEKHHPQCVCDSGLTGNPLIKCVPVTVLTAPSTNPCEPNPCGLNTLCSVVKNKAACSCLPDFIGDPQS-GCR--LECVLNSDCPSNQACISHHCKDPCSLGNVCGVGAVCISKDHVVTCVCQKGYSGDPFIQCISKSYLPILKNETLPCDPSPCEPNSYCSVHSGQVAMCNPCGSSGGYWSPACHPDCLFDSDCSFNLACIGQKCMDPC--SGSCGFGAQCTVHHHQPICTCPQGLVGNPFEHCHPPTASENQKQDPCAALQCGANAVCKVSFGHTTCVCSPGYQGNPYLGCRPECVLNSDCPSALCCVNNKCEDPCI--GACGVNAECQAVNHLPVCYCPKDHSGDPFVSCYAFKPIFAPVMGHP-SNPCDPS----------PCGPNSRCLISKQGY---ASCSCLPGYRGVPPVCKSECVISAECPQSQACINQKCADPCPGT-CGLNARCDTINHNPICNCAPGYVGDP--FINCYLPPA-----EEIPKIPKIDGNPCDP-----SPCGSNSICQVTQGHPVC----SCAMNYTGKPPFCRPECVMSQECPHDQACIREKC--------------------RDPCTQS-CGYNAKCSVINHTPFCSCLPGYEGD-------AFVGCSSVPPTVQAPIPTNPCTPSPCGENAHCTSVDGTARCTCIPPYVGNPY------------AGGCRPECVIPSDCAPHETCLSSHCRDPC---PGVCGRNAVCKVVNHIPQCSCLPGFIGNPFQSCKPEPPKPLPPKNPCESAMCGPNSICRVS-DGHAVC----SCQRDFVGTPPACRPECVQSGECDQTKACVNQKCVDPCPGTCGVQAVCQVLNHNPMCSCPPSTTGDPFVKCVEEAPKEAVESINPCVPSPCGANSECHITERGAMCSCVPGM--LGAPPHCRPECSIHADCPTKLACINNKCRDPCMKA--CGVNSQCAVVNHKPVCSCFDGYQGDPFTRCNPVRASERTPAQTDPCFPTPCGVNADCVNNKGVASCVCLSGFYGNPHSGCHRECESNTDCASSLVCSNYKCVDPC--PETCGVEAVCTVSEHKPVCSCAQGFSGDPFIQCHPIPVSPSTPPPV-------------------------LNPCYPSPCGANSQCRPVNGEAICSCLPQFVGNP------PKCHPECTENSDCPADRACVNLKCANPCQNT----------------------------CGIRAQCTVRNHNPICTCPAKYTGDPFIQCSAIPSSFIQVPSKSSASCQPSPCGPHSQCQIVDNKPVCSCIPGFIGSPPKCRPECVISTDCSSHLTCVKQKCTDPC-PGSCGVNAQCQVLNHVPTCSCMEGFTGDSFVHCSPIPMTGVNLETTGDPCLSSPCGINAVCQ-----KGFCFCIGDYEGNPYEECRPECTINHECDRSKACIANKCQDPCPGTCGQFSQCSVVNHMPICSCPQGMTGDPFFSCRMLTAEPSKPKDVCIPSPCGPNSKCQTIEGNAACSCLPGYVGTPPNCKLECVVSSECPSQEACINSKCIDPCTGACGVGARCGVVNHSPICSCGPELTGDPFKSCQDLSMLPSTPPEEDKSVCNPSLCGPNSHCEVEGEIPVCSCLPNFKGRPPHCRPECIINPDCPSNLACINQKCVNPCPGSCGINAECQVISHSVHCSCSPGLTGNPFVQC--IQQEKLTNPCTPSPCGPNAYCRQQKNAGSCICIPDYHGNPYEGCRPECVLDSDCSSNFACILNKCTDPCPSTCGQRAVCSVINHVPSCNCLPGHIGDPFVDCNPQPVADTEAALVDPCTPSPCGPNSQCR-KANNQPVCSCLPEYKGAP-PNCQPECVSNNECPLNKACQNYKCRNPCSGACGLQASCEVISHSPVCSCPAGLMGDPFVRCMLPLAIPSSPIDESDNPCLPSPCGPNSVCRI-IKKQAACSCLHGFIGTAPNCRPECTVSSDCSASEACIVGKCRDPCIGSCSNNAECR----------------------------------------VQNHAPVCSCVEGYSGDPFSQCSPIMVIEEPSGRD----PCTPSPCGANADCFD----GNCKCRPSYYGDPYSGCRPECTLNSECPSNKACTNQRCVNPCL--GICGQDARCDVIN-HAPSCSCPPGLTGNPLAACR---SFTVQNDTLAGDLCNPNPCGPNSICRITNGFAVCSCQPGLIGSPPLCRPECIVSTECPLTQACIRSKCADPC-TGTCGVNAECRVINHSPICSCEPGHTGDPFRQCYAEPMSPGPLPSTE-NPCKPSPCGPNSKCQVSEGNPVCSCSEHYMGSPPHCRPVCTIDPECPSHLACIGQKCADPCPGSCGSNARCSVINHSPMCACLSGYSGDPFTGCSATEVSLSNEITEADPCYPSPCGSNARCQNDDGFVICECIAEYQGNPYEGCRPECLVSSDCPMNLACIGN-KCHDPCPGTCGFSAICTVSNHNPICTCPEGTTGDAFKLCQLIQ-KSDSTVTLSS---------PCSRSPCGPNAVCRVINNAAMCECLPDFYGSPSDSGCRPECVISADCPRNKACSGNKCQDPCPGICGTNAICHVVNHSPVCSCPVSMVGDPFIECRLAPAESTDPCFPSPCHKNGICNIIGGSTTCIYPECIINQDCPRDKACFSQKCSDPCY-DACGVNAICHAVNHQPVCFCPPGFTGEPQVLCKMQPTSAEPRIECTSDTECNNDRACVSGSCKNPCATSSNVCGINAECHVQFHRPICACKSGFIGNALVQCQEAGCQDNSGCSTMEACINGECVNPCTFSQCGVNAECHPDNNHRARCSCPASFTGDPLVKCERPQCSSNDDCPQNLACQNKRCVNPCICANNALCIVISHNPTCQCPPGFVGNPYR---SCVIAPIEVSPGCKQDSDCPSRHVCMSGDCRDPCIGIQPCGQNAECKVLNTLPLRTLSCQCLPGYVGDASVQCERAAAQVEHGCKGDAECLESEVCINLLCVNPCAVSTPCAPSAECQADNHRAMCKCPPGLVGDPFVNCYKASVKSPECSVDSDCATDVACINQRCQDPCIL-SNLCGAGAQCSVSMHRPVCDCPADWAGDPQVQCYKPECQSNADCVYDKACVENSCLDPCQETTCGRGAECKVQNHHASCTCPLGTQGDPLISCIGVICQFNDDCADHESCDRVNHKCRPVCQEKTCATNAACSAANHQATCTCMPGTQGNPYTDCSTARLPAPV-CSQDADCPSKLACINQ-RCENPCLASHICTKEQDCRVLDTLPLRSVVCECPSDTIATPEGSCKPIAGTTKDPKCRSSEECKNNEKCFKGVCTDACRVEPCGVNAQCIGKKHQAVCSCPPGYIGSPYFECSSLPKLPLPVLPECTRDNDCSYGLGCNRQRCVNPCTT-KVCSRNAFCHVEGHKPICRCPPGFSGDPMVECKPSTEAATIGCSSNAECPLQESCVNRLCISPCN----CGPNADCKVLDHYPICSCSPGFSGNPQFGC---------VKVDCESDSHCLSSQTCYNGKCVNPCILEDACAPNAECYGDN----HQTACRCAPGYEGNPLVRCEHV------ECHSDSECRSDQKCFNLHCVNPCQNSPCAPNAVCYVNNHNAACRCPESLPLGNPAVNCERQPSFGKEPECKYDTDCVSGLACLTN-KCVDPCYELVPCSNSARCNVLDSVPVKTLTCTCSEGWVPNAEGECRPVVVPSPPGCATNQDCPSNETCISRICRNPCNCGANANCIVQDHYPICSCQEGFEGNPHIACRS-----IGCRTDGECESGKACLNSHCIDPCLVSNPCGFDAECYTIGNRAECRCVSGYRGDPYDRCTVIGCRTNNDCPDDRACINSQCINPCAYEH-PCAANSECKVNNHLALCRCPPGELGNPYVGCRPEPKPECKVDADCPAKLACFNDVCQNPCTALQPCTSPAECSVVSSLPVRTMLCVCPNGYASSGSGTCKAAPPIIPIGCIADSDCPLHKACVNALCMSPCN----CPSYAECQVSDHKP----TCSCPPGFEGDPNIECVKID-CPANKGFIRAENGECVCPLGYALNANDECQPCYINQGYKIDENDRCTCALDRGFIVNEFGE-CVCPTEFGYQRDTNGNCVLVGECEKDDNCPNKKFCNLNTQICEDACQNTRCGVNAFCNATNHKAVCLCIAGYNGDPYSVCNHTHTVFR--TDFPRPDMVVSCLSDGVQVEIHITETGFNGVLYVKGHSKDESCRRIVSVPQEYANQRTEIFKVHFGSCGLLY-KNGLADFVLVIQKHPKLVTYKAQAYHIKCVYSTGEQNVTLGFNVSMLTTAGTIANTGPPPTCTMKIVTHTGQEINSAEIGDNLMLQVDVQPSSIYGGFARSCIAKTMEDSVENE-YIVTDENGCATDPSIFGDWDYNPDTQSLLATFNAFKFPSSDNIRFQCNIRVCFGKCQPSDCRGYNAYGKRRRRDLRYVSKNSSTDVSEALLAGQLREEITIQSNAILTLERSEERVAGPPDAPEPQRA--EDICISVIGFIIALIVTALLALVAVAVAVSCWLLAYRRRPTLAGPLPHPPEFPNPLFTTPEPVAEPSPDY 6449          

HSP 2 Score: 2071.97 bits (5367), Expect = 0.000e+0
Identity = 2095/6824 (30.70%), Postives = 2825/6824 (41.40%), Query Frame = 0
Query:   24 KGVFFLNVEDGFFGCQVNASVDVLQLFEISKLCDGVPDCYRGSDEANSQIKCTKDCLYTTGRHCQHGACLDSQCYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECR-TNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPN-GS--CACRKGFQPNG-VLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRD----PCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSF--NCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFN----GACNCQEPY------VGPNCEDACR-------DATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSR------------------------------------CVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGI---SYCACPRGYEMNPRTKNCEDIDECQAIGHTP-CGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAEC--TPSNPPQCLCKAGFTGNPLTGCEDLDECA--LNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACI-----------------GSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSL--CNQVICGSNAQCIVSPSGPTCQCFEGMVG---------NP----------YPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLS---CTCQSGF-LGDPTLVCMPPTQQAECS-SECGTNSHCIY-GNPNSCACNIGYFGNPYTGC---EVTTSVEDCDSLK----------------CGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVT----EDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCS-SAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQRE--EKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPIC-LCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSC----------------NEVSFGMKNCVPACDLV-NCPSGAECVSEGHRGYCRC-----------LPGYSGNP-----DDRSG-CMIFS-----QNKCSSNAECAESEVCKRSNGQRSCQPACSYL-ECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGC--RKVSCVENEDCPDNEFCDRLSYTCMDPCQ-NEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTE-TCGPNALCSPEFENL-CQCPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQS-GC-SDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCL----------------DPCDISYCTPLATCNVIQHK-AFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQLIGS-----NCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQ------------GCKPKA-----------------------------QCYSNSECSSDTRCQNGRCVDPCDGFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPR-----ECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNP----SPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHC---QPTLVPCSS--ASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQAGLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGST-------------KNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECI----EGVCISGCGSNRDC------PYGEMCEGGQC------------------RNPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLLPN------QCGENAQCLNQLGGFDCVCRSGCTGDP-------FQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCIC-----------------------TKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKE-ESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPK------DACQPSPCGSKANCN-INDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQC------------------------------VVDRVP---------KPPIRPLPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYYQC----IVRGNREV--------------------CSCQPGYFGGP-PNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPP--PKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRC---SPNPPEPLETDPC----SACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAEC--------------------------SEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSP-PNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENE--VTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKP---PSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEE---RDPC--ETCGQHAICHIHNNIAACKCEDNYIDKP-PNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQPI---DPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRCI---------------------------------------------PAGCRS----DSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCT--------------------------------------------------QYECKRHEECPSTLACRDFKCVDPC--DCAVGANCRVSNHKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCAC-PNGFLFIGDFECKAPERPECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQKAGCQS-------------------------------NSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECR--------QYECLVDSDCPYTLACPNRECIDPCQ-----CAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSC----LEIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAV----CTCPIEWVGNPMRECH------QYECIQHNDCPNDKACIDNKCVDPC-LETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQV-----ECQQDGDCADNEKCDLRAQTCQLICNAQS-CVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQAC--LNAKCVSPC---NCGTGALCDVINHTPICYCPPKYSGNPQIACEKLE-----CRNDDDCGDHQRCYDNLCVDPCLIDNECGINAEC-----IPRSHQSTCECPPGYQGDPFVKCSTF-------ECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPCDCGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPCA---CGPNAVCTIENHRPVCTCKDGF-YGDPEIVC-------KEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVN----HQYVCTCPPGLEGN------PYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPV-----KTCPAGSGLI----------------------LNEFEECVCPPGFVLDSQGICAP-----CRFDVG----------------FIIENGRCICDYTKGFVLDLSGKKCVCPENHSINDNGICEEEPE-----CRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPPP-VDIDRPEIVVNCLSDGVGVGLTISDPRYHGLIYVKGHSQDPN--CRLRVDEGQNGQRIDFHV-KFGTC----DLAYDEDGYAHFILV--------IGHAKLMTYKSQA-----YRIRCIYSTGEQNISH--------GFN---VSILTTAGTIANTGPPPTCIMRICNSNG--EDISQAEIGDKLMLKVEVSPGEIYGGFARNCIARTVDETNEETVYTVTDDNGCATDPSIFKDWEYNRDKGYLSAVFDAFKFPNSNTIKFKCNIRVCFGQCQPQNCAGRNAFGRRRRESEHEIAGT-----------VYTGQLREEIKIESNAILAIERK-------------AKRLQDNLQNRYIGNEE 6060
            + VFFLN+EDGFFGCQVN S  VLQLFE+SKLCDG  DC+RG+DE   ++KCTK+C    G  CQ+GACLDSQC+CNDG+GG  C +PD NECKYRPCDVF +CTNTLGSF CSC  GY G+GF+C+DIDEC  P +A+ CV NAECCNLPAH++CKC+PGFEGDG+VECRDIDECL    CGINT+C NT GN++C+C  G+ GNP++GCVD++EC     CG+GA CTNL G + C+CP G  GD Y+G C            C    CG NA+C+       C+C +GF GDP  SC D++EC ++    CGV + C+N +  + C+C  GY+G+    C  +     C +   C  NA+C+   GS  C C +GF  +G + C++++EC +  NPCG N++C +  G + C C     G P  + C D      L+  CGQ A C+       C C +G+A  P + S  C  +D        +  C VN+ C+         C C  GF     + C DIDEC      CG  ++C N  GS+ C C  G          +   +    D +C  +A C N      C C+E +      V   C D          +  C  NS C    G   C+C  G+  +P  + C DIDEC  NPCG+ A+CEN +GSF C CP     DP    +      C  D  C     C   +                                    CVC  G+       CVD++EC   N C + +VC N PGS+ C+CP G  G+PF   Q CS             + + Q+        P   + I       S C C RGY  + +T  C D++EC  +   P CG  A C N PGS+ C CPPG  G+PF  SC                EEC   +C C  P+ +  L+G    + C    C   AEC         C C  GF       CED+DECA     C  G+ CINK   Y+C C  GT+GDPY   CS ++ ++C    +C     CI                 G++C +PC  + CG NA C   +    C C+ GF  D    C+ +  C    C + A+CI       C C +G+ G         NP            G  CS L   S  P   +G  C+  R +  C    CG NA C     S   C C   F +GDP   C       +C  S CG  +HC+  G+  SC C  G  GNP   C   +  +S  DC S K                CG NA+C   + +P+C+C   Y G P   C     C  S        +N+    +  C   F  NP   C++++        +   C  Q   P        C+C +G+  ++  DL+  CS +   C  N DC  N  C          CSDPC+   C  N  C    HQ  C+C            + CQ      C  +  CP    C         C++PC   SCP    C V D  P+C  C  GF  +   G C    GC+ + +CA   +C                N+    ++N  P C  V +C   + C    +   C C           LPG    P     D  +G CM  +      + C S+++C E E C   +GQ  C   C+    C   A C V  H   C CP G + G+P ++      +SCV N DC   E C  ++  C  PC  +  C +NA+C+   H   C C   +       V C +          + Q +C  +  CP  ++C                  R+C+     +PC E +CG NA+C P      C+C  GF G P    GC  I                     +C +  +C   E C NG C   C    N                       + EV      C C  GY    + GC +  N C  N CG    C    G+ IC CP     +    C       S   C     C     +    CL                +PC  S C P   C+++    A C+C P +   P N   GC +    CE   CGHG+    + A  C C +   LIG+            C  G PC  +A C    G+ QC C     GDPYT              C P A                             +C SN +CS    C   +C+DPC G CGIGA C V+ H P+C C     GNP IKC  +            + L     + C+    CGLN+ C +  +   CSC     GDP+     EC  N DCP +                         Q C    CKDPC   N CGV A+C SK+H   C C  G++G+  ++C+      IL +    ++ C  S     C+ ++ C+++     G+  +     N C          C   C    DC  + +CI  +C DPC  + CG  A C V   Q  C C +G + NP     P  A   +        QC  N +C  SF    C      + N                          + C   C  + DC +   C NN+C                     DPC +  CG NAEC+  NH  +C CP+   G+P   C   +P   P     ++ C  S       C+   Q    C                    C  G   +   C   C  + +CP    C+  KC DPC      CG  A C T NH   C C  G  GDP+ +C   YL                   + CGS   C        C     C    +    FC  +C ++ +C +   CI       C   CG N  C      P+     G +                    NPC    C  N+ C        C C   Y      G  + EC     C+  ++C    C + C     CG+NA C++ NH  QC C  GF GN  Q C  +    L P        CG N+ C    G   C C+    G P        Q  +C   K     K  C++PC   G+CG QA+C+V+NH  +C CP    G+P V C  +      P+   ES                      ++PC    C  N  C        C+C   +L         P    +C     CP+ L+CI+  C++PC   +C     C V+NH+ +C C                         DPC  +PCG  A C   +G A C C  G  G+P   C +E ES   T C  ++ C         +C+                  DPC P  CG  A C V  ++  C C  G  GDPFIQC P+  +P       + C PSPCG+ + C  +N E  AICSC   + GNP   C PEC  + DCP+D++C NLKC +PC   CGI A C V  H P C C   Y GDP+ QC                              +VD  P           P +  P+C  + DC S   C    C DPCP  CG+NA C+V NH   C C  GF GD +  C    +   N E                     C C   Y G P   CRPEC I  +C     C+  +C DPC   CG+ +QC VV H P+CSCP G TG+P+  C+++   P  PK  C PSPCG N+ C+ +     C CLPG++G PP C+ EC+   ECPS + C   KCIDPC   CG+ A C   NH  IC C   + GDPF  C   S  P  P E D      S CG N+ C+V   +  +CSC  ++ G P   CRPEC+ N DCPS+ AC+  KCV+PC G+CG+NAEC                           +  +PC P+PCG N+ C    N    C C  DY G+P   CRPEC  DS C ++  C+  KC DPCP  CG+ A C                                         V+ H P C CL G IGDP+ + C  +P A      V PC P+PCG N++C + N    C C+ +Y G P  +C+PECV N++CP   AC ++KC++PC  + ACG+ A C V  +H   CSC    +GDP V C  P   PS  + +E  +PC    CGP S          CSCL G++G  P+C+P C V+SDC A  ACI   C DPC  + C +N  C V++H   C C  GY G+P   C+      +  EE   RDPC    CG +A C   N    CKC  +Y   P   CR EC L+ +CP + AC   +C +PC+  CG++A C VINH P C C P   G+PL  C    V       D C PNPCG N+  R      +C+C PG  G P   C  EC++  +CP  +AC  + +C++PC G CGV A C VI H+ ICSC     GDPF +C                                              P  CR     D ECPS  ACI ++C DPCP  +CG NA C   +H   C CL G+ G+P+ GC+                                                  + EC    +CP  LAC   KC DPC   C   A C VSNH   CTCP G TGD +              C+   +  DS   ++S    PC  +PC   A C V  +   C C P+ +    D  C    RPECV   +CP + AC   +C DPC    CG NA C V  H PVC+C +  VGDP+  C+ A  +S                               N +CP  +AC ++KC DPC ++ CG NA C    H P+C C  G+ G P   C+        + EC  D++C    AC +  C +PC      C  NAEC VQ H+  C C  GF GNA             ++  C+ +  C + +AC +G+C NPC F + CG ++ C   +    R   C+C + +T +   +C R        C ++ DCP +  C N  C+NPC     C++ A C V  H   C CP G  G+PY SC    +E+  GCK D +C     C +G+C++PC     PCGQ AEC   N   +    C C   +VG+   +C       ++ C    +C   + CI+  CV+PC + T C   A C+++ H + C CPPGL G+P V C++      EC  D DCA +  C    Q CQ  C   + C +GA C    HR  C C     GD  V C  KP      C+ + DC    AC+ E  C +PC     C     C+V +        C CP+G       SCI     V C+ +  C   ++C  +N KC   C    C T A C   NH   C C P   GNP   C         C  D DC     C +  C +PCL  + C    +C     +P      CECP      P   C          +C +++EC   + C    C D C V EPCG NAQC   +H A C CPPG  G P   CS  P +  PV  EC  D+DC+  L C  Q C NPC T   C ++A C V    P    IC+C  G+  D    C        +GC  + ECP   +C+NR+C  PC+CG  A+C +  H P+C C  G  GNP   C  + C+SD+ C     C  NG CV  C+L+  C  NAECYG  H+  CR                 C  GY  N   +C       V C SD EC   + C N  C +PC    C PNAVC + NH   C C +    G+P + C       KE  C+ +++C +   C+   C   C  + VPC   A C  ++        CTC  G   N      P V  S   C  N +C  +  CI++ C++PC     C   A C+V++H   C+C  G+EG    +C+   +GC  D +C S  AC++  C +PCL++ PCG +A+C  +         C C+ GY GD   +CT +       CP     I                       N    C CPPG + +    C P     C+ D                    ++      + +    L +    CVCP  ++ + +G C+  P      C  D +C   + C   N  C  PC    C  +A    +DH+  C C  G+ GDPN  C  I  P     +  +  E V       +G  L  +D         +G+  D N  C   +D G       F V +FG C    +  Y  D   + +LV          + K     +Q         RC  +      +H        G+N    S+     T+  T  P   ++  C S+G   +I   E G   +L V+   G       R  ++   +  N+ T         C     ++K+       G    V    K P   T K +     C      QN      F      +   IA T            +TGQ     +I  N +L ++ +             AK ++D+++N YI  +E
Sbjct:   25 REVFFLNLEDGFFGCQVNESTQVLQLFELSKLCDGKRDCFRGTDELAKELKCTKNCDQVNGHLCQNGACLDSQCHCNDGFGGCDCQVPDENECKYRPCDVFAHCTNTLGSFHCSCFPGYTGNGFYCQDIDECANPAIASRCVANAECCNLPAHFLCKCRPGFEGDGEVECRDIDECLQPNACGINTVCTNTPGNYTCDCQTGYQGNPYNGCVDLNECEYKGACGLGALCTNLPGGHHCECPRGYEGDAYRGVC-------TDINECLHNVCGINAICRNEPGTFQCSCPQGFAGDPFSSCTDVDECMATP---CGVKSECVNTNGSFSCKCLPGYSGEPEKKCLDIN---ECDNPNQCGINAKCMNTPGSYVCVCPEGFSGHGQIYCENVNECSA--NPCGENAVCTDTVGSFVCSCRQDYTGDPYRK-CVDIDECAILDKPCGQNAVCENTDPGFTCTCPQGFAGKP-DPSVACEQVDV-------SVLCAVNSDCAEHAECIEGQCFCLNGFKAQGSL-CHDIDECLS--LPCGPFSVCNNTQGSFQCSCIPGN----VGAPPKIPCKPPCDDIKCGEHAFCKNNEQDAYCICEEGWTFSPADVSAGCIDINECDQVHGVNGQCGLNSICTNSLGGFNCECQQGYSGNP-FKQCFDIDECQQNPCGEGALCENTVGSFECSCPPDWLPDPDPSTKCVPILTCKVDKDCPGNAICYDKKFCHCPEPNIGSDCVNPCDAVSCGTNAECVISNNEPSCVCSPGFTGTTPDGCVDIDEC-DNNPCPIGAVCHNEPGSFSCKCPGGTVGDPFK--QGCS-------------QAKIQIGCGPENPCPGSELCIRDDFLEESVCICQRGYLRDAKTGKCRDVNECTELRDKPVCGVNAICKNLPGSYDCQCPPGSNGNPFN-SC----------------EECNSSECQCKHPYQL--LNGECVLAGCDNGQCPNGAECITIAGQVSYCACPKGFRRQEDGVCEDIDECAEIAQACGYGAECINKRGGYECLCNQGTSGDPYI-LCSPAQ-IKCFNHHDCQANEKCIQPGECVCPPPFITDRMDGNKCKSPCEMLSCGINAECNPHD-PPRCVCRPGFTGDPLLGCIDIDECVNSPCVAGAKCINEHGSYRCDCPKGVTGEGCADRCSRNPCGENTRCRDVNNGYECSCLPGCSGDP--LKGCNCETNR-LDACSGHVCGKNALCRMTSGSEPECYCPLEFPVGDPDSECFAKRIPVDCRVSGCGKGAHCVLVGSDYSCQCPPGTVGNPNKDCIPEKECSSNSDCQSDKTCSNHQCLDVCSVKGACGLNALCEPVNHRPKCSCPTCYIGTPKTGCYLDSNC--SSLSSQKCSLNSDCPSNLTCIDGFCKNP---CLYIDNKNILNCTNHKKCHVQNHKP-------VCICETGYAVNEYGDLI--CSPNKVECLNNDDCPSNLACY------KSKCSDPCEHTLCSANKTCSVLAHQPVCMC-----------TKDCQPSTLSICMRDSGCPPDLACR-----NYLCINPCANFSCPARSPCNVEDHKPVCKFCPVGFSADSKFG-CVRAVGCVDNEECALNMACINNQCQNPCHMNNPCTNQHDCQVQNHQPVCVKVCSCHKNSNCGPNHYCDGCHCVIDPASRTQSPLPGCEHCPPGVRCDPFTGACMKMNGTAKYPHPCQSDSDCLEIEACY--DGQ--CGDLCALAGTCAPSAECQVYKHRPVCKCPPG-YEGDPAVKCFLPEPLSCVTNADCSFMEAC--INKICQHPCDVHNPCAQNAICSNTNHGASCGCIEGY--EGNAYVGCTEV-------AAKSQRSCQYNGDCPSDKVCD--------------RLNRICV-----NPCFEDSCGLNAVCIPVNHGTDCRCLAGFHGNPYL--GCTSI--------------------VQCHNDNECNADEACINGKCSNPCRCGPN----------------------AICEVYFHKANCKCLTGYSGNPTIGCIAPTNPCNPNPCGYQALCEVDEGNPICFCPKGMTGNPFKTCIPEGDECSPNPCGPYSGCRVVHGAAVCYCLPEYEGDPPSKPCHLPKNPCSPSPCGPNTQCSLLSDGFAKCTCLPGYVESP-NTIRGCVEKRNRCEPNPCGHGAICDPNQAQSCFCPE--PLIGNPYRSCTAPSKTLCLPG-PCGQNADCYVVGGTEQCYCKMTFTGDPYTSCRPGRSSPCDPNPCGPFAECSISPEGKQHCACLSGMAGDPMSGCSGPECRSNKDCSPTQACLGWKCLDPCPGACGIGASCRVEKHHPQCVCDSGLTGNPLIKCVPV------------TVLTAPSTNPCE-PNPCGLNTLCSVVKNKAACSCLPDFIGDPQSGCRLECVLNSDCPSN-------------------------QACISHHCKDPCSLGNVCGVGAVCISKDHVVTCVCQKGYSGDPFIQCISKSYLPILKNE---TLPCDPS----PCEPNSYCSVH----SGQVAMC----NPCGSSGGYWSPACHPDCLFDSDCSFNLACIGQKCMDPCSGS-CGFGAQCTVHHHQPICTCPQGLVGNPFEHCHPPTASENQKQDPCAALQCGANAVCKVSFGHTTCVCSPGYQGNPY------------------------LGCRPECVLNSDCPSALCCVNNKC--------------------EDPC-IGACGVNAECQAVNHLPVCYCPKDHSGDPFVSCYAFKPIFAPVMGHPSNPCDPSPCGPNSRCLISKQGYASC-------------------SCLPGYRGVPPVCKSECVISAECPQSQACINQKCADPC---PGTCGLNARCDTINHNPICNCAPGYVGDPFINC---YLPPAEEIPKIPKIDGNPCDPSPCGSNSICQVTQGHPVC----SCAMNYTGKPPFCRPECVMSQECPHDQACIREKCRDPCTQSCGYNAKCSVINHTPFCSCLPGYEGDAFVGCSSVPPTVQAPIPTNPCTPSPCGENAHCTSVDGTARCTCIPPYVGNPYAGGCRPECVIPSDCAPHETCLSSHCRDPC--PGVCGRNAVCKVVNHIPQCSCLPGFIGNPFQSCKPEPPKPLPPKNPCESAMCGPNSICRVSDGHAVCSCQRDFVGTPPACRPECVQSGECDQTKACVNQK--CVDPC--PGTCGVQAVCQVLNHNPMCSCPPSTTGDPFVKCVEE-----APKEAVES----------------------INPCVPSPCGANSECHITERGAMCSCVPGMLGAP------PHCRPECSIHADCPTKLACINNKCRDPCM-KACGVNSQCAVVNHKPVCSCFDGYQGDPFTRCNPVRASERTPAQTDPCFPTPCGVNADCVNNKGVASCVCLSGFYGNPHSGCHRECES--NTDCASSLVCSNY------KCV------------------DPC-PETCGVEAVCTVSEHKPVCSCAQGFSGDPFIQCHPIPVSPSTPPPVLNPCYPSPCGANSQCRPVNGE--AICSCLPQFVGNP-PKCHPECTENSDCPADRACVNLKCANPCQNTCGIRAQCTVRNHNPICTCPAKYTGDPFIQCSAIPSSFIQVPSKSSASCQPSPCGPHSQCQIVDNKPVCSCIPGFIGSPPKCRPECVISTDCSSHLTCVKQKCTDPCPGSCGVNAQCQVLNHVPTCSCMEGFTGDSFVHCSPIPMTGVNLETTGDPCLSSPCGINAVCQKGFCFCIGDYEGNPYEECRPECTINHECDRSKACIANKCQDPCPGTCGQFSQCSVVNHMPICSCPQGMTGDPFFSCRMLTAEPSKPKDVCIPSPCGPNSKCQTIEGNAACSCLPGYVGTPPNCKLECVVSSECPSQEACINSKCIDPCTGACGVGARCGVVNHSPICSCGPELTGDPFKSCQDLSMLPSTPPEEDKSVCNPSLCGPNSHCEVE-GEIPVCSCLPNFKGRP-PHCRPECIINPDCPSNLACINQKCVNPCPGSCGINAECQVISHSVHCSCSPGLTGNPFVQCIQQEKLTNPCTPSPCGPNAYCRQQKNA-GSCICIPDYHGNPYEGCRPECVLDSDCSSNFACILNKCTDPCPSTCGQRAVCS----------------------------------------VINHVPSCNCLPGHIGDPFVD-CNPQPVADTEAALVDPCTPSPCGPNSQCRKANNQPVCSCLPEYKGAP-PNCQPECVSNNECPLNKACQNYKCRNPC--SGACGLQASCEV-ISHSPVCSCPAGLMGDPFVRCMLPLAIPSSPI-DESDNPCLPSPCGPNSVCRIIKKQAACSCLHGFIGTAPNCRPECTVSSDCSASEACIVGKCRDPCIGS-CSNNAECRVQNHAPVCSCVEGYSGDPFSQCSP----IMVIEEPSGRDPCTPSPCGANADCFDGN----CKCRPSYYGDPYSGCRPECTLNSECPSNKACTNQRCVNPCLGICGQDARCDVINHAPSCSCPPGLTGNPLAACRSFTVQNDTLAGDLCNPNPCGPNSICRITNGFAVCSCQPGLIGSPPL-CRPECIVSTECPLTQACIRS-KCADPCTGTCGVNAECRVINHSPICSCEPGHTGDPFRQCYAEPMSPGPLPSTENPCKPSPCGPNSKCQVSEGNPVCSCSEHYMGSPPHCRPVCTIDPECPSHLACIGQKCADPCP-GSCGSNARCSVINHSPMCACLSGYSGDPFTGCSATEVSLSNEITEADPCYPSPCGSNARCQNDDGFVICECIAEYQGNPYEGCRPECLVSSDCPMNLACIGNKCHDPCPGTCGFSAICTVSNHNPICTCPEGTTGDAFKL------------CQLIQK-SDSTVTLSS----PCSRSPCGPNAVCRVINNAAMCECLPDFYGSPSDSGC----RPECVISADCPRNKACSGNKCQDPCPG-ICGTNAICHVVNHSPVCSCPVSMVGDPFIECRLAPAESTDPCFPSPCHKNGICNIIGGSTTCIYPECIINQDCPRDKACFSQKCSDPC-YDACGVNAICHAVNHQPVCFCPPGFTGEPQVLCKMQPTSAEPRIECTSDTECNNDRACVSGSCKNPCATSSNVCGINAECHVQFHRPICACKSGFIGNALVQ---------CQEAGCQDNSGCSTMEACINGECVNPCTFSQ-CGVNAECHPDNNHRAR---CSCPASFTGDPLVKCERP------QCSSNDDCPQNLACQNKRCVNPCI----CANNALCIVISHNPTCQCPPGFVGNPYRSCVIAPIEVSPGCKQDSDCPSRHVCMSGDCRDPC-IGIQPCGQNAECKVLNTLPLRTLSCQCLPGYVGDASVQCERAAAQVEHGCKGDAECLESEVCINLLCVNPCAVSTPCAPSAECQADNHRAMCKCPPGLVGDPFVNCYKASVKSPECSVDSDCATDVAC--INQRCQDPCILSNLCGAGAQCSVSMHRPVCDCPADWAGDPQVQC-YKPE-----CQSNADCVYDKACV-ENSCLDPCQ-ETTCGRGAECKVQN----HHASCTCPLGTQGDPLISCIG----VICQFNDDCADHESCDRVNHKCRPVCQEKTCATNAACSAANHQATCTCMPGTQGNPYTDCSTARLPAPVCSQDADCPSKLACINQRCENPCLASHICTKEQDCRVLDTLPL-RSVVCECPSDTIATPEGSCKPIAGTTKDPKCRSSEECKNNEKCFKGVCTDACRV-EPCGVNAQCIGKKHQAVCSCPPGYIGSPYFECSSLPKLPLPVLPECTRDNDCSYGLGCNRQRCVNPC-TTKVCSRNAFCHVEGHKP----ICRCPPGFSGDPMVECKPSTEAATIGCSSNAECPLQESCVNRLCISPCNCGPNADCKVLDHYPICSCSPGFSGNPQFGCVKVDCESDSHCLSSQTCY-NGKCVNPCILEDACAPNAECYGDNHQTACR-----------------CAPGYEGNPLVRCEH-----VECHSDSECRSDQKCFNLHCVNPCQNSPCAPNAVCYVNNHNAACRCPESLPLGNPAVNCERQPSFGKEPECKYDTDCVSGLACLTNKCVDPCY-ELVPCSNSARCNVLDSVPVKTLTCTCSEGWVPNAEGECRPVVVPSPPGCATNQDCPSNETCISRICRNPC----NCGANANCIVQDHYPICSCQEGFEGNPHIACRS--IGCRTDGECESGKACLNSHCIDPCLVSNPCGFDAECYTIG----NRAECRCVSGYRGDPYDRCTVIGCRTNNDCPDDRACINSQCINPCAYEHPCAANSECKVNNHLALCRCPPGELGNPYVGCRPEPKPECKVDADCPAKLACFNDVCQNPCTALQPCTSPAECSVVSSLPVRTMLCVCPNGYASSGSGTCKAAPPIIPIGCIADSDCPLHKAC--VNALCMSPCN---CPSYAECQVSDHKPTCSCPPGFEGDPNIECVKIDCPANKGFIRAENGECVC-----PLGYALNAND-ECQPCYINQGYKIDENDRCTCALDRG-------FIVNEFGECVCPTEFGYQRDTNGNCVLVGECEKDDNCPNKKFCNLNTQICEDACQNTRCGVNAFCNATNHKAVCLCIAGYNGDPYSVCNHTHTVFRTDFPRPDMVVSCLSDGVQVEIHITETGFNGVLYVK---GHSKDESCRRIVSVPQEYANQRTEIFKVHFGSCGL---LYKN-------GLADFVLVIQKHPKLVTYKAQAYHIKCVYSTGEQNVTL--GFNVSMLTTAGTIANTGPPPTCTMKIVTHTGQEINSAEIGDNLMLQVDVQPSSIYGGFARSCIAKTMEDSVENEYIVTDE 6257          
BLAST of GH13743 vs. nr
Match: gi|1317991440|ref|XP_023288883.1| (uncharacterized protein LOC105696885 isoform X2 [Orussus abietinus])

HSP 1 Score: 2808.48 bits (7279), Expect = 0.000e+0
Identity = 2242/6743 (33.25%), Postives = 2998/6743 (44.46%), Query Frame = 0
Query:    1 MVVFLPISSGQLVGRQPNDLSIDKGVFFLNVEDGFFGCQVNASVDVLQLFEISKLCDGVPDCYRGSDEANSQIKCTKDCLYTTGRHCQHGACLDSQCYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTN-PCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGR--FACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVC-FNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPN-GRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLS-GCRGEST-------FECTQDSQCDQGESCLSSRCVCRRGYERNP-AGDCVDLNECLL---GNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCS---NCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQ-GKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVE--CGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYG-NPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDD------------------------DLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEK-----CSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMV-SDGMPICLCNSGFEKNKLTGSCD--VYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSN-GQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQ-IEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKND--RGDLC-PFGQCQTTCASSS--QCPPGQICKSGICAAGCSSNTHCEEGR------VCITGKCQDPCTETCGPNALCS-PEFENLCQCPEGFAGVPTAA---QGCVRIPPTCT----------------------TDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCG---AGGQCSCQPGYE----------MTQSGCSDLNECKNNI----------------CGAGKTCANTPGSYICSCPTNQVPDE-------SGACRSPDQCSSDQDC-NDALACLADSLSGAKKC--LDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEY--------------------PCEGFTCGHGS-CHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCTNEQGS---------------------YQCTCHDGM---------VGDPYTQGCKPKA------------------------------QCYSNSECSSDTRCQNGRCVDPCDG--FCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPR-------------------------------------------------ECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSR-----SECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPST-CILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDN--------DCFLGHVCLDKMCKVG--------------------------------CSAPKDCPNSQSCI----NHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPV-VACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKIC------KEVCRSDSQCQSKEICQGISCSQG---------------CRSDPDCTADKACH----------------NNQCIGRSSKRKVTNRTGSIIAHL---------------------------ADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVP---CSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCN-EGLCVQICNSNTQCQAGLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCRNPC-NGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKT------------------ECTTNGQCSRDKSCEGGRCINLCSESNS-------------------------------------------CGKNAECRMNNHRAQCVCPSGFYGNALQEC----------------------------------------VVDRN---------------------DCLLPNQCGENAQCL-NQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECP-------------------------------ECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATH-KCEDNERCIAQRHKPKCTCK-----------------ERLLINSAGELICPQQDVQ---CLYEDQCPSTLSC--IDGACQNPCQGT-----SCPDGKSCQVLNHQALCICTKD------------PCSISPCGDEAICRAVEG--NAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSL---GCVEPAD---------DPCTPSPCGAFANCLVVLNQLKC-VCPPGLFGDPFIQC-QPVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIR--------------------PL----------------PQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGD------------------------PYYQCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPN-------PPEPLETDPCSACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAEC-------------------------------SEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPY---NEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVEC----HKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAP-PDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPCE--TCGQHAICHIHNNIAACKCEDNYIDKPPNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQP----------IDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRCIPAGCRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYE---GCTQYECKRHEECPSTLACRDFKCVDPC--DCAVGANCRVSNHKTTCTCPPGFTGDPYS-----------RDDP----------------------------PRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGF-------------------------------------LFIGDFECK--------APE-RPECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPY--------------------------TVCQKAGCQ------------------SNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQY----------------------------------------------ECLVDSDCPYTLACPNRECIDPC--QCAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFL--------RPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSCLEIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQVECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPCNCGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCS----------------------------------------TF---ECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPC--DCGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPC--ACGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASI------QCTPVKTCP---------------------AGSGLILNEFEECVCPPGFVLDSQGIC-----------APCRFDVGFIIENGRCICDYTKGFVLDLSGKKCVCPENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPP 5754
            ++    +SS  +  R     ++   VFFLN+EDG+FGCQ+NAS D+LQL E+SKLCDG  DCY G+DE   ++KCT DC       CQ+G CLDS C+CNDG+GG  C +PD NECKYRPCD+F +CTNTLG F CSC  GY+GDGFHCKDIDEC+ P +A  CV+NAECCNLPA+++CKCK G+ G+G+  C DIDECLT   CG N LC N  GN++CEC  G+ G+PH  CVD++EC +   CG  A C N+ G Y+C CP G  G+P +               C    C ++ALC     G  C C EG  GDP   C DI+EC S +   CGV AIC N  PGY+C CP GY+ + +   +C    V T C S+FDC NNA+C     C C+ GF+  G  C+DI+EC +  NPCG  S+C N  G ++C C    +G PP  PC+ PC EV CG  A C+    EA+CICEEGW +NP +I++GC+DIDECD    P+G+CG NAIC+N+PG F+C C  G++G+    C D+DECA NR  CG  A CTN  G+YSC C      +P          +C +D +C GNA+C     C C +P +G +C   C D TC PN++C++ N    C C  G+   P  G  C DIDEC  NPC   A+C+N  GSF C+CP G +GDP + GCR             C    QC + E   SS C+C+RGY RN  +G C D+NEC+       CG+N++CKNLPGSY+C+CP GF GNP++ C+ C+   C C PPY+ +EG+C LA CS    C   A+C+ I GG+SYCACP+G+        CEDI+EC    H  CG GA+C+N PGS+ C CP G  GDP+ G C P +  C S+++C+ NE+C+Q G+C+C PPF++D  DGN CK+PC+RF CG NA+CTPS+PP+C+C+AG+ G+P  GC D++EC  NPC  G+ C+N    + CEC    +GDPY  GC+G    +  C ++++C   LACI   C NPC +V CG NA C  + H AWCRC  GF E     CVS C+  +CG  A CIVS  GPTC+C EG +GNP+PGG C+   CS   PC+E    C  GRC  +C    CGV A CDP    C C   F+G+P L+CMPP Q   C   CG N+HC YG +   C CN G  GNPY GC       DC S  CG +A C       EC C  G+ G PY +C D++EC  + CG +A CINT GGYDCRC   +VGNPF  C   +A    D                        D C++  CGP + C  G C+C  G+ G DPND   GC     C  +  C   +IC  +   G R C D C + QCGPN+ C+T +H  SCIC DG+ G+ +D   GCQ +       CS NEDC  G  C    +G   C+D C   +C  +++C   + G  +C+C  G+E N  + SC+      C  D +C     C   + G+  CV  C +  CP  + CV+  H+  C CLPG+ GNP+DR+GC    ++ CSS++EC E   C+ ++ G  +C+P C ++ CG  A+CVV NH   C CP GL+VG+P   +GC+ V CV N DCP  + C+RL++TC D C +  CG+NA+C    H+  C+CPP F P+P P+V C   D    D C P   C    +++   +CP   +       AGC    +C +        VC    C + C   CGPN +C     E +C+C   F  VP+      GC+R    CT                      TDC  S +C N  C+  CTSHG C   E C NG+C+  C  +KNC   + C+   C+  C  D+ C    VC        C+C  G++            Q+GC   +EC +                  C  G+ C +     +C   +N +P E          C S   C+ DQ C N    C    + G + C  +D C+   C P A C  ++    CSCP    GDP     GC    +                    PC   +CG  + C   DHA  C C  GY    + C  + EC S   C +   C  E                          C C+ G          V +  ++ C P A                              +C+S+ +C S   C    C +PCD    CG  A+C+ ++H P C C  +  GNPKI+C+ LEC  ++DCD + +C  NKCVD C +S +CG  + C  SNH  VC C  G TGDP                                                   C  N  CP    C N VCV+  E  C+ D +C  ++ C R     +ECK  C     CG NA C ++ HQ VC C  GF G++  E +   S  C  D +C     C    C   C + N C +N  C     + TC   +         C L  +CL+  C  G                                C    DCP S +C+      +C D C   QCGPNA C V      C C R +  NP+ + + C  +PI C  +  C  N  C    C+P C  D +C  +++C    C      K  C  ++ CQ +   +  SC  G               CR D DC+A  AC                 N +CI  S            + H+                            +PC +  CG NA C   N +A CSCP G   NP         P   C    DC     C +G+C   C    +CL NE C+  G+C  +C  +  C++G +C    C  GC S+ +C ++  C+   C D C    + CG  A C   NH  QC CP+   GDP   C+  +  C S  + C  G  C+   C+ +C + A C   E C  G C   C     C     C   +C  GC ++  C   E C    C+NPC +   C   + C+V      C C   Y   A   C+K+                   C +   CS  + C  G C   C   N+                                           CG +A CR++NHR  C CP GF G    +C                                        VVDRN                     D  L   CG NA+C  N +GG +C+C  GC GDP++GC C         +G   +PCN    CG  A C++ ++Q  C CP                               EC       +C+   G    P VE   T  ECG  AEC   + C+ G C+DPCA    C  N  C    HK +C C                  ER    +               C     CP  L+C    G C++PC  T     +C   K CQV NH+  C+C               P +++ C  +A C +      A C+ P   RG P             AC  +  C  L  +P+C C     P   + L   GC  P D         DPC  S C A A C V  ++  C  CP G   D    C + V+   +  C PSPCG  + C +    + +CSC   + G+P   C  EC   ++C SDQ+C   +C +PCP  CG  + C V  H P C C  G++GD +  C    V  P +                     P+                P+C+ + +CPS   C + +C+DPC   CG  A C V NH   C C  G+ G+                        PY  C V  NR VCSC PGY G PP+CRPECV+  +CP    C+  +C DPC + CG  A CQV  H P+CSCP G  G+P+++C      PP  PC PSPCG NA C++   +  C C+ G  G PP CRPEC+   +CPS+  C + KC DPC   CG+NA C  +NH+ +C C    +GDPF  C+P        P +P    P   CG NA C  R N    C+C  DY G+ Y  CRPEC+ N+DC  ++AC+ NKC +PCIG CG+NAEC                                 P +PC P+PCG  S C   ++  A+C CQ  YIGSPP+CRPEC   + C  +  C+ +KC DPC   CG+NA C                                        HV+ HNP+C+C  GF GDP     +  +  P  I +   PC P+PCG N++C E +   +C C+  Y+G    +CRPECV+N +C    ACL+ KC DPC    +CG+N  CNV   H   C+C   Y G+P  EC     +P     TE    PC    CG  +   +RNG+ +C C+P Y G P   C+P CV N+DC  + AC+NN CVDPC    CG    C+V +H   C C PG+ G+P   C +    T      DPCE  TCG ++ C      A C C+  +I  PP+CR EC    +CP++ ACI   CA PC   CG+N  C V+NH+P+C C P Y G+P V C   K+  P          ++PC+PNPCG N++ +  GS   C+C P ++G P   C  EC  + +CP   AC  N RC NPC G CG  A C V  H  +C+C +   G+P + C P         P TE     E  +PC    CG NA+C  R+   +C C   + G+P++   GC   EC+   +CPS LAC +FKC+DPC   C + A C+V+NH   C+CPP +TGDPYS           + DP                              PP     C  N +CP   AC+NS+C DPC+ N C   A CT   H   C CP+GF                                     +  G   C          PE RPECV   EC  HLAC+++RC DPC   +CG+NA+C V+  +PVC C   + GDP+                          TVC+   C+                   ++ECP  + C+  +C+DPC  + CG N  C    H+P+CSC+ G+ G+P+ +CR+                                               EC+V S+C  T AC N++C+DPC   C  NA C V NH   C+CLP   G+ +                          ++C+D    NP + +        +PCG ++ C+  + VP    +C C   Y        I         C  + DC  ++ C N+ CI+PC     C + A C V +H   C CPAG TG+P+V C+            +  E        NPC     PCG  A C+       C C   + G+P   C Q ECI + DCP +KAC+ NKC DPC    CG  A C    HI  C C PG  GNP   C              E+  +   T    C    C   +IC+  N +  C CQ   +G         P      C ++ +CP   AC  +  C +PC     C  D  C V++ +P    +C CP GM       C   P++      + C  +             CG  A C  +    +C C   Y G+P     + EC  + DC   Q C    C DPC+    CG N  C  ++H  TC C PGY GDPF +CS                                        TF   EC  N +C  TK C+  +C+DPC  N  CG +++C V  H+  C CPPGT G+P   C    P   P E                      PC T  PC  +++C VVD        C C+ G++ +        P      C+   ECP   AC++  C+DPC   CG+ A+C +  H P+C C E   GNP   C P+  +     ++P  CAP           SPCG NAEC   G  A C    + V   P                N Q          CT + +C    ACI   C++PC   C  NA C++ NH  VCTC + F GDP   C+ V              I     P    D  PCG +A C+   +   C C PG  GNPY  C   EC  NS+C   R C   +C+DPC   D C   A C V NH   C+CP    G    SC+ + +  VG  D              PC    PCG N  C    +    T TC CLPG  GDAS       +C     CP                     A +   +N    C CPP    +    C           +PCR +    + NG   C Y                              PEC V+ +C+  + C  F+R C DPC+   CG  +     +H+  C C  GY GDP   C    +P  P
Sbjct:   21 ILALWMLSSHLVESRDGFGHAMRGQVFFLNLEDGYFGCQMNASTDILQLLELSKLCDGHADCYEGTDERPKELKCTSDCKKGADDECQNGVCLDSVCHCNDGFGGCNCHVPDENECKYRPCDIFAHCTNTLGGFQCSCFPGYQGDGFHCKDIDECEDPAIAALCVENAECCNLPANFLCKCKQGYTGNGEEYCEDIDECLTPNACGDNALCRNIPGNYTCECPAGYTGDPHVTCVDLNECESKGACGRRANCINIPGAYKCICPDGYDGNPEEECSDV--------DECLGNPCHRSALCTNVEGGYRCLCPEGTDGDPLSGCHDIDECASYN-NPCGVNAICKNSVPGYKCVCPQGYSANPKPDVSCIQTNVTTRCKSNFDCVNNAECKEE-QCFCKSGFEGVGAECKDINECIT--NPCGPASVCGNTKGGFQCDCETGFIGAPPHVPCKAPCDEVVCGAHAFCKADGQEAYCICEEGWTFNPNDIAAGCIDIDECDVVNGPSGRCGQNAICTNTPGGFSCQCKAGYSGNALKQCIDVDECA-NRDACGHGATCTNTEGAYSCSCPKDTIPNPDPYIKCVGVVTCGTDDDCPGNAICDSQKRCLCPDPNIGNDCRHPCEDVTCGPNARCMLINDEATCLCSSGYTGKPRIGEGCRDIDECGANPCPPGAVCKNEPGSFSCECPGGMSGDPYTGGCRKSELPHVCGPHLPCPTGEQCVKDEFIGSSVCICQRGYTRNAESGKCRDINECIELTDKQACGLNAICKNLPGSYECQCPPGFNGNPYSLCEECNSIECQCQPPYRIVEGKCILAGCSKGEKCPGGAECITIAGGVSYCACPKGFSTR-SDGLCEDINECTD-SHQVCGYGAECVNLPGSYQCVCPHGYDGDPYNGLCSPAQKRCISDNECKPNEKCVQPGECVCPPPFYMDVFDGNSCKNPCNRFPCGINAKCTPSDPPKCMCEAGYEGDPQHGCIDVNECINNPCAPGAHCVNTKGGHSCECGKDLSGDPYGAGCTGVPVAKQGCTSNNDCENYLACINGNCQNPCDTVSCGPNAFCEPDKHTAWCRCVVGFNEGQNNECVSPCDGFVCGIGAHCIVSYDGPTCKCIEGFMGNPFPGGRCTPDVCSPDVPCVEP-SICVSGRCKRRCEDVICGVGASCDPVSGKCVCNPYFVGNPDLLCMPPVQPPLCDPACGNNAHCEYGLDKAKCVCNPGTSGNPYHGCGAQEK-SDCSSALCGKDAQCIAGPNAVECLCPSGFAGNPYIQCYDINECNGNACGAHAVCINTNGGYDCRCMEGYVGNPFRMCQESQANPCSDPTTCQCGPEKLCPRDYSCIEGRCVDRCSDVTCGPKSGCQDGICICPPGYSG-DPNDQENGCRLTGHCSNDQHCDAQQICFQVG-KGVRKCVDGCSKLQCGPNALCLTQHHVSSCICIDGYLGNPSDLVEGCQPKRSGAVPTCSRNEDCRQGFLCLQQDDGIHECVDACSKTTCGAHQRCEADAGGHVVCVCQDGYEWNPESFSCEKPAVPDCTGDQECKSDSVCRPDAVGVLKCVSICGMFTCPENSRCVASEHKARCECLPGFEGNPNDRTGCQTARRDACSSDSECPEDSTCRSTDEGVLACRPVCDFVRCGPNALCVVNNHAAICECPPGLYVGDPDGGDGCKTVPCVYNIDCPPTQLCNRLTHTCYDACDDSACGQNAVCVADDHRAVCRCPPGFKPNPLPDVECIGVDVCNSDSCHPSAICVADASNTPICKCPENHVGDPYF--AGCQPEGYCADQHDCPLHSVCKNHGCVNICDNVCGPNMVCEIANDEPVCKCNYKF--VPSTKGLHHGCIRYTSYCTIDADCEGTVCLEGQCRAVCRSDTDCSHSEICQNKKCVVSCTSHGNCEADEACINGICILGCRGNKNCPLNQSCIQSKCQDPCARDNVCGPNAVCNCVDHIATCACPLGFQGNPTPDQGCVRIQNGCRTSSECPSQHVCSNGFCQCQCSQQVDCAQGERCKSGLCVKVCYGESNCLPGELCINGSCEAGCTSDAGCNVDQICINSKCRCSHGFVPGPEGCVDVDECEKQPCHPTAECTNLRGTFRCSCPQGRIGDPV--VTGCAIPHHCSSNSDCHDSQACIQRNCSDPCSFVSCGSNTVCSVFDHAASCQCLTGYIGDATGCFKV-ECLSNTDCSSDKYCNQETNKCTSPCNQVNCGYGNCVAIDHVAVCKCYPGFTLVDEICADVDECASKPCHPTAICHNTEGAFTCKCPHHLVGDPLTLGCKQPGECFSDLDCPSSASCLENMCKNPCDDPTVCGQNAECISEDHIPFCRCPEQTTGNPKIRCDHLECNYHSDCDPNSACFTNKCVDPCSVSNVCGNGADCSPSNHSAVCVCQPGKTGDPNLGCTPVQYCQTDTQCPTGLACKGGICTALCTNTRDCFGEQLCINGLCQPTCRSNASCPDFQYCRNNVCVQ--EFRCVHDSDCEQEEKCVRNDVGQAECKRACDL-IFCGRNAECRAEVHQAVCFCREGFHGDANDEKIGCQSIECETDDHCSQEKICTDRRCEIACLTRNPCGVNAVCSASNHVQTCTCQSGYTGNPYQGCELVDLCLNGPCAPGATCDNSRGSFRCNCQPGTVGDPYNGGCQQPVECVQDDDCPLSATCVPLDDTLKCADICARLQCGPNAECVVDAHVGSCRCHRDYDGNPNDLRIGCQPKPIGCSTSSDCSPNMYCYEQICRPTCQLDEECNLSDICFNGQCLNPCDVKNACGLNADCQVRNHVKQCSCPPGFTGNSTIECVRFPVACRDDNDCSATDACRENVCLPLCNIDNDCALNEKCIQGSCLLTCRLVNDCFLGHVCLRNICTAGCRGDQDCDANEACVGNKCINPCELMPCGPNARCTVLNQRATCSCPAGFMPNPSPKIACLRSPGTQCHENRDCEIGTRCLEGSCTPVCSSHANCLSNERCDVNGVCKSLCKKDEDCRSGEICEGLVCSKGCRSDGECQNDYSCLNNLCTDECA-LPNACGINAKCKMANHGRQCYCPQPLVGDPNVGCKQPFHPC-SLNDDCLPGQTCYDRRCSDACRSDANCLNDERCDGGLCKPICNSDDHCAANQICRNRLCTEGCRNDNACSAEESCIQNACKNPCLDSKVCGECAECRVINHAIQCSCPVNYYGNALISCSKSLIPCDGSCECNEIGFCVKSCGSQSDCSCGEVCYNGMCQMKCDNHNACHKGYICQEGLCLVGCRINSDCPSSLTCINGRCTDPCLNGNSPCGVDALCRVSNHRVVCFCPEGFQGEPSVKCYQLECQQDNDCESNKRCGEDGICTNPCLKHDACGLNAQCRVVDRNALCSCPPGHFGNPKISCRRGGDECLRRPCGPNAKCRDNSVGGVECICEPGCYGDPYRGCVC--------ERG---DPCN-EVQCGINAECRIYDNQPQCFCPPHLPSGDPAYACTSAGSSKTDCRTSGCGKGAECIREGTVFVCRCPPGANGSPNVEC-FTESECGEDAECPSEKACLGGQCLDPCALRGACGANALCRVVAHKARCACPQCHVGVPRVACRPDPKCERPSSGAPAPAPPSGPPAASRGCASHADCPGGLACHAATGECRDPCLPTGGRPRACGPDKRCQVRNHEPTCVCRGGFVVNELGELACAPDTLA-CTQDAECPSNAACIAARCQNPCNARGKP-------------ACPDDKTCNVLDHRPICTCTRDCTPSLSICLRDTGC--PPDLTCRNYRCVDPCAESTCPADAPCYVEEHKPICKFCPVGFVPDSQYGCLKEVDIKVESPCHPSPCGPNSVCQVK-MGRPVCSCQSNFVGSP-PDCRSECLLSEECRSDQACVFQRCTNPCPSSCGPNSDCTVVDHSPYCSCEVGFEGDAFVGCTRIIVEPPEVHDPCVPSPCGSNALCNVKDQGPVCTCIPPYVGNPHDGCKPECRISAECPSNLACINQHCLDPCLGVCGTEARCEVSNHVPVCTCLAGYTGNPFQACKLEISPLPPQNPCTPPPCGPYSTCRVMDNRAVCSCMPGYQGTPPSCRPECVVSSECPLHLACIGQKCADPCQSGCGLNAHCQVSNHNPICSCPSGYAGDPFQQCIKEEIRPPTNPCLPSPCGPNADCRVHANRPTCTCVAGMFGAPPNCRPECVIQEDCPSYLACIRNKCSDPCIGSCGLNAKCTCQNHRPMCYCYEGYEGDPFSGCNPKVQVSVTPPNQPCNPSP---CGSNAICTER-NGVGSCTCLSDYTGNAYEVCRPECVQNSDCLQNRACINNKCKNPCIGACGLNAECQVFNHRPSCSCATDHTGNPLVSCYATQPTETKVPTEPCLPSPCGAYSNCRV-IDDHAVCSCQPGYIGSPPSCRPECVVSADCDQNKACIDQKCEDPCTNTCGQNANC----------------------------------------HVINHNPVCSCNPGFTGDPLIICAKESVVTPSPIPSG-NPCLPSPCGPNSQCREIDGFPACSCLPGYLGR-APNCRPECVINEECLGNFACLNEKCIDPCP--GSCGVNTYCNV-VRHRPLCTCNAGYTGNPFTECIPIVQEP---TTTESPRTPCDPSPCGANAVCSDRNGVGSCVCIPEYFGDPYTGCRPECVTNTDCNRNRACLNNKCVDPC-PGACGRQATCFVTNHTPSCTCMPGFSGDPSQECVRMEVTTPQVTS-DPCEPSTCGPNSNCIASKGYAVCSCKTGFIGSPPSCRPECTTSTECPQNKACIDNTCADPCPGSCGQNTKCHVVNHNPVCSCAPGYTGEPFVHCA--KIEMPLTGDKTLEGGVNPCVPNPCGPNSQCKVVGSQPACSCTPEYFGRP-PFCKPECKDNSECPPLTACI-NERCKNPCQGACGQYARCAVQNHAPVCTCFDGHTGEPSLGCTPI--------PVTEP----EPTNPCEPNPCGPNAQCRERNGAGSCTCPLNYLGDPHDPVRGCYP-ECEADRDCPSHLACVEFKCLDPCTSTCGLNALCQVANHNPVCSCPPNYTGDPYSVCIVEELKVYPKADPCLPSTCGPNSKCKSVNDQAVCTCIPGFIGLPPNCRPECTANSDCPVHLACVNSKCADPCV-NTCGLRAQCTTRGHNPICTCPSGFTGDPFNLCSPHVTEVIPVVEQVPSCTPSPCGPNSQCQIISGTPACSCLPNYIGAPPECRPECVLSSECESHLACVNQRCQDPCVG-SCGINARCHVSNRIPVCTCMESFTGDPFFQCTVIPISTQPTVRDPCNPSPCGPNTVCRDGDCECLPEYFGSPFEGCRPECVLSNECPRDKTCVRNRCKDPC-VDVCGENTRCDVVNHIPVCSCVPGFIGDPFVKCREQPKEVTEYEDPCSPSPCGPNSNCRANDRHAICSCLQGYLGVPPFCKPECVVSSECSPTRACINKKCVDPCPGSCGLNARCEVINHSPICSCLPNQTGDPF--------------------------RSCYD----NPVVVVEPEDPCSSKPCGPNAHCRNVNGVP----SCTCLPSY--------IGSPPSCRTECIINPDCSTNKACVNSKCIDPCPGS--CGNDADCKVINHAVICTCPAGYTGNPFVQCIV-----------RKEEV-------NPCEP--SPCGPNAVCEKQGSAGACRCVEFYHGDPYEGC-QPECIINPDCPANKACLGNKCEDPC-PGVCGTLAQCTVVNHIPVCTCVPGYVGNPFTLCRP------------EEQPVTESTRVEPCTPSPCGPNSICQVANSQAVCICQDNYIG--------APPNCRPECVVNSECPQNRAC-HKYHCNDPC--PGTCGVDALCYVVNHNP----LCTCPSGMTGDPFSRCYVQPAIPPAAMRNPCAQNP------------CGLYAECRSVGDQAVCSCLKNYIGSPPNC--RPECSVNTDCLPSQACISEKCRDPCI--GSCGQNTNCRVQNHIPTCICQPGYTGDPFNECSPIIEVPPVPADPCNPFPCGPNAVCDNGVCTCRGNYFGDPYTFCRPECTMNSDCDRTKSCINQRCIDPC--NGICGVDSRCDVVNHVPMCSCPPGTTGNPFTFCRIYQPPTVPAE----------------------PC-TPSPCGPNSICRVVDDY----AACTCQDGYIGN--------PPSCRPECIVTAECPLTQACLSNKCEDPCPGTCGQNAKCQVVNHNPICSCEEKDTGNPFERCYPMALEGPKLPRNP--CAP-----------SPCGLNAECQIRGDSAACSCLPNYVGVPP----------------NCQ--------PECTINPQCPPQLACIQQKCRNPCDGLCVLNARCSVINHHAVCTCLEDFTGDPFNSCQPV--------------IKELPAPPKPCDPSPCGANAYCRESFNGVTCECTPGYRGNPYDGCRP-ECLVNSDCPASRVCTRMKCEDPCI--DTCGLGAICTVSNHVPICSCPAKTTGYAFTSCEPIAID-VGIVD--------------PC-NPSPCGSNTICEKSGS----TATCRCLPGLTGDASSAAGCRPECVLASDCPGDKTCADSRCIDPCSRDVCGRAATCRAVNHSPLCSCPPPLFGNPFVECYEKEEIDPCNPSPCRSNGECQVRNGVASCIY------------------------------PECVVNSDCSRDKSC--FSRKCRDPCIGA-CGVNSLCQTVNHKAVCSCPSGYEGDPRIQCRIQDLPVAP 6373          

HSP 2 Score: 2283.06 bits (5915), Expect = 0.000e+0
Identity = 2127/6835 (31.12%), Postives = 2906/6835 (42.52%), Query Frame = 0
Query:  121 CDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKV-------------ECRDIDECLTNQ--------VCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDG-RFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPP---------------------EQPCRDPCLEVN-CGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSIS-PTG---KCGV-NAICSNSPGSF---------------------------NCVCAKGFNGDPYIGCFDIDECAEN------------RFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDAT-CFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNP---FTSCQ----SCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNP-RTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPF-----------------------QGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTN-GCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVA-ENHAAWCRCKSGFAEDSQGNCVSLCNQVIC-------------------------------GSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQC----------------------GQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHC-------IYGNPNSCACNIGYFGNPYTGCEVTTSVEDCD-SLKCGDNAVCSFASG-KPECTCKRG-YDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQ----CLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPC-QQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCL------------------DPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCR------------------------KVSCVENEDCPDNEFCDRLSYTCMDPC-----QNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRG----------DLCPFGQCQTTCASSSQ--CPPGQICK----SGICA---------AGCSSNTHCEEGRVCITGKCQDPCTE-TCGPNALCS-PEFENLCQ-CPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCARGE-QCSNGM------CLKLCHTDKNCLQGEICVDKFCE----PGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQ-SGCSDL--------NECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPC-----------------------------------DIS-----------YCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCY-----QVEYPCEGFTCG---------HGSCHPEDHAPKCHCQDGY------QLIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGFCGIGAKCVVKNHSPKCSCLPRWRG------NPKIKCELL------------------------------------------ECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPREC-----EQNLDCPGD-------GKCDNFVCVKPH----------------EKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNP-SPVVACTREPIT------------CQGNKQC------------PENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEG------------------LCVQI---------------------CNSNTQC-----QAGLVCIDRQ------CVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQC-----GSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCI----SGCGSNRDC------------------PYG----EMCEGGQCRNPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQEC---------VVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLN-----PCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICT---------------------KDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQP---VEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRP--------------------------------LPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCI---------------------------VRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPP---KQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPN-PPEPLETDPCSA--CGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAEC-----------------------------SEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEII---DPCANRECGPYSQKVERNGICTCSCLPGYVGAPPD-CQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPC--ETCGQHAICHIHNNIAACKCEDNYI---DKPPNCRRECVLHEDCPKHLACIQYKCASPCINQ-CGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQPIDPCLPNPCGENTE--HRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRC----IPAG----CRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQYECKRHEECPSTLACRDFKCVDPC---DCAVGANCRVSN-HKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFLFIGDFECK---APERPECVSDPECPLHLACISERCLDPCT-SQACGVNAKCTVTTHVP----VCACELDYVGDPYTVCQ------KAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQY-----ECLVDSDCPYTLACPNRECIDPC---QCAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLR-PCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACI-NPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSC--------LEIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASN----HRAVCTCPIEWVGNPMRECHQY----ECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQV----------ECQQDGDCADNEKC-DLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPCN----CGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPG-YQGDPFVKCSTF-------ECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQ----HMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPC----DCGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCR---------------------------------------------------STCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIV-VGCTSDDECGDARACINAICKDPCACGPNAVCTIENHRPVCTCKDGFYGDPEIVC-KEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKTCPAGSGLILNEFEECVCPPGFVLDSQGICAPCRFDVGFIIEN-GRCICDYTKGFVLDLSGKKCVCPENHS--INDNGICEEE-PECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPPPVDIDRPEIVVNCLSDGVGVGLTISDPRYHGLIYVKGHSQDPNCRLRVDEGQNGQR-IDFHVKFGTCDLAYDEDGYAHFILVI-GHAKLMTYKSQAYRIRCIYSTGEQNISHGFNVSILTTAGTIANTGPPPTCIMRICNSNGEDISQAEIGDKLMLKVEVSPGEIYGGFARNCIARTVDETNEETVYTVTDDNGCATDPSIFKDWEYNRDKGYLSAVFDAFKFPNSNTIKFKCNIRVCFGQCQPQNCAGRNAFGRRRRESEHEIAGTV------YTGQLREEIKIESNAILAIERKAKRLQDNLQNRYIGN--EEVCVSKIGFIIALVITALLALVAVAIAVSCWLMAYRRRPRTEGPLPHPPEFPNPLFTTPEPLAEPTPDY 6128
            C+V   C N+     C C+ G+      C D+DEC+       C   AEC NL   + C C  G  GD  V             +C D   C+            CG NT+C       SC+CL G+ G+   GC  ++                L N  C      S D Y   C  +     S   CN  +CG    C    +  +C C  GFT   +I C D++EC S     C   AIC N    + C+CP    GD     C   K    C SD DC ++A CL N              +C++  +  +    CG N+ C++      C+C     G P                         C DPC   N CG  A C      A C+C+ G   +P   + GC  +  C      PTG   K G+  A+C+N+   F                           N VC + F       C   ++C  N               CGR A C  +V    C C  G   D +      +   C++D  C    +C +             CE AC     C  N+ C   N +  C C  G+  +P  + C  +D C   PC   A C+N  GSF C C  GT GDP +G   +   EC QD  C      LS+ CV        P  D +   +      CG N+ C        C C   + GNP      CQ     CS SS  C P     E  C+      C+   +C           C  G  +NP   KN              CG  ADC        CSCPPG  G+                         +  CLPL   C+ ++ C  NE+C+QG C+ +     D   G+ C        C  + +C                    G + ++ C L PC   + C        C CP G   +P     C  S   +C  + +C      IG++C+    +  C S+ANC++ E       CKS   +D       +C  ++C                               G NA+C ++  G  C C + +VG+P  G       CS    CL  GQTC   RC   C                        + C  N  C  NRL   C  G   D          Q  C + C  +  C       +  +   C+C + Y+GN    C  + S+  CD S +C +   C  + G + +C+C    Y+G+   +C + + C      +   C+       CR +SD   +       +     D  L  N  CG +A+C +      C C  GF+G+      +       CQ + DC  N+ C          C++PC +   CG N+ C   +    C C  G  G+   P+  C+R         C     C  N  G   C+                  DPC  + C  N +C + D  P C C           +C        D                      C    C  GAEC+ EG    CRC PG +G+P+       F++++C  +AEC   + C    G +   P      CG  A+C V  H  +C CPQ   VG P++  CR                           C  + DCP    C   +  C DPC     +   CG +  C V  H+  C C   F+ +   E+ C  +               C   +CQ  C +  +  CP  + C       IC          + C  +T C     C   +C DPC E TC  +A C   E + +C+ CP GF  VP +  GC++       D    S C    C P      +  R    C +        C   C   + C   + CV + C       C  +SDC    V      CSC+ G+E     GC+ +        + C  + CG+   C       +C+C    V +    C+   +C    +C   LAC+       + CLDPC                                   +IS            C P +TC V+ ++A CSC P ++G P + +  C       +   C G  C          +  C   +H P C C  GY      Q I    +        +PC  +A C        CTC  GM G P    C+P  +C    +C S   C   +C DPC G CG+ AKC  +NH P C C   + G      NPK++  +                                           ECV+N+DC  +++C+NNKC + C   G CGLN+ C++ NH P CSC + HTG+P              P +       G   N   +  H                   C+V  +C+ ++ C   +C+DPC   N CG NA C   NH  VCSC PGFTG+  + C +   + +  S  P    C  S           C  N +C E      C     C  G++     C+  C   ++C  + +C+N +C DPC  + CG N  C V+  +  C C  G+  NP +  +   +EP T            C  N  C            PE F    + C+P C  ++DC  N  C    C + C     C  +  C   + +  C   P  + D +    +C+    + +VT    +     +DPC  S CG N+ C      A+CSC  G  G+P   C+P    C+++++CPQ+K C   TC   C   G C QN  C+                     C +I                     C  N+QC     Q    C          C   C  N++CP  + C+  +C++PCQ     CG+ A C  QNH   C C  G +G+P   C    +      N C     G    C     A SC                C  +C+   DC +   C+E  C+    S CG N  C                  PY     E  +     +PC    C PNS C+      +C C  G+  L      + ECT N  C    +C   +C + C   N+CG  A+C    H   C CPSGF G+    C         VV++     P+ CG N+QC    G   C C     G P +          C +  AC+N     PC   GSCG  A C V N   +C C E + G+P       F C   P +  + T R+    + C  N  C  G C              C+ +               S  E   P+    C+  ++CP   +C+   C++PC    C +   C V+NH  +C C                      +DPCS SPCG  + CRA + +AIC C +G  G P     K E   ++ C P  AC                    ++  CV+P      P  CG  A C V+ +   C C P   GDPF  C     V   P+D C   PCG  A+C  N      C+C   Y G+P + C  EC  + DC ++++C N KC DPCPG CG  A C+V  H   C C  GY G+P+ QC+V +    P  P                                 P+C  N DCP+ K C    C DPCP  CG  A C V NH   C C PG+ G+P+  C                            V  ++ VC CQ  Y G PPNCRPECV+  +CP +  C +  C DPC   CG  A C VV H P+C+CP G TG+P+ RC +    PP   + PC  +PCG  A C+ V  Q  C CL  ++G PP CRPEC  + +C   + C  EKC DPC   CG N  C  +NH   C+C     GDPF+ CSP     P+  DPC+   CG NA CD       +C+C  +Y GDPY  CRPEC  N+DC   ++C+  +C+DPC G CGV++ C                             + P +PC P+PCG NS+C   V+  A C CQ+ YIG+PP+CRPEC   + CP    C+  KC DPCPG CG+NA+C+                                        V+ HNP+C+C E   G+P+        E  +    PC P+PCG NAEC  +  S +C C+ +YVG P  +C+PEC +N  CP  LAC+  KC++PC+    C +NA C+V N HHA C+CL D+ GDP   C       V +E+     PC    CG  +   E     TC C PGY G P D C+P C+VNSDCPA   C    C DPC  + CG    C V +H   C C     G     C       I     DPC    CG + IC    + A C+C             CR ECVL  DCP    C   +C  PC    CG+ A C  +NH P+C C P  FG+P V+C      + IDPC P+PC  N E   R   ++CI                 EC+++ DC  +++C S  +C +PCIG CGV ++C  + H A+CSCP   EGDP I+C    +P      C    +CP    C++R C D C   +CG+N+ C  + H + CIC  GF GNP  GC++  CK    CP T AC + +C+D C    C + A C+    H+ +C CP G  G+PY     P        C  N +CP   AC   +CVDPC    C   A C V+ H   C C  GF+      C       RPEC +D +CP  LAC    C +PC  S  CG N KCT    +P    +C C  +++GD    C+      +  C ++SEC   EAC+NRKC +PC    C  +A+C    H   CSC  G  G+PY  C +      EC  +SDC  TLAC N+ C +PC    C +NAECS  +H  +C C  GF GN       P          C+ + DCP  + C +G+C  PCL     CG  + C    TV      C+C  G   N       Q+  I   CQ ++DC   + C+    I  P    + C++ A C  +DH  KC C  G TG+P+V C        + IV  C  D EC     C NGNC++PC    + C    EC   +       +C CP + + +    C++     EC    +C + + C++  C + CL+T CG  A C+S+ H   C C PG  GNP V C +V          +C  + DC+ + +C + R  +  L+ N   C   ++C   +HR  C C      D N  C   P  I A CR + DCPS  +CI+ G C +PC     C  +  C V++  P+    C C      G+ G+     + + CES + C + + C N +C++PC+    C   A C   NH   C C P Y+GNP+  CE++EC ++ +C  +  C +  CVDPC+ +  C  NA C  RSH+  C CP   + GDP+  C          EC  + ECP    C    C DPC    PC  NA+C V          C C  G   D    C P P    PV   C  D +C+   ACI + C+ PC     C  +A C V +  P    +C CR G+  +   +C      T + C    +CP D +C+N  C +PC     CG  AECF  GH   C C  G  G+    C  I C ++ +C     C  N  CV +C+ ++PC S AEC+   H  +CR                                                   S C V+ TSP R ++C+CP GY ++ +  C  +  IV + CT D  C   +AC+NA+C+DPC CG NAVC +  H+P+C+C  G+ G+P I C K  GC+S+ EC  T  C+   C   C    V C  +A C+ +NH+ +C CP G EGNP VSC   ECR NS+C  +RACIN +C+DPC +++ C     C V  H  +CTCPPGY G+    C KV   C  DS+CP+Q AC    C NPC   +PCGVN  C VLDT+P+RTM C CLPGY G+A ++CT    C A  G I +E   CVC PG  L++  IC PCR + G II+N G C+C   +G ++D  G +CVCP  H   ++  G C+     C  +  C   +YCE   +TC DPC K  CG  A  +  +H+  C CI GY+GD    C      +    D   P +V NCLSDGV V + + D  + GL+YVKGHS++  CR  +   +  ++ +   + FG+C L    +G A F+LVI  H KL+TYK+QAY   CIY TGEQN++ GFNVS+LTTAGTIANTGPPPTC+M+I   NG +IS AEIGD LML+VEV P  IYGGFARNC+A+T+ E N+E  Y VTD+NGCATDP+IF +WE N D   L A F+AFKFP+S+ I+F+CNIRVCFG+CQP NC G NAFGRRRR  + +   T+      Y GQLREEI I+SN I  +ER+ +R   +          E++CVS +GF+I+LVIT LLALVAVAIAVSCWLMAYRR P++ GPLPHPPEFPNPLFTT E +AEP+PDY
Sbjct: 2031 CNVDQICINSK----CRCSHGFVPGPEGCVDVDECE----KQPCHPTAECTNLRGTFRCSCPQGRIGDPVVTGCAIPHHCSSNSDCHDSQACIQRNCSDPCSFVSCGSNTVCSVFDHAASCQCLTGYIGD-ATGCFKVE---------------CLSNTDC------SSDKY---CNQETNKCTSP--CNQVNCGYGN-CVAIDHVAVCKCYPGFTLVDEI-CADVDECASKP---CHPTAICHNTEGAFTCKCPHHLVGDPLTLGC---KQPGECFSDLDCPSSASCLEN--------------MCKNPCDDPTV---CGQNAECISEDHIPFCRCPEQTTGNPKIRCDHLECNYHSDCDPNSACFTNKCVDPCSVSNVCGNGADCSPSNHSAVCVCQPGKTGDP---NLGCTPVQYCQTDTQCPTGLACKGGICTALCTNTRDCFGEQLCINGLCQPTCRSNASCPDFQYCRNNVCVQEFRCVHDSDCEQEEKCVRNDVGQAECKRACDLIFCGRNAECRAEVHQAVCFCREGFHGDANDEKIGCQSIECETDDHCSQEKICTDR-----------RCEIACLTRNPCGVNAVCSASNHVQTCTCQSGYTGNPY-QGCELVDLCLNGPCAPGATCDNSRGSFRCNCQPGTVGDPYNG-GCQQPVECVQDDDCP-----LSATCV--------PLDDTLKCADICARLQCGPNAECVVDAHVGSCRCHRDYDGNPNDLRIGCQPKPIGCSTSS-DCSPNMYCYEQICR----PTCQLDEECNLSD------ICFNGQCLNPCDVKN-------------ACGLNADCQVRNHVKQCSCPPGFTGNSTIECVRFPVACRDDNDCSATDACRENVCLPL---CNIDNDCALNEKCIQGSCLLTCRLVNDCFLGHVCLRNICTAGCRGDQDCD-------------ANEACVGNKCINPCELMPCGPNARCTVLNQRATCSCPAGFMPNPSPKIACLRSPGTQCHENRDCE-----IGTRCLEGSCTPVCSSHANCLSNERCDVNGVCKSLCKKDEDCRSGEICEGLVCSKGCRSDGECQNDYSCLNNLCTDECALPNACGINAKCKMANHGRQCYCPQPLVGDPNVGCKQPFHPCSLNDDCLP-GQTCYDRRCSDACRSDANCLNDERCDGGLCKPICNSDDHCAANQICR-NRL---CTEGCRNDNACSAEESCIQNACKNPCLDSKVCGECAECRVINHAIQCSCPVNYYGNALISC--SKSLIPCDGSCECNEIGFCVKSCGSQSDCSCGEVCYNGMCQMKCDNHNACHKGYICQEGLCL-----VGCRINSDCPSS----LTCINGRCTDPCLNGNSPCGVDALCRVSNHRVVCFCPEGFQGEPSVKCYQ-----LECQQDNDCESNKRCGEDG-----ICTNPCLKHDACGLNAQCRVVDRNALCSCPPGHFGN---PKISCRRGGDECLRRPCGPNAKCRDNSVGGVECICEPGCYGDPYRGCVCERGDPCNEVQCGINAECRIYDNQPQCFCPPHLPSGDPAYACTSAGSSKTD----------------------CRTSGCGKGAECIREGTVFVCRCPPGANGSPNVE----CFTESECGEDAECPSEKACL---GGQCLDPCALRGACGANALCRVVAHKARCACPQ-CHVGVPRV-ACRPDPKCERPSSGAPAPAPPSGPPAASRGCASHADCPGGLACHAATGECRDPCLPTGGRPRACGPDKRCQVRNHEPTCVCRGGFVVNELGELACAPDTLACTQDAECPSNAACIAARCQNPCNARGKPACPDDKTCNVLDHRPICTCTRDCTPSLSICLRDTGCPPDLTCRNYRCVDPCAESTCPADAPCYVEEHKPICKFCPVGF--VPDSQYGCLK-----EVDIKVESPCHPSPCGPNSVCQVKMGRPVCSCQSNFVGSPPDCRSECLLSEECRSDQACVFQRCTNPCPSSCGPNSDC---TVVDHSPYCSCEVGFEGDAFVGCTRIIVEPPEVHDPCVPSPCGSNALCNVKDQGPVCTCIPPYVGNPHDGCKP--ECRISAECPSNLACIN------QHCLDPCLGVCGTEARCEVSNHVPVCTCLAGYTGNPFQACKLEISPLPPQNPCTPPPCGPYSTCRVMDNRAVCSCMPGYQGTPPSCRPECVVSSECPLHLACIGQKCADPCQSGCGLNAHCQVSNHNPICSCPSGYAGDPFQQCIKEEIRPPTNPCLPSPCGPNADCRVHANRPTCTCVAGMFGAP--PNCRP--ECVIQEDCPSYLACIRNKCSDPCIGSCGLNAKCTCQNHRPMCYCYEGYEGDPFSGCNPKVQVSVTPPNQPCNPSPCGSNAICTERNGVGSCTCLSDYTGNAYEVCRPECVQNSDCLQNRACINNKCKNPC--IGACGLNAECQVFNHRPSCSCATDHTGNPLVSCYATQPTETKVPTEPCLPSPCGAYSNCRVIDDHAVCSCQPGYIGSPPSCRPECVVSADCDQNKACIDQKCEDPCT--NTCGQNANCHVINHNPVCSCNPGFTGDPLIICAK--ESVVTPSPIPSGNPCLPS----------PCGPNSQCREIDGFPACS----CLPGYLGRAPNCRPECVINEECLGNFACLNEKCIDPCPGS-CGVNTYCNVVRHRPLCTCNAGYTGNPFTECIPIVQEPTTTESPRTPCDPSPCGANAVCSDRNGVGSCVCIPEYFGDPYTGCRPECVTNTDCNRNRACLNNKCVDPC--PGACGRQATCFVTNHTPSCTCMPGFSGDPS---QECV----RMEVTTPQVT-----SDPCEPSTCGPNSNCIASKGYAVCSCKTGFIGSP-PSCRPE---CTTSTECPQNKACIDNTCADPCP--GSCGQNTKCHVVNHNPVCSCAPGYTGEPFVHCAKIEMPLTGDKTLEGGVNPCVPNPCGPNSQCKVVGSQPACSCTPEYFGRPPFCKPECKDNSECPPLTACINERCKNPCQ---GACGQYARCAVQNHAPVCTCFDGHTGEPSLGCTPIPVTEPEPTNPCEPNPCGPNAQCRERNGAGSCTCPLNYLGDPHDPVRGCYPECEADRDCPSHLACVEFKCLDPCTSTCGLNALCQVANHNPVCSCPPNYTGDPYSVCIVEELKVYPKADPCLPSTCGPNSKCKSVNDQAVCTCIPGFIGLPPN--CRPECTANSDCPVHLACVNSKCADPCV--NTCGLRAQCTTRGHNPICTCPSGFTGDPFNLCSPHVTEVIPVVEQVPSCTPSPCGPNSQCQIISGTPACSCLPNYIGAPPECRPECVLSSECESHLACVNQRCQDPC--VGSCGINARCHVSNRIPVCTCMESFTGDP------FFQCTVIP-ISTQPTVRDPCNPSPCGPNTVCRDGDC-------------ECLPE------------YFGSPFEGCRPE----CVLSNECPRDKTCVRNRCKDPCVDV-CGENTRCDVVNHIPVCSCVPGFIGDPFVKCREQPKEVTEYEDPCSPSPCGPNSNCRANDRHAICSCLQGYLGVP--PFCKPECVVSSECSPTRAC--------------------INKKCVDPC-----PGSCGLNARCEVINHSPICSCLPNQTGDPFRSCYDNPVVVVEPEDPCSSKPCGPNAHCR-NVNGVPSCTCLPSYIGSPPS-CRTECIINPDCSTNKACVNSKCIDPCPGSCGNDADCKVINHAVICTCPAGYTGNPFVQCIVRKEEVNPCEPSPCGPNAVCEKQGSAGACRCVEFYHGDPYEGCQPECIINPDCPANKACLGNKCEDPCPGVCGTLAQCTVVNHIPVCTCVPGYVGNPFTLCRPEEQPVTESTRVEPCTPSPCGPNSICQVANSQAVCICQDNYIGAPPNCRPECVVNSECPQNRACHKYHCNDPCPGTCGVDALCYVVNHNPLCTCPSGMTGDPFSRCYVQPAIPPAAMRNPCAQNPCGLYAECRSVGDQAVCSCLKNYIGSPPNCRPECSVNTDCLPSQACISEKCRDPCIGSCGQNTNCRVQNHIPTCICQPGYTGDPFNECSPIIEVPPVPADPCNPFPCGPNAVCD-----NGVCTCRGNYFGDPYTFCRPECTMNSDCDRTKSCINQRCIDPCNGICGVDSRCDVVNHVPMCSCPPGTTGNPFTFCRIYQPPTVPAEPCTPSPCGPNSICRV-VDDYAACTCQDGYIGNPPSCRPECIVTAECPLTQACLSNKCEDPCPGTCGQNAKCQ----------------------------------------VVNHNPICSCEEKDTGNPFERCYPMALEGPKLPRNPCAPSPCGLNAECQIRGDSAACSCLPNYVGVP-PNCQPECTINPQCPPQLACIQQKCRNPCD--GLCVLNARCSVIN-HHAVCTCLEDFTGDPFNSCQP-----VIKELPAPPKPCDPSPCGANAYCRESFNGVTCECTPGYRGNPYDGCRPECLVNSDCPASRVCTRMKCEDPCI-DTCGLGAICTVSNHVPICSCPAKTTGYAFTSCEPI---AIDVGIVDPCNPSPCGSNTICEKSGSTATCRCLPGLTGDASSAAGCRPECVLASDCPGDKTCADSRCIDPCSRDVCGRAATCRAVNHSPLCSCPPPLFGNPFVEC---YEKEEIDPCNPSPCRSNGECQVRNGVASCI---------------YPECVVNSDCSRDKSCFS-RKCRDPCIGACGVNSLCQTVNHKAVCSCPSGYEGDPRIQCRIQDLPVAPKPECYQHVDCPMEMVCVERRCVDACSLNSCGINSRCHVQLHRAICICNPGFTGNPQTGCSEIGCKSDSMCPPTQACVNKECIDICLVMQCGLHAQCQADGFHRASCRCPEGSFGNPYEECRRPE-------CSVNQDCPSFLACQAGKCVDPCN---CPPSAQCYVDDHRPTCKCTAGFVGDPYVSCTIEPVKNRPECQNDGDCPNKLACFDGTCENPCEHSVPCGTNTKCTAVGTLPTRTMICECLPNFIGDANVACRPLEKVIEPECTADSECSHDEACLNRKCTNPCTLRLCANSAECRMRDHRYTCSCPPGMIGDPYVSCYREVSITPECESNSDCAPTLACVNQVCQNPCLDRNCGSNAECSTIDHHPTCNCQQGFAGNPQVQCFRP---------SCRTNDDCPYDKNCRNGNCVTPCLGDDVTCGRGAKC----TVIAHEAQCSCPPGTQGN------PQIACISAACQYNEDCDDHEACDRLNRICRPVCEDDTCATSATCIPRDHQPKCICGPGTTGNPHVECTRLTPQPGVSIVPECSQDRECALGLICLNGNCKDPC-ITSNMCSGDQECRVLDTVPLRITICQCPKDTITDVNGRCNRTVSSDECRSDQECRDHENCLNGGCKEACLDTNCGINAQCRSKSHTGICTCSPGYTGNPYVECSKVPPDSGSSVFVDCYSNDDCSSDRRCTNSRCISPCLVDNP--CGRNSLCHVSDHRPICKCPISYAIDRNGNCV--PPSIIAECRSNSDCPSTDSCIN-GLCTSPCN----CGDNAKCVVLNHYPS----CSC----LPGHSGNPQLGCTKLECESDTDCGSQETCYNNRCINPCSLENVCAINAECYGQNHRSACRCLPGYNGNPRAVCERVECSSNYECVSNLACQNGRCVDPCIENFPCAQNAICAVRSHEPFCRCPEHLHAGDPYSYCQRPAVIVDQPECKLDVECPSKLACFDGVCKDPCAEIRPCLANARCSVLDTAPVRTMVCTCIQGWLTDLDGTCKPIP--LAPVGG-CTADDECSDQEACIARLCRTPCS----CGSNAECYVQNHKP----VCSCRPGYQGNPYTAC------TSVECRTHVDCPWDRSCLNENCVNPCLLSNPCGLNAECFARGHVADCSCRHGYHGDAFERCDVIRCYTNADCPANRACV-NAQCVDSCVQENPCSSRAECHVREHLPICRCPAGYAGNPYVDCSLEERPECTADDDCPSVLACFSGKCENPCTVIHPCTEPSECRVLPTSPTRTMICDCPSGYVSSGSGTCQAIKSIVTIECTRDSNCASDKACVNALCRDPCGCGSNAVCNVVEHKPICSCLSGYEGNPNIECVKATGCRSDRECSGTDVCVQRSCIQACTSSLVTCAREAECRAINHRAICRCPAGYEGNPRVSCILAECRSNSDCPTNRACINSRCEDPC-LANPCQPETICSVNAHVFECTCPPGYAGSAKTGCTKVAEKCKIDSECPAQFACFDGECINPCKKIQPCGVNTSCKVLDTVPVRTMICKCLPGYFGNAIVRCTKAPICEADRGQIRDENGNCVCAPGSALNANEICVPCRTNSGMIIDNKGYCVCALERGMIIDEYG-RCVCPTEHGYVLDAFGYCKLVGLTCLSNDECVDSQYCEKTTKTCEDPCRKQICGGNAVCSATNHQAICSCIHGYSGDAYFYCN---NKRDWRTDFPTPGLVANCLSDGVQVEINLLDEGFDGLLYVKGHSKEEQCRRIILIPETMRKYVVIKIAFGSCGLIL-INGEASFVLVIQKHPKLVTYKAQAYHFTCIYQTGEQNVTLGFNVSMLTTAGTIANTGPPPTCLMKIVAQNGNEISSAEIGDNLMLQVEVQPSSIYGGFARNCVAKTM-EDNQENEYLVTDENGCATDPTIFGEWELNPDSQSLMASFNAFKFPSSDNIRFQCNIRVCFGRCQPVNCRGYNAFGRRRRSIDSDANETLSSATEEYEGQLREEITIQSNLIFTVERREERYTADPAEVPAAQRVEDICVSMVGFVISLVITTLLALVAVAIAVSCWLMAYRRLPKSTGPLPHPPEFPNPLFTT-ESVAEPSPDY 8382          
BLAST of GH13743 vs. nr
Match: gi|1317991438|ref|XP_023288882.1| (uncharacterized protein LOC105696885 isoform X1 [Orussus abietinus])

HSP 1 Score: 2808.48 bits (7279), Expect = 0.000e+0
Identity = 2242/6743 (33.25%), Postives = 2998/6743 (44.46%), Query Frame = 0
Query:    1 MVVFLPISSGQLVGRQPNDLSIDKGVFFLNVEDGFFGCQVNASVDVLQLFEISKLCDGVPDCYRGSDEANSQIKCTKDCLYTTGRHCQHGACLDSQCYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTN-PCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGR--FACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVC-FNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPN-GRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLS-GCRGEST-------FECTQDSQCDQGESCLSSRCVCRRGYERNP-AGDCVDLNECLL---GNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCS---NCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQ-GKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVE--CGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYG-NPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDD------------------------DLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEK-----CSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMV-SDGMPICLCNSGFEKNKLTGSCD--VYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSN-GQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQ-IEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKND--RGDLC-PFGQCQTTCASSS--QCPPGQICKSGICAAGCSSNTHCEEGR------VCITGKCQDPCTETCGPNALCS-PEFENLCQCPEGFAGVPTAA---QGCVRIPPTCT----------------------TDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCG---AGGQCSCQPGYE----------MTQSGCSDLNECKNNI----------------CGAGKTCANTPGSYICSCPTNQVPDE-------SGACRSPDQCSSDQDC-NDALACLADSLSGAKKC--LDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEY--------------------PCEGFTCGHGS-CHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCTNEQGS---------------------YQCTCHDGM---------VGDPYTQGCKPKA------------------------------QCYSNSECSSDTRCQNGRCVDPCDG--FCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPR-------------------------------------------------ECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSR-----SECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPST-CILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDN--------DCFLGHVCLDKMCKVG--------------------------------CSAPKDCPNSQSCI----NHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPV-VACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKIC------KEVCRSDSQCQSKEICQGISCSQG---------------CRSDPDCTADKACH----------------NNQCIGRSSKRKVTNRTGSIIAHL---------------------------ADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVP---CSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCN-EGLCVQICNSNTQCQAGLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCRNPC-NGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKT------------------ECTTNGQCSRDKSCEGGRCINLCSESNS-------------------------------------------CGKNAECRMNNHRAQCVCPSGFYGNALQEC----------------------------------------VVDRN---------------------DCLLPNQCGENAQCL-NQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECP-------------------------------ECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATH-KCEDNERCIAQRHKPKCTCK-----------------ERLLINSAGELICPQQDVQ---CLYEDQCPSTLSC--IDGACQNPCQGT-----SCPDGKSCQVLNHQALCICTKD------------PCSISPCGDEAICRAVEG--NAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSL---GCVEPAD---------DPCTPSPCGAFANCLVVLNQLKC-VCPPGLFGDPFIQC-QPVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIR--------------------PL----------------PQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGD------------------------PYYQCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPN-------PPEPLETDPCSACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAEC-------------------------------SEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPY---NEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVEC----HKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAP-PDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPCE--TCGQHAICHIHNNIAACKCEDNYIDKPPNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQP----------IDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRCIPAGCRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYE---GCTQYECKRHEECPSTLACRDFKCVDPC--DCAVGANCRVSNHKTTCTCPPGFTGDPYS-----------RDDP----------------------------PRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGF-------------------------------------LFIGDFECK--------APE-RPECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPY--------------------------TVCQKAGCQ------------------SNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQY----------------------------------------------ECLVDSDCPYTLACPNRECIDPC--QCAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFL--------RPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSCLEIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQVECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPCNCGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCS----------------------------------------TF---ECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPC--DCGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPC--ACGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASI------QCTPVKTCP---------------------AGSGLILNEFEECVCPPGFVLDSQGIC-----------APCRFDVGFIIENGRCICDYTKGFVLDLSGKKCVCPENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPP 5754
            ++    +SS  +  R     ++   VFFLN+EDG+FGCQ+NAS D+LQL E+SKLCDG  DCY G+DE   ++KCT DC       CQ+G CLDS C+CNDG+GG  C +PD NECKYRPCD+F +CTNTLG F CSC  GY+GDGFHCKDIDEC+ P +A  CV+NAECCNLPA+++CKCK G+ G+G+  C DIDECLT   CG N LC N  GN++CEC  G+ G+PH  CVD++EC +   CG  A C N+ G Y+C CP G  G+P +               C    C ++ALC     G  C C EG  GDP   C DI+EC S +   CGV AIC N  PGY+C CP GY+ + +   +C    V T C S+FDC NNA+C     C C+ GF+  G  C+DI+EC +  NPCG  S+C N  G ++C C    +G PP  PC+ PC EV CG  A C+    EA+CICEEGW +NP +I++GC+DIDECD    P+G+CG NAIC+N+PG F+C C  G++G+    C D+DECA NR  CG  A CTN  G+YSC C      +P          +C +D +C GNA+C     C C +P +G +C   C D TC PN++C++ N    C C  G+   P  G  C DIDEC  NPC   A+C+N  GSF C+CP G +GDP + GCR             C    QC + E   SS C+C+RGY RN  +G C D+NEC+       CG+N++CKNLPGSY+C+CP GF GNP++ C+ C+   C C PPY+ +EG+C LA CS    C   A+C+ I GG+SYCACP+G+        CEDI+EC    H  CG GA+C+N PGS+ C CP G  GDP+ G C P +  C S+++C+ NE+C+Q G+C+C PPF++D  DGN CK+PC+RF CG NA+CTPS+PP+C+C+AG+ G+P  GC D++EC  NPC  G+ C+N    + CEC    +GDPY  GC+G    +  C ++++C   LACI   C NPC +V CG NA C  + H AWCRC  GF E     CVS C+  +CG  A CIVS  GPTC+C EG +GNP+PGG C+   CS   PC+E    C  GRC  +C    CGV A CDP    C C   F+G+P L+CMPP Q   C   CG N+HC YG +   C CN G  GNPY GC       DC S  CG +A C       EC C  G+ G PY +C D++EC  + CG +A CINT GGYDCRC   +VGNPF  C   +A    D                        D C++  CGP + C  G C+C  G+ G DPND   GC     C  +  C   +IC  +   G R C D C + QCGPN+ C+T +H  SCIC DG+ G+ +D   GCQ +       CS NEDC  G  C    +G   C+D C   +C  +++C   + G  +C+C  G+E N  + SC+      C  D +C     C   + G+  CV  C +  CP  + CV+  H+  C CLPG+ GNP+DR+GC    ++ CSS++EC E   C+ ++ G  +C+P C ++ CG  A+CVV NH   C CP GL+VG+P   +GC+ V CV N DCP  + C+RL++TC D C +  CG+NA+C    H+  C+CPP F P+P P+V C   D    D C P   C    +++   +CP   +       AGC    +C +        VC    C + C   CGPN +C     E +C+C   F  VP+      GC+R    CT                      TDC  S +C N  C+  CTSHG C   E C NG+C+  C  +KNC   + C+   C+  C  D+ C    VC        C+C  G++            Q+GC   +EC +                  C  G+ C +     +C   +N +P E          C S   C+ DQ C N    C    + G + C  +D C+   C P A C  ++    CSCP    GDP     GC    +                    PC   +CG  + C   DHA  C C  GY    + C  + EC S   C +   C  E                          C C+ G          V +  ++ C P A                              +C+S+ +C S   C    C +PCD    CG  A+C+ ++H P C C  +  GNPKI+C+ LEC  ++DCD + +C  NKCVD C +S +CG  + C  SNH  VC C  G TGDP                                                   C  N  CP    C N VCV+  E  C+ D +C  ++ C R     +ECK  C     CG NA C ++ HQ VC C  GF G++  E +   S  C  D +C     C    C   C + N C +N  C     + TC   +         C L  +CL+  C  G                                C    DCP S +C+      +C D C   QCGPNA C V      C C R +  NP+ + + C  +PI C  +  C  N  C    C+P C  D +C  +++C    C      K  C  ++ CQ +   +  SC  G               CR D DC+A  AC                 N +CI  S            + H+                            +PC +  CG NA C   N +A CSCP G   NP         P   C    DC     C +G+C   C    +CL NE C+  G+C  +C  +  C++G +C    C  GC S+ +C ++  C+   C D C    + CG  A C   NH  QC CP+   GDP   C+  +  C S  + C  G  C+   C+ +C + A C   E C  G C   C     C     C   +C  GC ++  C   E C    C+NPC +   C   + C+V      C C   Y   A   C+K+                   C +   CS  + C  G C   C   N+                                           CG +A CR++NHR  C CP GF G    +C                                        VVDRN                     D  L   CG NA+C  N +GG +C+C  GC GDP++GC C         +G   +PCN    CG  A C++ ++Q  C CP                               EC       +C+   G    P VE   T  ECG  AEC   + C+ G C+DPCA    C  N  C    HK +C C                  ER    +               C     CP  L+C    G C++PC  T     +C   K CQV NH+  C+C               P +++ C  +A C +      A C+ P   RG P             AC  +  C  L  +P+C C     P   + L   GC  P D         DPC  S C A A C V  ++  C  CP G   D    C + V+   +  C PSPCG  + C +    + +CSC   + G+P   C  EC   ++C SDQ+C   +C +PCP  CG  + C V  H P C C  G++GD +  C    V  P +                     P+                P+C+ + +CPS   C + +C+DPC   CG  A C V NH   C C  G+ G+                        PY  C V  NR VCSC PGY G PP+CRPECV+  +CP    C+  +C DPC + CG  A CQV  H P+CSCP G  G+P+++C      PP  PC PSPCG NA C++   +  C C+ G  G PP CRPEC+   +CPS+  C + KC DPC   CG+NA C  +NH+ +C C    +GDPF  C+P        P +P    P   CG NA C  R N    C+C  DY G+ Y  CRPEC+ N+DC  ++AC+ NKC +PCIG CG+NAEC                                 P +PC P+PCG  S C   ++  A+C CQ  YIGSPP+CRPEC   + C  +  C+ +KC DPC   CG+NA C                                        HV+ HNP+C+C  GF GDP     +  +  P  I +   PC P+PCG N++C E +   +C C+  Y+G    +CRPECV+N +C    ACL+ KC DPC    +CG+N  CNV   H   C+C   Y G+P  EC     +P     TE    PC    CG  +   +RNG+ +C C+P Y G P   C+P CV N+DC  + AC+NN CVDPC    CG    C+V +H   C C PG+ G+P   C +    T      DPCE  TCG ++ C      A C C+  +I  PP+CR EC    +CP++ ACI   CA PC   CG+N  C V+NH+P+C C P Y G+P V C   K+  P          ++PC+PNPCG N++ +  GS   C+C P ++G P   C  EC  + +CP   AC  N RC NPC G CG  A C V  H  +C+C +   G+P + C P         P TE     E  +PC    CG NA+C  R+   +C C   + G+P++   GC   EC+   +CPS LAC +FKC+DPC   C + A C+V+NH   C+CPP +TGDPYS           + DP                              PP     C  N +CP   AC+NS+C DPC+ N C   A CT   H   C CP+GF                                     +  G   C          PE RPECV   EC  HLAC+++RC DPC   +CG+NA+C V+  +PVC C   + GDP+                          TVC+   C+                   ++ECP  + C+  +C+DPC  + CG N  C    H+P+CSC+ G+ G+P+ +CR+                                               EC+V S+C  T AC N++C+DPC   C  NA C V NH   C+CLP   G+ +                          ++C+D    NP + +        +PCG ++ C+  + VP    +C C   Y        I         C  + DC  ++ C N+ CI+PC     C + A C V +H   C CPAG TG+P+V C+            +  E        NPC     PCG  A C+       C C   + G+P   C Q ECI + DCP +KAC+ NKC DPC    CG  A C    HI  C C PG  GNP   C              E+  +   T    C    C   +IC+  N +  C CQ   +G         P      C ++ +CP   AC  +  C +PC     C  D  C V++ +P    +C CP GM       C   P++      + C  +             CG  A C  +    +C C   Y G+P     + EC  + DC   Q C    C DPC+    CG N  C  ++H  TC C PGY GDPF +CS                                        TF   EC  N +C  TK C+  +C+DPC  N  CG +++C V  H+  C CPPGT G+P   C    P   P E                      PC T  PC  +++C VVD        C C+ G++ +        P      C+   ECP   AC++  C+DPC   CG+ A+C +  H P+C C E   GNP   C P+  +     ++P  CAP           SPCG NAEC   G  A C    + V   P                N Q          CT + +C    ACI   C++PC   C  NA C++ NH  VCTC + F GDP   C+ V              I     P    D  PCG +A C+   +   C C PG  GNPY  C   EC  NS+C   R C   +C+DPC   D C   A C V NH   C+CP    G    SC+ + +  VG  D              PC    PCG N  C    +    T TC CLPG  GDAS       +C     CP                     A +   +N    C CPP    +    C           +PCR +    + NG   C Y                              PEC V+ +C+  + C  F+R C DPC+   CG  +     +H+  C C  GY GDP   C    +P  P
Sbjct:   21 ILALWMLSSHLVESRDGFGHAMRGQVFFLNLEDGYFGCQMNASTDILQLLELSKLCDGHADCYEGTDERPKELKCTSDCKKGADDECQNGVCLDSVCHCNDGFGGCNCHVPDENECKYRPCDIFAHCTNTLGGFQCSCFPGYQGDGFHCKDIDECEDPAIAALCVENAECCNLPANFLCKCKQGYTGNGEEYCEDIDECLTPNACGDNALCRNIPGNYTCECPAGYTGDPHVTCVDLNECESKGACGRRANCINIPGAYKCICPDGYDGNPEEECSDV--------DECLGNPCHRSALCTNVEGGYRCLCPEGTDGDPLSGCHDIDECASYN-NPCGVNAICKNSVPGYKCVCPQGYSANPKPDVSCIQTNVTTRCKSNFDCVNNAECKEE-QCFCKSGFEGVGAECKDINECIT--NPCGPASVCGNTKGGFQCDCETGFIGAPPHVPCKAPCDEVVCGAHAFCKADGQEAYCICEEGWTFNPNDIAAGCIDIDECDVVNGPSGRCGQNAICTNTPGGFSCQCKAGYSGNALKQCIDVDECA-NRDACGHGATCTNTEGAYSCSCPKDTIPNPDPYIKCVGVVTCGTDDDCPGNAICDSQKRCLCPDPNIGNDCRHPCEDVTCGPNARCMLINDEATCLCSSGYTGKPRIGEGCRDIDECGANPCPPGAVCKNEPGSFSCECPGGMSGDPYTGGCRKSELPHVCGPHLPCPTGEQCVKDEFIGSSVCICQRGYTRNAESGKCRDINECIELTDKQACGLNAICKNLPGSYECQCPPGFNGNPYSLCEECNSIECQCQPPYRIVEGKCILAGCSKGEKCPGGAECITIAGGVSYCACPKGFSTR-SDGLCEDINECTD-SHQVCGYGAECVNLPGSYQCVCPHGYDGDPYNGLCSPAQKRCISDNECKPNEKCVQPGECVCPPPFYMDVFDGNSCKNPCNRFPCGINAKCTPSDPPKCMCEAGYEGDPQHGCIDVNECINNPCAPGAHCVNTKGGHSCECGKDLSGDPYGAGCTGVPVAKQGCTSNNDCENYLACINGNCQNPCDTVSCGPNAFCEPDKHTAWCRCVVGFNEGQNNECVSPCDGFVCGIGAHCIVSYDGPTCKCIEGFMGNPFPGGRCTPDVCSPDVPCVEP-SICVSGRCKRRCEDVICGVGASCDPVSGKCVCNPYFVGNPDLLCMPPVQPPLCDPACGNNAHCEYGLDKAKCVCNPGTSGNPYHGCGAQEK-SDCSSALCGKDAQCIAGPNAVECLCPSGFAGNPYIQCYDINECNGNACGAHAVCINTNGGYDCRCMEGYVGNPFRMCQESQANPCSDPTTCQCGPEKLCPRDYSCIEGRCVDRCSDVTCGPKSGCQDGICICPPGYSG-DPNDQENGCRLTGHCSNDQHCDAQQICFQVG-KGVRKCVDGCSKLQCGPNALCLTQHHVSSCICIDGYLGNPSDLVEGCQPKRSGAVPTCSRNEDCRQGFLCLQQDDGIHECVDACSKTTCGAHQRCEADAGGHVVCVCQDGYEWNPESFSCEKPAVPDCTGDQECKSDSVCRPDAVGVLKCVSICGMFTCPENSRCVASEHKARCECLPGFEGNPNDRTGCQTARRDACSSDSECPEDSTCRSTDEGVLACRPVCDFVRCGPNALCVVNNHAAICECPPGLYVGDPDGGDGCKTVPCVYNIDCPPTQLCNRLTHTCYDACDDSACGQNAVCVADDHRAVCRCPPGFKPNPLPDVECIGVDVCNSDSCHPSAICVADASNTPICKCPENHVGDPYF--AGCQPEGYCADQHDCPLHSVCKNHGCVNICDNVCGPNMVCEIANDEPVCKCNYKF--VPSTKGLHHGCIRYTSYCTIDADCEGTVCLEGQCRAVCRSDTDCSHSEICQNKKCVVSCTSHGNCEADEACINGICILGCRGNKNCPLNQSCIQSKCQDPCARDNVCGPNAVCNCVDHIATCACPLGFQGNPTPDQGCVRIQNGCRTSSECPSQHVCSNGFCQCQCSQQVDCAQGERCKSGLCVKVCYGESNCLPGELCINGSCEAGCTSDAGCNVDQICINSKCRCSHGFVPGPEGCVDVDECEKQPCHPTAECTNLRGTFRCSCPQGRIGDPV--VTGCAIPHHCSSNSDCHDSQACIQRNCSDPCSFVSCGSNTVCSVFDHAASCQCLTGYIGDATGCFKV-ECLSNTDCSSDKYCNQETNKCTSPCNQVNCGYGNCVAIDHVAVCKCYPGFTLVDEICADVDECASKPCHPTAICHNTEGAFTCKCPHHLVGDPLTLGCKQPGECFSDLDCPSSASCLENMCKNPCDDPTVCGQNAECISEDHIPFCRCPEQTTGNPKIRCDHLECNYHSDCDPNSACFTNKCVDPCSVSNVCGNGADCSPSNHSAVCVCQPGKTGDPNLGCTPVQYCQTDTQCPTGLACKGGICTALCTNTRDCFGEQLCINGLCQPTCRSNASCPDFQYCRNNVCVQ--EFRCVHDSDCEQEEKCVRNDVGQAECKRACDL-IFCGRNAECRAEVHQAVCFCREGFHGDANDEKIGCQSIECETDDHCSQEKICTDRRCEIACLTRNPCGVNAVCSASNHVQTCTCQSGYTGNPYQGCELVDLCLNGPCAPGATCDNSRGSFRCNCQPGTVGDPYNGGCQQPVECVQDDDCPLSATCVPLDDTLKCADICARLQCGPNAECVVDAHVGSCRCHRDYDGNPNDLRIGCQPKPIGCSTSSDCSPNMYCYEQICRPTCQLDEECNLSDICFNGQCLNPCDVKNACGLNADCQVRNHVKQCSCPPGFTGNSTIECVRFPVACRDDNDCSATDACRENVCLPLCNIDNDCALNEKCIQGSCLLTCRLVNDCFLGHVCLRNICTAGCRGDQDCDANEACVGNKCINPCELMPCGPNARCTVLNQRATCSCPAGFMPNPSPKIACLRSPGTQCHENRDCEIGTRCLEGSCTPVCSSHANCLSNERCDVNGVCKSLCKKDEDCRSGEICEGLVCSKGCRSDGECQNDYSCLNNLCTDECA-LPNACGINAKCKMANHGRQCYCPQPLVGDPNVGCKQPFHPC-SLNDDCLPGQTCYDRRCSDACRSDANCLNDERCDGGLCKPICNSDDHCAANQICRNRLCTEGCRNDNACSAEESCIQNACKNPCLDSKVCGECAECRVINHAIQCSCPVNYYGNALISCSKSLIPCDGSCECNEIGFCVKSCGSQSDCSCGEVCYNGMCQMKCDNHNACHKGYICQEGLCLVGCRINSDCPSSLTCINGRCTDPCLNGNSPCGVDALCRVSNHRVVCFCPEGFQGEPSVKCYQLECQQDNDCESNKRCGEDGICTNPCLKHDACGLNAQCRVVDRNALCSCPPGHFGNPKISCRRGGDECLRRPCGPNAKCRDNSVGGVECICEPGCYGDPYRGCVC--------ERG---DPCN-EVQCGINAECRIYDNQPQCFCPPHLPSGDPAYACTSAGSSKTDCRTSGCGKGAECIREGTVFVCRCPPGANGSPNVEC-FTESECGEDAECPSEKACLGGQCLDPCALRGACGANALCRVVAHKARCACPQCHVGVPRVACRPDPKCERPSSGAPAPAPPSGPPAASRGCASHADCPGGLACHAATGECRDPCLPTGGRPRACGPDKRCQVRNHEPTCVCRGGFVVNELGELACAPDTLA-CTQDAECPSNAACIAARCQNPCNARGKP-------------ACPDDKTCNVLDHRPICTCTRDCTPSLSICLRDTGC--PPDLTCRNYRCVDPCAESTCPADAPCYVEEHKPICKFCPVGFVPDSQYGCLKEVDIKVESPCHPSPCGPNSVCQVK-MGRPVCSCQSNFVGSP-PDCRSECLLSEECRSDQACVFQRCTNPCPSSCGPNSDCTVVDHSPYCSCEVGFEGDAFVGCTRIIVEPPEVHDPCVPSPCGSNALCNVKDQGPVCTCIPPYVGNPHDGCKPECRISAECPSNLACINQHCLDPCLGVCGTEARCEVSNHVPVCTCLAGYTGNPFQACKLEISPLPPQNPCTPPPCGPYSTCRVMDNRAVCSCMPGYQGTPPSCRPECVVSSECPLHLACIGQKCADPCQSGCGLNAHCQVSNHNPICSCPSGYAGDPFQQCIKEEIRPPTNPCLPSPCGPNADCRVHANRPTCTCVAGMFGAPPNCRPECVIQEDCPSYLACIRNKCSDPCIGSCGLNAKCTCQNHRPMCYCYEGYEGDPFSGCNPKVQVSVTPPNQPCNPSP---CGSNAICTER-NGVGSCTCLSDYTGNAYEVCRPECVQNSDCLQNRACINNKCKNPCIGACGLNAECQVFNHRPSCSCATDHTGNPLVSCYATQPTETKVPTEPCLPSPCGAYSNCRV-IDDHAVCSCQPGYIGSPPSCRPECVVSADCDQNKACIDQKCEDPCTNTCGQNANC----------------------------------------HVINHNPVCSCNPGFTGDPLIICAKESVVTPSPIPSG-NPCLPSPCGPNSQCREIDGFPACSCLPGYLGR-APNCRPECVINEECLGNFACLNEKCIDPCP--GSCGVNTYCNV-VRHRPLCTCNAGYTGNPFTECIPIVQEP---TTTESPRTPCDPSPCGANAVCSDRNGVGSCVCIPEYFGDPYTGCRPECVTNTDCNRNRACLNNKCVDPC-PGACGRQATCFVTNHTPSCTCMPGFSGDPSQECVRMEVTTPQVTS-DPCEPSTCGPNSNCIASKGYAVCSCKTGFIGSPPSCRPECTTSTECPQNKACIDNTCADPCPGSCGQNTKCHVVNHNPVCSCAPGYTGEPFVHCA--KIEMPLTGDKTLEGGVNPCVPNPCGPNSQCKVVGSQPACSCTPEYFGRP-PFCKPECKDNSECPPLTACI-NERCKNPCQGACGQYARCAVQNHAPVCTCFDGHTGEPSLGCTPI--------PVTEP----EPTNPCEPNPCGPNAQCRERNGAGSCTCPLNYLGDPHDPVRGCYP-ECEADRDCPSHLACVEFKCLDPCTSTCGLNALCQVANHNPVCSCPPNYTGDPYSVCIVEELKVYPKADPCLPSTCGPNSKCKSVNDQAVCTCIPGFIGLPPNCRPECTANSDCPVHLACVNSKCADPCV-NTCGLRAQCTTRGHNPICTCPSGFTGDPFNLCSPHVTEVIPVVEQVPSCTPSPCGPNSQCQIISGTPACSCLPNYIGAPPECRPECVLSSECESHLACVNQRCQDPCVG-SCGINARCHVSNRIPVCTCMESFTGDPFFQCTVIPISTQPTVRDPCNPSPCGPNTVCRDGDCECLPEYFGSPFEGCRPECVLSNECPRDKTCVRNRCKDPC-VDVCGENTRCDVVNHIPVCSCVPGFIGDPFVKCREQPKEVTEYEDPCSPSPCGPNSNCRANDRHAICSCLQGYLGVPPFCKPECVVSSECSPTRACINKKCVDPCPGSCGLNARCEVINHSPICSCLPNQTGDPF--------------------------RSCYD----NPVVVVEPEDPCSSKPCGPNAHCRNVNGVP----SCTCLPSY--------IGSPPSCRTECIINPDCSTNKACVNSKCIDPCPGS--CGNDADCKVINHAVICTCPAGYTGNPFVQCIV-----------RKEEV-------NPCEP--SPCGPNAVCEKQGSAGACRCVEFYHGDPYEGC-QPECIINPDCPANKACLGNKCEDPC-PGVCGTLAQCTVVNHIPVCTCVPGYVGNPFTLCRP------------EEQPVTESTRVEPCTPSPCGPNSICQVANSQAVCICQDNYIG--------APPNCRPECVVNSECPQNRAC-HKYHCNDPC--PGTCGVDALCYVVNHNP----LCTCPSGMTGDPFSRCYVQPAIPPAAMRNPCAQNP------------CGLYAECRSVGDQAVCSCLKNYIGSPPNC--RPECSVNTDCLPSQACISEKCRDPCI--GSCGQNTNCRVQNHIPTCICQPGYTGDPFNECSPIIEVPPVPADPCNPFPCGPNAVCDNGVCTCRGNYFGDPYTFCRPECTMNSDCDRTKSCINQRCIDPC--NGICGVDSRCDVVNHVPMCSCPPGTTGNPFTFCRIYQPPTVPAE----------------------PC-TPSPCGPNSICRVVDDY----AACTCQDGYIGN--------PPSCRPECIVTAECPLTQACLSNKCEDPCPGTCGQNAKCQVVNHNPICSCEEKDTGNPFERCYPMALEGPKLPRNP--CAP-----------SPCGLNAECQIRGDSAACSCLPNYVGVPP----------------NCQ--------PECTINPQCPPQLACIQQKCRNPCDGLCVLNARCSVINHHAVCTCLEDFTGDPFNSCQPV--------------IKELPAPPKPCDPSPCGANAYCRESFNGVTCECTPGYRGNPYDGCRP-ECLVNSDCPASRVCTRMKCEDPCI--DTCGLGAICTVSNHVPICSCPAKTTGYAFTSCEPIAID-VGIVD--------------PC-NPSPCGSNTICEKSGS----TATCRCLPGLTGDASSAAGCRPECVLASDCPGDKTCADSRCIDPCSRDVCGRAATCRAVNHSPLCSCPPPLFGNPFVECYEKEEIDPCNPSPCRSNGECQVRNGVASCIY------------------------------PECVVNSDCSRDKSC--FSRKCRDPCIGA-CGVNSLCQTVNHKAVCSCPSGYEGDPRIQCRIQDLPVAP 6373          

HSP 2 Score: 2282.68 bits (5914), Expect = 0.000e+0
Identity = 2127/6836 (31.11%), Postives = 2906/6836 (42.51%), Query Frame = 0
Query:  121 CDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKV-------------ECRDIDECLTNQ--------VCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDG-RFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPP---------------------EQPCRDPCLEVN-CGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSIS-PTG---KCGV-NAICSNSPGSF---------------------------NCVCAKGFNGDPYIGCFDIDECAEN------------RFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDAT-CFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNP---FTSCQ----SCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNP-RTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPF-----------------------QGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTN-GCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVA-ENHAAWCRCKSGFAEDSQGNCVSLCNQVIC-------------------------------GSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQC----------------------GQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHC-------IYGNPNSCACNIGYFGNPYTGCEVTTSVEDCD-SLKCGDNAVCSFASG-KPECTCKRG-YDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQ----CLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPC-QQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCL------------------DPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCR------------------------KVSCVENEDCPDNEFCDRLSYTCMDPC-----QNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRG----------DLCPFGQCQTTCASSSQ--CPPGQICK----SGICA---------AGCSSNTHCEEGRVCITGKCQDPCTE-TCGPNALCS-PEFENLCQ-CPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCARGE-QCSNGM------CLKLCHTDKNCLQGEICVDKFCE----PGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQ-SGCSDL--------NECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPC-----------------------------------DIS-----------YCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCY-----QVEYPCEGFTCG---------HGSCHPEDHAPKCHCQDGY------QLIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGFCGIGAKCVVKNHSPKCSCLPRWRG------NPKIKCELL------------------------------------------ECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPREC-----EQNLDCPGD-------GKCDNFVCVKPH----------------EKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNP-SPVVACTREPIT------------CQGNKQC------------PENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEG------------------LCVQI---------------------CNSNTQC-----QAGLVCIDRQ------CVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQC-----GSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCI----SGCGSNRDC------------------PYG----EMCEGGQCRNPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQEC---------VVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLN-----PCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICT---------------------KDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQP---VEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRP--------------------------------LPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCI---------------------------VRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPP---KQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPN-PPEPLETDPCSA--CGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAEC-----------------------------SEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEII---DPCANRECGPYSQKVERNGICTCSCLPGYVGAPPD-CQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPC--ETCGQHAICHIHNNIAACKCEDNYI---DKPPNCRRECVLHEDCPKHLACIQYKCASPCINQ-CGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQPIDPCLPNPCGENTE--HRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRC----IPAG----CRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQYECKRHEECPSTLACRDFKCVDPC---DCAVGANCRVSN-HKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFLFIGDFECK---APERPECVSDPECPLHLACISERCLDPCT-SQACGVNAKCTVTTHVP----VCACELDYVGDPYTVCQ------KAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQY-----ECLVDSDCPYTLACPNRECIDPC---QCAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLR-PCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACI-NPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSC--------LEIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASN----HRAVCTCPIEWVGNPMRECHQY----ECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQV----------ECQQDGDCADNEKC-DLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPCN----CGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPG-YQGDPFVKCSTF-------ECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQ----HMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPC----DCGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCR---------------------------------------------------STCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIV-VGCTSDDECGDARACINAICKDPCACGPNAVCTIENHRPVCTCKDGFYGDPEIVC-KEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKTCPAGSGLILNEFEECVCPPGFVLDSQGICAPCRFDVGFIIEN-GRCICDYTKGFVLDLSGKKCVCPENHS--INDNGICEEE-PECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPPPVDIDRPEIVVNCLSDGVGVGLTISDPRYHGLIYVKGHSQDPNCRLRVDEGQNGQR-IDFHVKFGTCDLAYDEDGYAHFILVI-GHAKLMTYKSQAYRIRCIYSTGEQNISHGFNVSILTTAGTIANTGPPPTCIMRICNSNGEDISQAEIGDKLMLKVEVSPGEIYGGFARNCIARTVDETNEETVYTVTDDNGCATDPSIFKDWEYNRDKGYLSAVFDAFKFPNSNTIKFKCNIRVCFGQCQPQNCAGRNAFGRRRRESEHEIAGTV------YTGQLREEIKIESNAILAIERKAKRLQDNLQNRYIGN---EEVCVSKIGFIIALVITALLALVAVAIAVSCWLMAYRRRPRTEGPLPHPPEFPNPLFTTPEPLAEPTPDY 6128
            C+V   C N+     C C+ G+      C D+DEC+       C   AEC NL   + C C  G  GD  V             +C D   C+            CG NT+C       SC+CL G+ G+   GC  ++                L N  C      S D Y   C  +     S   CN  +CG    C    +  +C C  GFT   +I C D++EC S     C   AIC N    + C+CP    GD     C   K    C SD DC ++A CL N              +C++  +  +    CG N+ C++      C+C     G P                         C DPC   N CG  A C      A C+C+ G   +P   + GC  +  C      PTG   K G+  A+C+N+   F                           N VC + F       C   ++C  N               CGR A C  +V    C C  G   D +      +   C++D  C    +C +             CE AC     C  N+ C   N +  C C  G+  +P  + C  +D C   PC   A C+N  GSF C C  GT GDP +G   +   EC QD  C      LS+ CV        P  D +   +      CG N+ C        C C   + GNP      CQ     CS SS  C P     E  C+      C+   +C           C  G  +NP   KN              CG  ADC        CSCPPG  G+                         +  CLPL   C+ ++ C  NE+C+QG C+ +     D   G+ C        C  + +C                    G + ++ C L PC   + C        C CP G   +P     C  S   +C  + +C      IG++C+    +  C S+ANC++ E       CKS   +D       +C  ++C                               G NA+C ++  G  C C + +VG+P  G       CS    CL  GQTC   RC   C                        + C  N  C  NRL   C  G   D          Q  C + C  +  C       +  +   C+C + Y+GN    C  + S+  CD S +C +   C  + G + +C+C    Y+G+   +C + + C      +   C+       CR +SD   +       +     D  L  N  CG +A+C +      C C  GF+G+      +       CQ + DC  N+ C          C++PC +   CG N+ C   +    C C  G  G+   P+  C+R         C     C  N  G   C+                  DPC  + C  N +C + D  P C C           +C        D                      C    C  GAEC+ EG    CRC PG +G+P+       F++++C  +AEC   + C    G +   P      CG  A+C V  H  +C CPQ   VG P++  CR                           C  + DCP    C   +  C DPC     +   CG +  C V  H+  C C   F+ +   E+ C  +               C   +CQ  C +  +  CP  + C       IC          + C  +T C     C   +C DPC E TC  +A C   E + +C+ CP GF  VP +  GC++       D    S C    C P      +  R    C +        C   C   + C   + CV + C       C  +SDC    V      CSC+ G+E     GC+ +        + C  + CG+   C       +C+C    V +    C+   +C    +C   LAC+       + CLDPC                                   +IS            C P +TC V+ ++A CSC P ++G P + +  C       +   C G  C          +  C   +H P C C  GY      Q I    +        +PC  +A C        CTC  GM G P    C+P  +C    +C S   C   +C DPC G CG+ AKC  +NH P C C   + G      NPK++  +                                           ECV+N+DC  +++C+NNKC + C   G CGLN+ C++ NH P CSC + HTG+P              P +       G   N   +  H                   C+V  +C+ ++ C   +C+DPC   N CG NA C   NH  VCSC PGFTG+  + C +   + +  S  P    C  S           C  N +C E      C     C  G++     C+  C   ++C  + +C+N +C DPC  + CG N  C V+  +  C C  G+  NP +  +   +EP T            C  N  C            PE F    + C+P C  ++DC  N  C    C + C     C  +  C   + +  C   P  + D +    +C+    + +VT    +     +DPC  S CG N+ C      A+CSC  G  G+P   C+P    C+++++CPQ+K C   TC   C   G C QN  C+                     C +I                     C  N+QC     Q    C          C   C  N++CP  + C+  +C++PCQ     CG+ A C  QNH   C C  G +G+P   C    +      N C     G    C     A SC                C  +C+   DC +   C+E  C+    S CG N  C                  PY     E  +     +PC    C PNS C+      +C C  G+  L      + ECT N  C    +C   +C + C   N+CG  A+C    H   C CPSGF G+    C         VV++     P+ CG N+QC    G   C C     G P +          C +  AC+N     PC   GSCG  A C V N   +C C E + G+P       F C   P +  + T R+    + C  N  C  G C              C+ +               S  E   P+    C+  ++CP   +C+   C++PC    C +   C V+NH  +C C                      +DPCS SPCG  + CRA + +AIC C +G  G P     K E   ++ C P  AC                    ++  CV+P      P  CG  A C V+ +   C C P   GDPF  C     V   P+D C   PCG  A+C  N      C+C   Y G+P + C  EC  + DC ++++C N KC DPCPG CG  A C+V  H   C C  GY G+P+ QC+V +    P  P                                 P+C  N DCP+ K C    C DPCP  CG  A C V NH   C C PG+ G+P+  C                            V  ++ VC CQ  Y G PPNCRPECV+  +CP +  C +  C DPC   CG  A C VV H P+C+CP G TG+P+ RC +    PP   + PC  +PCG  A C+ V  Q  C CL  ++G PP CRPEC  + +C   + C  EKC DPC   CG N  C  +NH   C+C     GDPF+ CSP     P+  DPC+   CG NA CD       +C+C  +Y GDPY  CRPEC  N+DC   ++C+  +C+DPC G CGV++ C                             + P +PC P+PCG NS+C   V+  A C CQ+ YIG+PP+CRPEC   + CP    C+  KC DPCPG CG+NA+C+                                        V+ HNP+C+C E   G+P+        E  +    PC P+PCG NAEC  +  S +C C+ +YVG P  +C+PEC +N  CP  LAC+  KC++PC+    C +NA C+V N HHA C+CL D+ GDP   C       V +E+     PC    CG  +   E     TC C PGY G P D C+P C+VNSDCPA   C    C DPC  + CG    C V +H   C C     G     C       I     DPC    CG + IC    + A C+C             CR ECVL  DCP    C   +C  PC    CG+ A C  +NH P+C C P  FG+P V+C      + IDPC P+PC  N E   R   ++CI                 EC+++ DC  +++C S  +C +PCIG CGV ++C  + H A+CSCP   EGDP I+C    +P      C    +CP    C++R C D C   +CG+N+ C  + H + CIC  GF GNP  GC++  CK    CP T AC + +C+D C    C + A C+    H+ +C CP G  G+PY     P        C  N +CP   AC   +CVDPC    C   A C V+ H   C C  GF+      C       RPEC +D +CP  LAC    C +PC  S  CG N KCT    +P    +C C  +++GD    C+      +  C ++SEC   EAC+NRKC +PC    C  +A+C    H   CSC  G  G+PY  C +      EC  +SDC  TLAC N+ C +PC    C +NAECS  +H  +C C  GF GN       P          C+ + DCP  + C +G+C  PCL     CG  + C    TV      C+C  G   N       Q+  I   CQ ++DC   + C+    I  P    + C++ A C  +DH  KC C  G TG+P+V C        + IV  C  D EC     C NGNC++PC    + C    EC   +       +C CP + + +    C++     EC    +C + + C++  C + CL+T CG  A C+S+ H   C C PG  GNP V C +V          +C  + DC+ + +C + R  +  L+ N   C   ++C   +HR  C C      D N  C   P  I A CR + DCPS  +CI+ G C +PC     C  +  C V++  P+    C C      G+ G+     + + CES + C + + C N +C++PC+    C   A C   NH   C C P Y+GNP+  CE++EC ++ +C  +  C +  CVDPC+ +  C  NA C  RSH+  C CP   + GDP+  C          EC  + ECP    C    C DPC    PC  NA+C V          C C  G   D    C P P    PV   C  D +C+   ACI + C+ PC     C  +A C V +  P    +C CR G+  +   +C      T + C    +CP D +C+N  C +PC     CG  AECF  GH   C C  G  G+    C  I C ++ +C     C  N  CV +C+ ++PC S AEC+   H  +CR                                                   S C V+ TSP R ++C+CP GY ++ +  C  +  IV + CT D  C   +AC+NA+C+DPC CG NAVC +  H+P+C+C  G+ G+P I C K  GC+S+ EC  T  C+   C   C    V C  +A C+ +NH+ +C CP G EGNP VSC   ECR NS+C  +RACIN +C+DPC +++ C     C V  H  +CTCPPGY G+    C KV   C  DS+CP+Q AC    C NPC   +PCGVN  C VLDT+P+RTM C CLPGY G+A ++CT    C A  G I +E   CVC PG  L++  IC PCR + G II+N G C+C   +G ++D  G +CVCP  H   ++  G C+     C  +  C   +YCE   +TC DPC K  CG  A  +  +H+  C CI GY+GD    C      +    D   P +V NCLSDGV V + + D  + GL+YVKGHS++  CR  +   +  ++ +   + FG+C L    +G A F+LVI  H KL+TYK+QAY   CIY TGEQN++ GFNVS+LTTAGTIANTGPPPTC+M+I   NG +IS AEIGD LML+VEV P  IYGGFARNC+A+T+ E N+E  Y VTD+NGCATDP+IF +WE N D   L A F+AFKFP+S+ I+F+CNIRVCFG+CQP NC G NAFGRRRR  + +   T+      Y GQLREEI I+SN I  +ER+ +R   +           E++CVS +GF+I+LVIT LLALVAVAIAVSCWLMAYRR P++ GPLPHPPEFPNPLFTT E +AEP+PDY
Sbjct: 2031 CNVDQICINSK----CRCSHGFVPGPEGCVDVDECE----KQPCHPTAECTNLRGTFRCSCPQGRIGDPVVTGCAIPHHCSSNSDCHDSQACIQRNCSDPCSFVSCGSNTVCSVFDHAASCQCLTGYIGD-ATGCFKVE---------------CLSNTDC------SSDKY---CNQETNKCTSP--CNQVNCGYGN-CVAIDHVAVCKCYPGFTLVDEI-CADVDECASKP---CHPTAICHNTEGAFTCKCPHHLVGDPLTLGC---KQPGECFSDLDCPSSASCLEN--------------MCKNPCDDPTV---CGQNAECISEDHIPFCRCPEQTTGNPKIRCDHLECNYHSDCDPNSACFTNKCVDPCSVSNVCGNGADCSPSNHSAVCVCQPGKTGDP---NLGCTPVQYCQTDTQCPTGLACKGGICTALCTNTRDCFGEQLCINGLCQPTCRSNASCPDFQYCRNNVCVQEFRCVHDSDCEQEEKCVRNDVGQAECKRACDLIFCGRNAECRAEVHQAVCFCREGFHGDANDEKIGCQSIECETDDHCSQEKICTDR-----------RCEIACLTRNPCGVNAVCSASNHVQTCTCQSGYTGNPY-QGCELVDLCLNGPCAPGATCDNSRGSFRCNCQPGTVGDPYNG-GCQQPVECVQDDDCP-----LSATCV--------PLDDTLKCADICARLQCGPNAECVVDAHVGSCRCHRDYDGNPNDLRIGCQPKPIGCSTSS-DCSPNMYCYEQICR----PTCQLDEECNLSD------ICFNGQCLNPCDVKN-------------ACGLNADCQVRNHVKQCSCPPGFTGNSTIECVRFPVACRDDNDCSATDACRENVCLPL---CNIDNDCALNEKCIQGSCLLTCRLVNDCFLGHVCLRNICTAGCRGDQDCD-------------ANEACVGNKCINPCELMPCGPNARCTVLNQRATCSCPAGFMPNPSPKIACLRSPGTQCHENRDCE-----IGTRCLEGSCTPVCSSHANCLSNERCDVNGVCKSLCKKDEDCRSGEICEGLVCSKGCRSDGECQNDYSCLNNLCTDECALPNACGINAKCKMANHGRQCYCPQPLVGDPNVGCKQPFHPCSLNDDCLP-GQTCYDRRCSDACRSDANCLNDERCDGGLCKPICNSDDHCAANQICR-NRL---CTEGCRNDNACSAEESCIQNACKNPCLDSKVCGECAECRVINHAIQCSCPVNYYGNALISC--SKSLIPCDGSCECNEIGFCVKSCGSQSDCSCGEVCYNGMCQMKCDNHNACHKGYICQEGLCL-----VGCRINSDCPSS----LTCINGRCTDPCLNGNSPCGVDALCRVSNHRVVCFCPEGFQGEPSVKCYQ-----LECQQDNDCESNKRCGEDG-----ICTNPCLKHDACGLNAQCRVVDRNALCSCPPGHFGN---PKISCRRGGDECLRRPCGPNAKCRDNSVGGVECICEPGCYGDPYRGCVCERGDPCNEVQCGINAECRIYDNQPQCFCPPHLPSGDPAYACTSAGSSKTD----------------------CRTSGCGKGAECIREGTVFVCRCPPGANGSPNVE----CFTESECGEDAECPSEKACL---GGQCLDPCALRGACGANALCRVVAHKARCACPQ-CHVGVPRV-ACRPDPKCERPSSGAPAPAPPSGPPAASRGCASHADCPGGLACHAATGECRDPCLPTGGRPRACGPDKRCQVRNHEPTCVCRGGFVVNELGELACAPDTLACTQDAECPSNAACIAARCQNPCNARGKPACPDDKTCNVLDHRPICTCTRDCTPSLSICLRDTGCPPDLTCRNYRCVDPCAESTCPADAPCYVEEHKPICKFCPVGF--VPDSQYGCLK-----EVDIKVESPCHPSPCGPNSVCQVKMGRPVCSCQSNFVGSPPDCRSECLLSEECRSDQACVFQRCTNPCPSSCGPNSDC---TVVDHSPYCSCEVGFEGDAFVGCTRIIVEPPEVHDPCVPSPCGSNALCNVKDQGPVCTCIPPYVGNPHDGCKP--ECRISAECPSNLACIN------QHCLDPCLGVCGTEARCEVSNHVPVCTCLAGYTGNPFQACKLEISPLPPQNPCTPPPCGPYSTCRVMDNRAVCSCMPGYQGTPPSCRPECVVSSECPLHLACIGQKCADPCQSGCGLNAHCQVSNHNPICSCPSGYAGDPFQQCIKEEIRPPTNPCLPSPCGPNADCRVHANRPTCTCVAGMFGAP--PNCRP--ECVIQEDCPSYLACIRNKCSDPCIGSCGLNAKCTCQNHRPMCYCYEGYEGDPFSGCNPKVQVSVTPPNQPCNPSPCGSNAICTERNGVGSCTCLSDYTGNAYEVCRPECVQNSDCLQNRACINNKCKNPC--IGACGLNAECQVFNHRPSCSCATDHTGNPLVSCYATQPTETKVPTEPCLPSPCGAYSNCRVIDDHAVCSCQPGYIGSPPSCRPECVVSADCDQNKACIDQKCEDPCT--NTCGQNANCHVINHNPVCSCNPGFTGDPLIICAK--ESVVTPSPIPSGNPCLPS----------PCGPNSQCREIDGFPACS----CLPGYLGRAPNCRPECVINEECLGNFACLNEKCIDPCPGS-CGVNTYCNVVRHRPLCTCNAGYTGNPFTECIPIVQEPTTTESPRTPCDPSPCGANAVCSDRNGVGSCVCIPEYFGDPYTGCRPECVTNTDCNRNRACLNNKCVDPC--PGACGRQATCFVTNHTPSCTCMPGFSGDPS---QECV----RMEVTTPQVT-----SDPCEPSTCGPNSNCIASKGYAVCSCKTGFIGSP-PSCRPE---CTTSTECPQNKACIDNTCADPCP--GSCGQNTKCHVVNHNPVCSCAPGYTGEPFVHCAKIEMPLTGDKTLEGGVNPCVPNPCGPNSQCKVVGSQPACSCTPEYFGRPPFCKPECKDNSECPPLTACINERCKNPCQ---GACGQYARCAVQNHAPVCTCFDGHTGEPSLGCTPIPVTEPEPTNPCEPNPCGPNAQCRERNGAGSCTCPLNYLGDPHDPVRGCYPECEADRDCPSHLACVEFKCLDPCTSTCGLNALCQVANHNPVCSCPPNYTGDPYSVCIVEELKVYPKADPCLPSTCGPNSKCKSVNDQAVCTCIPGFIGLPPN--CRPECTANSDCPVHLACVNSKCADPCV--NTCGLRAQCTTRGHNPICTCPSGFTGDPFNLCSPHVTEVIPVVEQVPSCTPSPCGPNSQCQIISGTPACSCLPNYIGAPPECRPECVLSSECESHLACVNQRCQDPC--VGSCGINARCHVSNRIPVCTCMESFTGDP------FFQCTVIP-ISTQPTVRDPCNPSPCGPNTVCRDGDC-------------ECLPE------------YFGSPFEGCRPE----CVLSNECPRDKTCVRNRCKDPCVDV-CGENTRCDVVNHIPVCSCVPGFIGDPFVKCREQPKEVTEYEDPCSPSPCGPNSNCRANDRHAICSCLQGYLGVP--PFCKPECVVSSECSPTRAC--------------------INKKCVDPC-----PGSCGLNARCEVINHSPICSCLPNQTGDPFRSCYDNPVVVVEPEDPCSSKPCGPNAHCR-NVNGVPSCTCLPSYIGSPPS-CRTECIINPDCSTNKACVNSKCIDPCPGSCGNDADCKVINHAVICTCPAGYTGNPFVQCIVRKEEVNPCEPSPCGPNAVCEKQGSAGACRCVEFYHGDPYEGCQPECIINPDCPANKACLGNKCEDPCPGVCGTLAQCTVVNHIPVCTCVPGYVGNPFTLCRPEEQPVTESTRVEPCTPSPCGPNSICQVANSQAVCICQDNYIGAPPNCRPECVVNSECPQNRACHKYHCNDPCPGTCGVDALCYVVNHNPLCTCPSGMTGDPFSRCYVQPAIPPAAMRNPCAQNPCGLYAECRSVGDQAVCSCLKNYIGSPPNCRPECSVNTDCLPSQACISEKCRDPCIGSCGQNTNCRVQNHIPTCICQPGYTGDPFNECSPIIEVPPVPADPCNPFPCGPNAVCD-----NGVCTCRGNYFGDPYTFCRPECTMNSDCDRTKSCINQRCIDPCNGICGVDSRCDVVNHVPMCSCPPGTTGNPFTFCRIYQPPTVPAEPCTPSPCGPNSICRV-VDDYAACTCQDGYIGNPPSCRPECIVTAECPLTQACLSNKCEDPCPGTCGQNAKCQ----------------------------------------VVNHNPICSCEEKDTGNPFERCYPMALEGPKLPRNPCAPSPCGLNAECQIRGDSAACSCLPNYVGVP-PNCQPECTINPQCPPQLACIQQKCRNPCD--GLCVLNARCSVIN-HHAVCTCLEDFTGDPFNSCQP-----VIKELPAPPKPCDPSPCGANAYCRESFNGVTCECTPGYRGNPYDGCRPECLVNSDCPASRVCTRMKCEDPCI-DTCGLGAICTVSNHVPICSCPAKTTGYAFTSCEPI---AIDVGIVDPCNPSPCGSNTICEKSGSTATCRCLPGLTGDASSAAGCRPECVLASDCPGDKTCADSRCIDPCSRDVCGRAATCRAVNHSPLCSCPPPLFGNPFVEC---YEKEEIDPCNPSPCRSNGECQVRNGVASCI---------------YPECVVNSDCSRDKSCFS-RKCRDPCIGACGVNSLCQTVNHKAVCSCPSGYEGDPRIQCRIQDLPVAPKPECYQHVDCPMEMVCVERRCVDACSLNSCGINSRCHVQLHRAICICNPGFTGNPQTGCSEIGCKSDSMCPPTQACVNKECIDICLVMQCGLHAQCQADGFHRASCRCPEGSFGNPYEECRRPE-------CSVNQDCPSFLACQAGKCVDPCN---CPPSAQCYVDDHRPTCKCTAGFVGDPYVSCTIEPVKNRPECQNDGDCPNKLACFDGTCENPCEHSVPCGTNTKCTAVGTLPTRTMICECLPNFIGDANVACRPLEKVIEPECTADSECSHDEACLNRKCTNPCTLRLCANSAECRMRDHRYTCSCPPGMIGDPYVSCYREVSITPECESNSDCAPTLACVNQVCQNPCLDRNCGSNAECSTIDHHPTCNCQQGFAGNPQVQCFRP---------SCRTNDDCPYDKNCRNGNCVTPCLGDDVTCGRGAKC----TVIAHEAQCSCPPGTQGN------PQIACISAACQYNEDCDDHEACDRLNRICRPVCEDDTCATSATCIPRDHQPKCICGPGTTGNPHVECTRLTPQPGVSIVPECSQDRECALGLICLNGNCKDPC-ITSNMCSGDQECRVLDTVPLRITICQCPKDTITDVNGRCNRTVSSDECRSDQECRDHENCLNGGCKEACLDTNCGINAQCRSKSHTGICTCSPGYTGNPYVECSKVPPDSGSSVFVDCYSNDDCSSDRRCTNSRCISPCLVDNP--CGRNSLCHVSDHRPICKCPISYAIDRNGNCV--PPSIIAECRSNSDCPSTDSCIN-GLCTSPCN----CGDNAKCVVLNHYPS----CSC----LPGHSGNPQLGCTKLECESDTDCGSQETCYNNRCINPCSLENVCAINAECYGQNHRSACRCLPGYNGNPRAVCERVECSSNYECVSNLACQNGRCVDPCIENFPCAQNAICAVRSHEPFCRCPEHLHAGDPYSYCQRPAVIVDQPECKLDVECPSKLACFDGVCKDPCAEIRPCLANARCSVLDTAPVRTMVCTCIQGWLTDLDGTCKPIP--LAPVGG-CTADDECSDQEACIARLCRTPCS----CGSNAECYVQNHKP----VCSCRPGYQGNPYTAC------TSVECRTHVDCPWDRSCLNENCVNPCLLSNPCGLNAECFARGHVADCSCRHGYHGDAFERCDVIRCYTNADCPANRACV-NAQCVDSCVQENPCSSRAECHVREHLPICRCPAGYAGNPYVDCSLEERPECTADDDCPSVLACFSGKCENPCTVIHPCTEPSECRVLPTSPTRTMICDCPSGYVSSGSGTCQAIKSIVTIECTRDSNCASDKACVNALCRDPCGCGSNAVCNVVEHKPICSCLSGYEGNPNIECVKATGCRSDRECSGTDVCVQRSCIQACTSSLVTCAREAECRAINHRAICRCPAGYEGNPRVSCILAECRSNSDCPTNRACINSRCEDPC-LANPCQPETICSVNAHVFECTCPPGYAGSAKTGCTKVAEKCKIDSECPAQFACFDGECINPCKKIQPCGVNTSCKVLDTVPVRTMICKCLPGYFGNAIVRCTKAPICEADRGQIRDENGNCVCAPGSALNANEICVPCRTNSGMIIDNKGYCVCALERGMIIDEYG-RCVCPTEHGYVLDAFGYCKLVGLTCLSNDECVDSQYCEKTTKTCEDPCRKQICGGNAVCSATNHQAICSCIHGYSGDAYFYCN---NKRDWRTDFPTPGLVANCLSDGVQVEINLLDEGFDGLLYVKGHSKEEQCRRIILIPETMRKYVVIKIAFGSCGLIL-INGEASFVLVIQKHPKLVTYKAQAYHFTCIYQTGEQNVTLGFNVSMLTTAGTIANTGPPPTCLMKIVAQNGNEISSAEIGDNLMLQVEVQPSSIYGGFARNCVAKTM-EDNQENEYLVTDENGCATDPTIFGEWELNPDSQSLMASFNAFKFPSSDNIRFQCNIRVCFGRCQPVNCRGYNAFGRRRRSIDSDANETLSSATEEYEGQLREEITIQSNLIFTVERREERYTADPAEGIPAAQRVEDICVSMVGFVISLVITTLLALVAVAIAVSCWLMAYRRLPKSTGPLPHPPEFPNPLFTT-ESVAEPSPDY 8383          
BLAST of GH13743 vs. nr
Match: gi|801399329|ref|XP_012060167.1| (PREDICTED: uncharacterized protein LOC105623383 [Atta cephalotes])

HSP 1 Score: 2789.22 bits (7229), Expect = 0.000e+0
Identity = 2320/7043 (32.94%), Postives = 3095/7043 (43.94%), Query Frame = 0
Query:    1 MVVFLPISSGQLVGRQPNDLSIDKGVFFLNVEDGFFGCQVNASVDVLQLFEISKLCDGVPDCYRGSDEANSQIKCTKDCLYTTGRHCQHGACLDSQCYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCV-------------------------------DIDEC-RTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQG-----------ACQAQV-------------APSVSQQG---------CNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGR--FACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVC-FNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGR-SCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGEST--FECTQDSQCDQGESCL------SSRCVCRRGYERN-PAGDCVDLNECLLGN---VCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCS---NCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQ-GKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKS--VECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNS-CACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLE---------------AVTEDDDLCANQ---------QCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEK----CSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKC---MVSDGMPICLCNSGFEKNKLTGSCD--VYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRS-NGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNP--QIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKND--RGDLC-PFGQCQTTCASSS--QCPPGQICKSGICA----AGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFEN---LCQCPEGFAGVPTAA---QGCVRIPPTCTTDCP-ASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGE---------------VCGAGGQCSCQ-----------------------------------PGYEMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDE---SGACRSPDQCSSDQDCNDALACLADS-------LSGAKKCLD--PCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEY--------------------PCEGFTCGHGS-CHPEDHAPKCHCQDGYQLIGSNC------------------QDIDECAS-----------------------------------------GNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCD--GFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPR-------------------------------------------------ECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSR-----SECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRI-PSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVD--------NDCFLGHVCLDKMCKVG--------------------------------CSAPKDCPNSQSCIN----HQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPV-VACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKIC------KEVCRSDSQCQSKEICQGISCSQG---------------CRSDPDCTADKACHNNQCIGRSSKRK--------------VTNRTGS--IIAHL---------------------------ADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVP---CSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVC-NEGLCVQICNSNTQCQAGLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCRNPCNGFE-CEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKT---------------------------------------ECTTNGQCSRDKSCEGGRCI---------------------NLCSESNS-CGKNAECRMNNHRAQCVCPSGFYGNALQECV--------------------VDRNDCLLPNQCGENAQ-----------------------------------------CLNQLGGFDCVCRSGCTGDPFQGCQCPTP--KDS-CRTKGAC-----------------------------LNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATH-KCEDNERCIAQRHKPKCTCKERLL--------INSAGELICPQ--QDVQCLYEDQCPSTLSCID--GACQNPCQGT--SCPDGKSCQVLNHQALCICT-------------------------------------KDPCSI---SPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCG---------------TTACGPNMACQELYGQPVCE-CIPGFVP--KY--------------PVSLGCV-EPADDPCTP-SPCGAFANCLVVLNQLKCV-----------CPPGLFGDPFIQ------------CQPVEETPKDACQP-----SPCGSKANCNINDENQAICSCWEGYFGNPLTGC--LPE----CQTDQDCPSDQSCNNL--KCQDPCPGF-CGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDDGNCVDPCPE--------------------RCGLNADCRVQNHQVQCFCQPGFKGD-PYYQCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDP-----CV--------NNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRP-PPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPY--CRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNPPEPLETDPC--SACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAEC-------------------------SEPI----DPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPC--ETCGQHAICHIHNNIAACKCEDNYIDKPPNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKC-----EPPKVSQPIDPCLPNPCGENT---EHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRC-------------------------------------------IPAGCRS----DSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQY-------------------------------------------------ECKRHEECPSTLACRDFKCVDPCDCAVG--ANCRVSNHKTTCTCPPGFTGDPYSRDDPPRPPILTVG-------------------------------------------CEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFLFIGDFECKAPE-----------------------------------------RPECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQKAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQYECLVDSDCPYTLACPNRECIDPC--QCAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSCLEIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQVECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGM----FV--------------------------GNGGSCIAAPSLVG---------CESSSKCKADQACLNAKCVSPCN--CGTGALCDVINHTPICYCPPKYSGNPQIACE------------------------------------------------KLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKC-------------------------------STFECLTN---------------DECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCS---PQPPVFEPV-------------------------------EAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCV-FLPTDTILG--------------------------------------CVKDDECPKDSACINRMCKDPC--DCGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACL---LQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPCA--CGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVV--------------------------------------------VGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKTCPAGSGLILNEFEECVCPPGFVLDSQGICAPCRFDVGFIIENGRCICDYTKGFVLDLSGKKCVCPENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPPPVDIDRPEIVVNCLSDGVGVGLTISDPRYHGLIYV 5789
            ++ ++ +SS     R+       + VFFLN+EDG+FGCQVN S DVLQL E+SKLCD   DCY+G DE  +++KCT DC    G  CQ+G CLDS C+CNDG+GG  C +PD NECKYRPCD+F +CTNTLGSF CSC  GY+GDGFHC+DI+EC  P +A  CV+NAECCNLP++++C+CK G+ G+G+V C D++EC     CG NT+C N  GN++C C  GF G+P +                                  D++EC  ++PCG  ++C N  G+Y+C+C  G   D   G           AC A                P    QG         C    CG+NA C  +     C+C+  +TGDP   C DINEC +     CG  AIC N+ PGY C CP GY+       AC+   V T C S+FDC NNA+C+  G C C+ GF+  G  C D++EC +  NPCG  SIC N  G Y C+C +  VGTPP  PC+ PC EV CG+ A C+    EA+CICE+GW +NP +I++GC+DI+ECD    P+G+CG NAIC+N+PG F+C C  G++G+ +  C DIDEC ++  +CG  A CTN  GSYSC C      DP           C+ D +C GNA+C     C C EP VG +C   C D +C PN+ C++ N +  C C  G+   P  +  C DI+ECA NPC   AIC N  GSF C+CP G  GDP SG   ES     C   + C  GE C+      SS C+C+RGY R+   G C D+NEC+       CGVN++CKNLPGSY+C+CP GF GNPF+ C+ C+   C C PPY+ + G+C LA CS    C + A+C+ I GG+SYCACP+GY       +CEDI+EC  +GH  CG GA+C+N PGS  C CP G GGDP+ G C P +  C+++ +C+ NE+C+Q G+C+C PPF+ D L+GN CK+PC RF CG NA+CTPS+PP+C+C+AGF G+P  GC D++ECA NPC  G+ CIN    + CECP G  GDPY  GC+G+ +   EC ++D+C   L+C+   C+NPC +VPCG NA C  + HAAWCRC  GF E     CVS C+  +CG+ AQCIVS  GPTC+C EG +GNP+PGG C    CSS  PC E    C  GRC  +C    CG+ A CDP    C C   F+G+P L+CMPP Q   C   CG N+HC YG   S C CN G  GNPY GC V     DC +  CG +A C+      EC C  G+ G PY +C D++EC  + CG NA CINT G YDCRC   F GNPF GC  ++               A    D +C N          +CGP ++C  G C+C  G+ G +PNDL +GC     C  + +C   EIC  +   G R C D C + QCGPN+ CIT NH  SC+C DG+ G+ ++   GCQ  +     C  + DCPAG  C     G   C++PC  + C   +KC   +V  G   C C  G+E N +  SC+      C+ D DC     C   + G+  CV  CD   C + + C+ E H G C CLPGY GNP+DR GC    +N+CS+++ECAE + C+ + +G  +CQ  C ++ CG  A+CVV NHV  C CP G + G+P     GCR V CV N DCP  + C+RL++TC D C    CG NA+C    H+  CQCPP   P+P P+V C   +    D C P   C     ++   QCPP  +    +        CSS   C    VC   +C +PC   CGPNA C  E  N    C+C   F  VP+++    GCVR    CT D     S C +G C   C S   C+ GE+C N  C+  C     CL    CV   C  GCR++ +C + E               VCG    CSC                                    P   +  SG       + N C  G+ C N     IC   +N +P E    GAC +   C+SD  C     C+          ++G + CLD   CD   C P A C  +     C+CP    GDP    +GC    +                    PC    CG  + C   DHA  C CQ GY    S C                  Q+I++C+S                                          NPCH+SA C N +GS+ C C  G+VGDP+  GCK    C+++S+C +   C + RC +PCD  G CG  A+C+ ++H P C C  +  GNP  +C  LEC  ++DC  S +C ++KCVD C L  +CG  + C   NH  VC+C  G TGDP                                                   C  N  CP    C N +CV+  E  C  D +C+DD+ C +     +EC   C     CG NA C + +H   CSC  GF GN+K + +   P  C ++ +C     C    C   C +HN C +N  C   K +  C           + C L   C +  C  G                                C    DCP +  C+N     +C D C   +CGPNA C      A C C+  +  +P+ + V C   P+ C     C  N  C    C+P C +D +C  +++C    C      +  C  +++C+ +   +  SC  G               C    DC  D  C  N C+   +                 +T R  +   + H+                            +PC  + CG NA+C   N +A CSC  G   NP         P   C +  DC    +C  G C   C    +CL NE C N G+C  +C  +  C++G +C    C+ GC ++ +C     C+  +C D C +  S CG  A CT  NHQ  C CP    GD   SC+  +L C S++ +C  G  C+   C  +C + A C   E C  G C   C     C     C   +C  GC S+  CP  E C   QCR+PC+G + C   + C+V      C C   Y   A   CAKT                                       +C  N  C +   C+GG C+                     N CS   S CG NA CR+++HRA C+CP G+ G   QEC                     V  N CL    CG NAQ                                         C   L GF+C C  GC GDP Q C C     KD+ C    AC                             L  C   G CGK A C       +C CP    G+PD+ C T+               REC    EC   + CI   C+DPCA    C  N  C    HKP+C+C +  +         +S  + + P+    + C  +  CP +LSC    G C++PC  +  +C   K CQV NH+ +C+C                                      ++PC++    PC  +  C  ++   +C C +      L  C+++  C                 + C  +  C     +P+C+ C PGFVP  KY              P+ L CV     +PCT  +PC     C V  ++  CV           CPPG+  DP               C   E     ACQ      +PC   A C IN  + A CSC EGY GN  + C  L E    CQ ++DCP ++ C+ L  +C +PC  F CG  A C    H+  C C  GY+G+P+  C    +   P  P P C  N  C +    D+GN V  CP+                     CG N+ CRV + QV+CFC PG++G  P + C +       SC P   G  PN R  C + ++      CL G    P     CV        N CG GA+C   +  P C CPD + GNPYK C   VRP  P  PC  SPCG NA+C  +    KC C+P F+G+P    C  EC+ + +C SH  C  + C DPC  VCG NA C   +H  +C C     GDPF  C    P   + +PC  S CG ++ C V  ND+ +CSC   Y G P   CRPECL + +CP+H AC+  KC DPC G CG+NA+C                          EP+    +PC P+PCG N+ C    +   +C C +   G+PPNCRPEC  D  C + L C+++KC+DPC G CG N  C                                         V+ H P+C C EG+ GDP++ GC +    ++    PC+P+PCG+NA C E+N +GSC C+ DY GDP+  CRPECV NSDC +  AC+++KCKDPC    ACGINA C V  NH   CSCL+ Y GDP   CH P   I      D C    CGPYS     +    CSC P Y+G+PP C+P CVV++DC  + ACIN  C DPC    CG N  C V +H   C C  GY G+P  GC K     +     +PC    CG ++ C + +   AC C  NY+ + PNCR ECV++E CP +LAC   +C  PC   CG N  C+V+ H+P+C C   Y GDP  +C      P    QP  PC P+PCG N    E  + GS   CTCLP ++GDPY  C  EC+ + DC  ++AC  N++C NPC G CG  A C V+ H  +CSC     GDP   C                                           +P  CR      SEC    ACI+ +C DPCP  +CG N  C T +H   C C  G+ G+P+  CT+                                                  EC  + EC +T AC + +C +PC  A G  A C V NH   CTCP G+ GDP  R     PP  TV                                            CE N++C    AC+  +C DPC  N C   + C V  H   C CP G+     F C+  E                                         RPEC+ + ECPLHLACI+++C+DPC +  CG+ A+C    H P+C C   + GDP+T C        +E P++E          C    CG N+ C      P CSCL  Y G P  +CR  EC++ ++C   LAC N+ C DPC   C  NA+C V NH   CTC+ GF G+ +T  CS I  P+ ++   +Q  + PS   C           L PCG ++IC   D        C C   Y  N  + C  +       C  + +C   + C    C +PC     C   A+C + +H+  C+CP+G  GDP+VS       C+      D         ++PC+    PCG  ++C      AVC+C   ++G+P     + EC+  ++CP  +AC++ KC DPCL  +CG  A C+   H   C C PG  G+P   C+ +          N       +     CN   C   A+C+  N + +C C P  +G         P      C I+ DCP + +CI+  +C++PC     C  +  C+V++      V C C +G     FV                           N G+CI      G         C  S+ C  ++AC+  KC  PC   CG  A C VINH P C C P Y G+P   C                                                 K EC  + +C  ++ CY   C DPC     CGI A C   +H   C CP G  GDPF +C                               +   CL N                +CP  + C+  +C DPC+ +  CG+NA CRV  H+  C C  G  GDP   C+    QP + E +                                 EC ++SDC     CI+Q+C +PC   D C + A C VV+ VP    +C C  G+  +    C   +P DTI                                        CV   +CP   AC+N  C+DPC   CG+   C +  H P+C C E   G+P                   +C P     PA +   L SPCG NAEC   G    C    + V   P  R                          CT + EC    AC+   C+DPC   CGPNA C++ NH  +CTC +G+ G+P   C++   + N+  +    C           +  PCG +A+C+  N    CTC P   G+PY  C   EC  NS+C    AC+N +C+DPC     C   AQC   NH   C C PGY G     C  +V                                              CV +S C    ACI++ C +PC   +PCG+N +C V+   PI    C+C  GY GD   +C P    P  S       + C+  P       GI A CR     I     C C  T        G    C               PECRV+  C     C   N  C DPCL   C   +  T  +H   C C EG+TGDP   C   + P   P  ID   +     +     G+ I  P Y G  YV
Sbjct:  156 LLTWILLSSYPAESRKGLGHGSKREVFFLNLEDGYFGCQVNESTDVLQLLELSKLCDHRVDCYQGVDEQRNKLKCTDDCTKEDGTKCQNGVCLDSVCHCNDGFGGCNCQVPDENECKYRPCDIFAHCTNTLGSFQCSCFPGYQGDGFHCEDINECDDPAIARRCVENAECCNLPSNFLCQCKSGYIGNGEVHCEDVNECTIPGACGDNTVCHNIPGNYTCTCQDGFTGDPFNSVSTSVRSRMCSQENDKLEIKVDNNMPASQLPYRDVNECEESSPCGAESECVNTEGSYECRCYIGYRMDSAHGCVDMNECIGGDACAANARCINVPGSYKCICPPGFVGQGLTRCENVNECERNPCGENAECIDTVGSFACSCKTDYTGDPFKECSDINECTALE-NPCGKNAICKNEEPGYNCLCPPGYSARSSPAVACDQTDVTTLCKSNFDCVNNAECI-EGQCFCKDGFKAIGAECVDLNECLT--NPCGPASICTNTRGSYHCECESGFVGTPPHIPCKAPCDEVTCGEHAFCKADGHEAYCICEDGWTFNPNDIAAGCVDINECDAINGPSGRCGRNAICTNTPGGFSCQCKLGYSGNAFKQCIDIDECTKSN-VCGHGATCTNIEGSYSCTCPEETIPDPDPYIKCVGIVRCEIDDDCPGNAICDLQKRCLCPEPNVGNDCRHPCEDLSCGPNAHCMLLNDVATCLCSNGYTGKPGIKDGCRDINECAINPCPPGAICNNEPGSFSCQCPSGMTGDPYSGGCQESKTPHVCGPSAPCPAGEQCIKDEFVGSSVCICQRGYTRDHETGKCRDINECMELREKPACGVNAICKNLPGSYECQCPPGFNGNPFSLCEECNSIECQCQPPYKIVNGKCMLAGCSKGEKCPSGAECITIAGGVSYCACPKGYTTK-SDGSCEDINEC-IVGHQVCGYGAECINLPGSHQCICPHGYGGDPYNGLCSPAQKRCTNDHECKANEKCVQPGECVCPPPFYTDPLNGNLCKNPCDRFPCGINAKCTPSDPPRCMCEAGFEGDPQHGCIDVNECANNPCGHGTYCINTKGDHTCECPKGMIGDPYGAGCTGAPTGKSECSSNDDCENYLSCVQGNCVNPCDNVPCGPNAYCEPDKHAAWCRCVIGFTEGKNNECVSQCDGFVCGTGAQCIVSYDGPTCKCIEGFMGNPFPGGQCVPDVCSSEIPCAEP-SVCISGRCKRRCEGVICGIGAMCDPLTNKCVCNPYFVGNPDLLCMPPIQPPHCDPFCGKNAHCEYGLQESKCICNPGTSGNPYHGCGVQEK-SDCSTAVCGKDAHCNAGPNAVECLCPSGFAGNPYIQCFDINECNGNACGSNAVCINTLGSYDCRCKDGFFGNPFVGCQQVQVGPCADPSTCICSNTAPCPFDYICVNHKCINQCSDIKCGPRSVCQNGVCVCPPGYSG-NPNDLHKGCHLHGHCLNDLECEPQEICFQVG-KGVRKCVDACSKLQCGPNALCITQNHVSSCLCIDGYQGNPSNLIEGCQPSKSVIPGCVHDSDCPAGAFCITLDGGVHDCVNPCNKVVCGAYQKCEPDLVVPGHATCKCQDGYEWNPIQSSCEKPSVPDCITDDDCHSSEGCRPDALGVLKCVSLCDGFTCTANSRCIMENHHGRCDCLPGYIGNPNDRRGCHSPRENRCSTDSECAEDQTCRSTPDGPLACQLVCDFITCGPNALCVVNNHVANCECPPGQYAGDPNDSTSGCRAVPCVYNIDCPPAQLCNRLTHTCYDACDENACGVNAVCITEDHKAICQCPPGLRPNPVPDVECVAVEACHPDSCHPTALCVAGPMNNPVCQCPPNHVGDPYVNGCQPEGHCSSPKDCPVHSVCHEHRCINPCENACGPNAFC--EIVNDQPSCKCIHRF--VPSSSGPEHGCVRGTNYCTVDTQCEDSYCIDGQCRAVCRSVADCSDGEKCINNKCMVSCIAHSQCLVDHACVSGGCILGCRSNKNCPITESCINNKCQDPCSRKDVCGPNAICSCTNHAITCTCPLGFHGNPTPEQGCVRVPNVCQTPQDCPSQHLCVSGLCQCQCSEQNNCAQGERCKNGICVKICYGDSNCLPGELCIDGACEA--GCTSDVGCKRDEVCINSKCRCSHGFIAGPEHCLDINECDDQPCHPSAECINLHGSYRCTCPSGTAGDPIG--LGCVLPHHCTTHKDCSDSQACVQHNCSDPCSFVDCGLNTICSVLDHAAGCQCQPGYIGDASGCFKVECLSNSDCPTDKYCNQEINKCSSPCNQVNCGYGNCLAIDHVSVCKCYSGFVLIGDICADVNECLQNPCHSSAICQNAEGSFACVCPHGLVGDPFKTGCKQPGDCFTDSDCPNSAACIDNRCTNPCDAPGICGRNAECLARDHVPICRCPGQTTGNPATECIHLECNYHSDCSPSDACFDHKCVDPCSLLNVCGHGADCSSLNHSAVCTCQPGGTGDPNLGCTPLQYCKSDSQCATGSVCNGGICTALCGSTRDCIGDQLCINGLCQPTCRSNSSCPEYQYCHNNICVQ--ELRCTSDNDCSDDEKCIKNNIGQAECHRACDV-ILCGRNAECKADDHAATCSCKHGFFGNAKDDKIGCQPIECEVNDDCTQEKICDSHRCRIACLAHNPCGVNAICTTEKHVQVCTCQPGYTGEPTHACKLIDYCANVPCAPGALCENTRGHFKCHCQPGTVGDPYNSGCQPPVECLQDVDCPLTAKCVNINNVPKCFDTCARIRCGPNADCVASNHAANCQCRADYEGDPNNLSVGCRPRPVVCSSQIDCLVNTYCYEGICRPSCQSDEECNLSDVCLNGQCLDPCDVRGTCGINAECKVRSHIKQCSCPPGFTGNSEVECVRLPVSCLGSGDCNGDNTCRENVCLPVCTVDNDCALNEKCIRGNCLLTCRLDNDCFLGHVCLNNMCSFGCRADEDCNANEACLENKCVNPCEATPCGPNAKCTVFNQRATCSCSTGFIPNPTAKVACLRTPGPICQANRDCVVGTSCIAGVCTPVCSSSANCLSNERCDNSGICKSLCRRDEDCRSGEICEGLVCISGCRADIECQDSYECINNQCIDSC-SLTSACGVNAKCTIVNHQKICTCPSPLVGDARISCKQTFLPC-SSELECLPGQTCYGKSCYSTCRSDANCLSDERCDGGICKTICNSDDHCLANQICHNRMCDIGCRSDNTCPSDESCINNQCRSPCDGGKACGECAGCRVVNHVAQCSCPANYYGNALINCAKTMTPCDGLCECDEIGFCTTSCHHQNDCSCGEVCHSGKCRIKCDINNACPKGYVCDGGLCLIGCRTHSDCPSSLSCTNGQCENPCSAQGSPCGINALCRVSSHRAVCLCPEGYQGEPSQECYQLECHHDDDCELNKHCSEYGVCTNPCLQHGVCGFNAQCRVINRKAQCSCPPGHFGNPKINCKKGGDECLRRPCGINAKCRETLNGFECTCDPGCHGDPHQVCFCDGDLCKDTRCGINAACRIYKNQPQCYCPPNNPSGDPMHACSSDRDLGDCRTNG-CGKNAECIRDGAIFVCRCPPGTSGSPDIECTTE---------------RECTSDLECPNEKACINLQCLDPCALRGACGINALCRVVLHKPRCSCPQCYIGMPHTACHPDSKCDTLNPKPTPSIGCSSDYDCPESLSCHSQTGECRDPCLSSRYTCEVNKRCQVRNHKPMCVCKYGFVVNEIGELTCAPDTLTCSRDFDCPSNTACVNGKCQNPCNVRNKRPCPADKTCDVLDHRPVCICTKNCNPS-LSICLRDSGCSPDLACRNYRCVDPCRNSTCPADAPCYVEEHKPICKFCPPGFVPDTKYGCMKDVKCTTHNDCPIQLACVNHQCVNPCTLGNPCDFIEACHVQYHRPVCVKVESNEAECPYCPPGMQCDPATNTCIKAGCTSNKDCPLTEACIGHACQEPCLVRNPCAEHAVC-INTNHGADCSCEEGYHGNGFSYCDLLEETKNICQYNEDCPPNKYCDRLNRQCINPCVEFDCGDNAKCVSSNHQAQCTCLPGYQGNPHIGCQEIVLTVDPCIPNP-CGLNALCEN----DNGNPVCFCPKGLTGSPFEQCIPEGDQCEGNPCGANSGCRVVSGQVKCFCLPGYEGHPPNFPCTLPST----SCDPSPCG--PNTR--CSVLDNGFAKCTCLSGYIESPNTIRGCVPKADQCEFNPCGFGARCNSTRVPP-CYCPDLTIGNPYKSCG--VRPEKPYDPCLLSPCGKNAICTAIDGIAKCTCIPPFVGNPYIDGCEAECIINRDCESHLACFNQHCRDPCPGVCGANAHCEVVDHLPMCSCLPGYTGDPFRACKVEKPLVPDQNPCMPSPCGPHSICRVM-NDRAVCSCSPGYQGTPP-HCRPECLVSTECPAHLACIDQKCNDPCPGLCGLNADCQVINHNPICSCPRQYAGDPFTQCVKEEPLPPTTNPCLPSPCGPNADCRVQEDH-PICTCISGMFGAPPNCRPECVIDQDCISSLACIQKKCLDPCVGSCGFNTNCT----------------------------------------VLNHRPICHCYEGYEGDPFS-GCAKVVFPVQ---LPCDPSPCGTNAVCKERNGAGSCTCLPDYTGDPYEGCRPECVQNSDCAHTKACINNKCKDPCV--GACGINAQCQV-YNHQPSCSCLSGYTGDPLTSCHIP---IKPSTPGDTCQPSPCGPYSNCRVIDNHAVCSCQPNYIGSPPSCRPECVVSTDCSPNTACINQRCKDPCL-GTCGVNADCRVINHNPVCICAIGYSGDPFFGCVKEEITPLPKPSGNPCVPSPCGPNSQCRVIDGFPACSCLPNYVGRAPNCRPECVINEGCPGNLACQNEQCVDPCPGSCGVNTYCNVVKHNPVCICNEGYTGDPFTECTPIVEAPITTEQPRTPCNPSPCGANAVCNERNEVGS---CTCLPQYFGDPYIACRPECVTNTDCDRSKACL-NNKCVNPCPGTCGQDATCRVVNHAPMCSCLPGYTGDPVNGCTIIIVTPLPVPIDPCDPSPCGPNSNCRTHDGHAVCLCQPGFSGVPPTCRPGCIVSSECSQNRACINNKCADPCP-GSCGQNTNCLTVNHNPICSCASGYSGDPFVHCTRISTTSPSPKGEGDPCLPNPCGPNSQCRVIGSHPACSCLQNYIGRPPNCRPECTDNSECFNTAACINQRCKNPCPGACGEIAKCTVQNHVPICTCPEGYEGDPTVRCVLASPPDRTVSNPCSPNPCGPNAQCRERNGAGACGCPPDLIGDPYDIIKGCHRECETNNDCAPQLACVGFKCTDPC-PNTCGTLSICNVQAHVPVCLCPPGYTGDPYFACEIEEMIKTLEPCSPSPCGPNSKCRVVNDQAVCTCLPEYRGIPPSCRPECIVNAECPLHLACINKKCVDPCPN-ICGLKAQCITKNHNPICTCPAGFTGDPFTFCSP---HVITEIPITER------PPSCTPSPCGPNSLCQIISGNPACSCLPNYIGVP-PQCRP-ECILSTECKSHLACVNQRCADPCPGSCGINAQCHVLNHLPVCTCMEGFTGDPFT-QCSII--PLGKN--IEQLTESPSTDPC----------ALSPCGPNAICDNGD--------CRCLPEYIGNPYEACRPE-------CILNSECARDKTCLKNKCKDPCPGI--CGQNAQCDIVNHIPVCSCPSGYIGDPFVS-------CRVQPRVPDSR-------KDPCTP--SPCGPNSQCRNVEDHAVCSCLQGYLGSPPS--CRPECLVSSECPPMRACVNKKCTDPCL-GSCGLNARCEVINHSPICSCLPGQTGDPFRSCYDIP---------NISVPPEPKDRGDPCNPSPCGPNALCQNTNGQPSCSCLPTYIG--------TPPSCRPECLINPDCPPEKSCINM-KCKDPC--PGSCGDNAECKVVN----HAVTCSCKLGYTGNPFVQCVLEEEPMNPCEPSPCGANAICQQRDNAGACICIDDYQGNPYEGCQPECVLSADCSTNKACVRNKCKDPCPGVCGVRAQCSVINHIPTCTCEPGYIGDPFTTCTLQPEVDTEPTVRNPCSPSPCGPNSLCRAVNNQAVCTCQESFVGVPPNCKPECVVNSECPQNRACYKYKCTDPC--PGTCGIEANCRVINHNPLCSCPQGKTGDPFSRCFPEPVVPLPPVDPCFPSPCGLYAECKVVNNQAACTCLKNYIGIPPNCRAECVVNTDCPSDQACISEKCRDPCIGS--CGQNADCRVQNHIPVCLCQLGYSGDPFTLCTVIREQPKIPEDLCSPSPCGPNAECNEGVCRCLPNYFGDPYSYCRPECTMNSDCPRVKTCINQNCVDPCP--DTCGRDARCDVVNHVP----MCSCPPGYTGNPFLLCRPHIPDDTIKQPCIPSPCGPNSICKVVNDHAVCSCQPGLISSPPTCKPECVISADCPLTQACLNNKCQDPCPGTCGQNTNCQVVNHNPICSCSESYTGDPFT-----------------ICYPQPKTPPALMNPCLPSPCGPNAECQVRGDNPACSCIENYVGLPPNCR------------------------PECTINPECPPQLACMQQKCRDPCVGLCGPNAQCSVVNHHAICTCINGYTGNPFSACEQ---KINAPLDIRKPC-----------EPSPCGINAVCRENNGVGSCTCLPDYLGDPYQECRP-ECTQNSDCLTRMACVNLKCRDPCP--GTCGVNAQCQSVNHLPICICIPGYTGNPFTLCSPIVEILQPETNSCSPSPCGPNSKCRDINGLAVCTCLPNFIGSSPNCRAECVMNSQCSQDLACINQKCISPC--PDPCGINTQCRVIGHSPI----CICNLGYTGDPFTRCFPAPHFPVVSK------DPCLSSPC------GIYAECR----NIGNTPSCSCLPT------YRGSPPNC--------------RPECRVNSECPMNLACN--NERCRDPCLGS-CSITSLCTVYNHIPVCTCPEGFTGDPFTNC--YLRPTTAPAVIDPCNLNPCGPNARCNNGICICLPEYQGDPYV 6878          

HSP 2 Score: 2386.3 bits (6183), Expect = 0.000e+0
Identity = 2182/6845 (31.88%), Postives = 2931/6845 (42.82%), Query Frame = 0
Query:  121 CDVFGYCTNTLGSFFCSCNEGYEGDGF-HCKDIDECQIPELANT--CVQNAECCNLPAHYVCKCKPGFEGDG---KVECRDIDECLTNQVC-------------GINTLCINTHGNFSCECLPGFHGNP----------------HDGCVDIDECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDP--------YQGACQAQVAPSVSQQGCN---AQSCGQNALCQRSSNGLICTCREGFTGDPKISC----VDINECQSS--SLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTP-------PEQPCR----DPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPK------EISSGCLDIDECD--KSISP-TGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDI------------DECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPN-GRSCIDI--------DECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCV-----------------------CRRGYERNPAGDCVDLNECLLG-----NVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAI-----GHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAEC-TPSNPPQCLCKAGFTGNPLTGCEDLDE----------CALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNS-CACNIGYFGNPYTGCEVTTSV-------EDCDSLKCGDNAVCSFASGKPECTCKRGYDGIP---------YERCQDVDECLF--------SVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTED----------DDLCANQQCGPNAICNLGQCLCASGFKGDDPND-------LVEGCSSAATCQTNT-------DCGYNEICSTIAH----------SGHRF----------CSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSC---------------QPACSYLE------------------------------CGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFI-----------------------PSP-TPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFEN-LCQCPEGFAGVPTAAQGCVRIPPTCTTDCP----------------------ASSLCFNGY------CMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICV----------------DKF--CEPGCRTDSDCRLGEVC---GAGGQC-----SCQPGYE-----------MTQSGCSDLNECKNN---------ICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCY--------------QVEYPCEGFTCG-HGSCHPEDHAPKCHCQD---GYQLIGSNCQDIDECASGNPCHNS-----AKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGFCGIGAKCVVKNHSPKCSCLPRWRGNPKI-------KCELL---------------------------------------------ECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDP----------------------RECEQNLDCP---GDGKCD---NFVCVKPH-EKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICM-HQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCI-------GRSSKRKVTNRT----------GSIIAH----------LADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVPCSSASDCPQSKTCSQ----GTCVAQCQLQGDCL---QNEVCN-----------------EGLCVQI-------CNSNTQCQA-----------GLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTK-----NQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECI----EGVCISGCGSNRDCP-----------------------YGEMCEGGQCRNPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVV---------DRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQ-------GCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRH-KPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICTKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPL-DSCVKEESCGTTACGPNMACQELYGQPVCECIPGFV-------PKYPVSLGCV-------EPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQC--QPVE-ETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRP--------------------------------LPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYY------------------------QCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPK---QPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNP-PEPLE-----TDPC--SACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECS--------------------------EPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAEC-IEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPD-CQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPC--ETCGQHAICHIHNNIAACKCEDNYIDKPPN---CRRECVLHEDCPKHLACIQYKCASPCI-NQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQPIDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRC-IPA------GCRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQYECKRHEECPSTLACRDFKCVDPC---DCAVGANCRVSN-HKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFLFIGDFECKA----PERPECVSDPECPLHLACISERCLDPCT-SQACGVNAKCTVTTHVP----VCACELDYVGDPYTVCQ------KAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQYECLVDSDCPYTLACPNRECIDPC---QCAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRP-CGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACI-NPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSCL---EIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASN----HRAVCTCPIEWVGNPMRECHQY-----ECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQV----------ECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPC----NCGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGY-QGDPFVKCSTF--------ECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQC----RVSQHMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPCD----CGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCR---------------------------------------------------STCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIV-VGCTSDDECGDARACINAICKDPCACGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEV-GCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQC--TPVKTCPAGSGLILNEFEECVCPPGFVLDSQGICAPCRFDVGFII-ENGRCICDYTKGFVLDLSGKKCVCPENH--SINDNGICEE--EPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPPPVDIDRPEIVVNCLSDGVGVGLTISDPRYHGLIYVKGHSQDPNCR--LRVDEGQNGQRIDFHVKFGTCDLAYDEDGYAHFILVI-GHAKLMTYKSQAYRIRCIYSTGEQNISHGFNVSILTTAGTIANTGPPPTCIMRICNSNGEDISQAEIGDKLMLKVEVSPGEIYGGFARNCIARTVDETNEETVYTVTDDNGCATDPSIFKDWEYNRDKGYLSAVFDAFKFPNSNTIKFKCNIRVCFGQCQPQNCAGRNAFGRRRRESEHEIAGTV------YTGQLREEIKIESNAILAIERKAKRLQDNLQNRYIGN--EEVCVSKIGFIIALVITALLALVAVAIAVSCWLMAYRRRPRTEGPLPHPPEFPNPLFTTPEPLAEPTPDY 6128
            CDV+ +         C+C  G +G+ F  C  +    I    N   C  N++C       VC C  GF G     + EC    +C  N+ C             G NT+C   + N  C C  G  G+P                 D    ++ C+ +PCG  A+C  +     C C     G P            C  ++A     Q C      +CG NA+C   S+  +C C  G+TGDP   C     DI    S+  +   CG  A+C  Q     C C   Y G+    C P      C+ + DC +N  C+              G+ C+D   C  T   CG N+ C  +     C C     G P        E P      +PC    CG  + C+    +A C C   +   P        +S+ C     C+  K + P    CG    C     S  C+C  GF+GDP+I C  +            D C  +   CG  + C N  G  SC C       P +      R  C    +C  N  C      CQ+P  G          +C  N+ C V N +P C+C+  +   P  G   I I        D C  +PCG +A C N     +C C     GDP  GCR E    C   + C   ++C+ ++CV                       C  G   N    C  +    +      N CG NS+C+ L     C C   F G P      C+ SS  C P       +C+      C   AKCV +      C+CP  Y  +P  + C+ +     +       +PCG  A C       SCSC P   G P        R  C SN +C  ++ C++ KC                + PC    CG NAEC    + P C+C  G TG+P T C  +            C    C   +IC  + +   C+C     G+PY      +   EC  + +C   L C+ ++C NPC+ + CG NA C   NH   C C  G+  DS  +C    +++I   N  C  SP GP  +C E                                G+ +  C     G    C P      C +     P LVC        C S CG N++C+  N +  C+C  GY G+P+T C +   +       + C    CG  + C      P CTC   Y G P         +  C     C+           CG NA C        CRC   + GN F  C  L A+++           +D C    CGPNA C  G C C   F+GD PN        L   C     C  N         C  N +C+ I H          +G+ F           ++PC  + CGPNS C   N+Q  C C  G+ G        C+ E  C  + DCP    C       Q C +PC + SC     C V +  PIC+C         TG  D +  C             ++   +  C P      C   ++C   G    C CLP + G+P +        + +C SN+EC+    C     +  C                P CS +                               CG  AVC   N  G C C    + GNP  EGCR   CV N DCP N  C  ++  C DPC    CG NALC V  H   C C P +                        PSP  P  LC   D   +C       TC    Q     +     C A C+ +  C     CI+ KC DPC   CG NA C     N +C CP  F G P  A  C  +P       P                      AS  C + Y      C PEC+ + +C   + C    C   C  D  C  G IC                 D F  C P    D+  +  + C   GA  QC     SC P Y+           +  S C     C  N         ICG    C+      +C+C      +    C                  +AD++       DPC+ S C P + C  I+ +A CSC P +   P N +  C               +   PC G TCG    C   +H P C C     G        + I+     NPC  S     +KC     +Y C+C    +GDP    C+P  +C SNSECS+   C N +C DPC G CGI + C V +H+P C CL  + G+P +       KC  +                                             EC  N+DC A ++C+ +KC + C   G CG N+ C++ NH P+C+C  G++G+P                        C  N  C    G   C     F+   P+    C V  +C  ++ C   +C DPC  P  CG+NA C   NH  +CSC  GFTG+  + C +     ++D + P   Q  ++ C+   C     C  +       C         C   ++     C+  C+   +C N+Q+C+  +C+DPC  + CG  A C V+   A C+C +G+  +      C  EP         P +   D   C P     S C AN +C   +C   C  +            +C   C  +PDC  DKAC  N+C        G+++K  V N T          G+  A           + +PC+ S CG N+ C+  N+QA+C+C  G  GNP   C+P    C   +DC  ++ C        C+  C +   C     N VC                  E +   I       C  N+QCQ              +     C   C SN++CPS+  C+  KC+DPC      C   A C   NH   C C  G +GDP+  C        + +     + CG+   C       SC    E   G   +EG C  +C I+SDC     CI    +  C   CG+N +C                        Y  +    +   PC    C PNS C  N    +C C    Q + +    + EC  N +C  +++C   +C++ C    +CG++A+C++ +H   CVC +G+ G+    C              D  LP+ CG NA C        C C     G P            CP  +   R K  C +PC   GSCG  A C V+NH   C CPE Y G+P +       C   P++      R     + C  N +C  G C              CI +    P   C+   +IN+                  CP   +C+   C++PC GT C     C V+NH  +C C                R + G+A   C       PL DS + ++ C  + CGPN  C+    Q +C CI GF        P+  +S  C        +   DPC  + CG  A C VV +   C CPP   GDPF+QC  QP E + P D CQPSPCG  A C + ++  + CSC   + G P   C PEC ++ +CPS Q+C N KC+DPCPG CG  A C    H P C C   + GDP+ QC    +P  P +P                                 P+C  N DC S + C    C DPCP  CG+NA C + NH   C CQ  + GDP+                         +C+    +  CSC P Y G PP+CRPEC++  +CP +  C+  +CVDPC   CG  A+C  + H P CSC     G+P+ +    + P P     PC PSPCG  + C+       C C+P ++G PPYCR EC  + +C S+K C +EKC DPC   CG NALC    H   C C +   GDPF  C   P P P E     +DPC  S CG+NADC        IC+C  +Y GDPY ECRPEC+ N+DCP ++AC  NKCVDPC+G CG NAEC+                            + PC+P+PCG NS+C       A C C + Y G PP+CRPEC   + C     CV  +C +PC   CG+NA C                                         V  HNP+C C     GDP+          +E    PC P+PCG N++C +  +   SC C   ++G P  +CRPEC VNS+CP   AC+  KC DPC     CG NA+C V   H ARC+C   Y GDP   C +  S         PC+   CG  +   ER  I  C C+P Y G P   CQP C+VN+DC    ACI   C DPC    CG    C V +H   C C     G+    C      T   +E DPC    CG + +C    N A CKC       P +   C  ECVL  DCP   ACIQ KC  PC  N CG  A C  INH P+C C     G+P  +C         +PC P+PC  N E R      +C                EC+I+ DCP ++AC S  +C +PCIG CG+ +IC  + H  ICSCP    G+  ++C IPA       C  +SEC + + C +++C DPC   +CG+N+ C  + H + CIC +G+ G P + C Q  C+   EC    +C + +CVD C    C + A C     HKT C CP G+TG+PY   + P        C  +++C  S  C N RCV+PC    C   A C V  H   C CP G++      C      PE  EC  D +CP  LAC +  C DPCT ++ C V+AKC+V   +P    +C C  ++ GD    C        A C+S+S+C    AC+NR+C +PC    C  NA+C    H               +     EC ++++CP   AC N+ C DPC   +C  NAEC   NH  SC C  G  G+       P         +CK D DCP  + C + +C +PC      CG  + C+           C C  G   +    CI  +      C  ++DC   + C+    +  P    + C   A C  +DH  KC CP G TG+PYV+C+    I   C  D+EC  + AC N  CQ+PC      C  + EC   N       +C CP   + +   +C Q      +C    DC N + C++ KCVD CL T CG  A CKS  H   CFC     GN  + C +V          EC  + +CA +++C + +           C   ++C   NH   C C    +GD    C   P  I   C  + +C   +AC++ G C NPC     C  +  C VI+  P+    C CP G        C      + CES S+C     C N +CV+PC     C   A C   NH   C C P Y GNPQI CE++EC  D DC  +  C D  C++PC  ++ C  NA C  + H ++C CP     G+PF  C           EC  + +C     C+  +C+DPC V +PC  NA+C     V      C CP G   D    C P   +   V   C  + DC+    CI++ C+NPC     C  +A C V +  P    IC C  G+  +   +C  +       C  D +C  D  C N  C +PC     CG  AECF   H   CRC +G  GNPL  C  IGC S+ +C     C  N  C+  C+  +PC   AEC  L H  +CR                                                   S C V+ T P+R +VC CP GY ++ +  C    PI+ + CT DD+C   R+C+NAICKDPCAC PNAVC + NH+P+C+C  G+ G+P+I+C  V GC+++++C  +H C+  +C P C P    CG +A+C G++H+ +C CPPG  GNP VSC  + CR NS+C  ++ACIN +C++PC I + C D   C V NH V+C CPPGY G   + C KV   C  D++CPSQTAC +  C NPC    PCG+NA+C VLDT PIRTM C CLPGY G+A I+C   P + CP G G I +E+  CVCPPGF  D+  +C PCR     +I E G C+CD  KGF +D  G+ CVCP  +   I+  G C +    ECR + +C    YC+    TC DPC K  CG  A      H+  C CI GY G+P   C      K    D  RPE+ V+CLSDGV V + + D  + G++YVKG S+D  CR  + +    + +   F V FG C L +  +G A F+LVI  H KLMTYK+QAY I+CIY TGEQN++ GFNVS+LTTAGTIANTGPPP C+M+I   NG +I+ AEIGD LML+VEV P  IYGGFARNC+A+T+ E N E  Y VTD+NGCATDP+IF +WE N D   L A F+AFKFP+S+ I+F+CNIRVCFG+CQP NC G NAFGRRRR+ + EI  T       Y GQLREEI I+SN I  +ER+ +R   +          E++CVS +GFIIAL+ITALLALVAVAIAVSCWLMAYRR+P+T GPLPHPPEFPNPLFTT E +AEP+PDY
Sbjct: 7547 CDVYNHVP------MCTCPSGMDGNAFVLCSPVPAPPISNPCNPSPCGPNSQCRENNMQAVCSCISGFIGAPPTCRPECVISSDCPKNEACTNQKCQDPCPGSCGRNTICNVINHNPVCVCRSGMTGDPFINLSQLILIGITFKAEDPLPVLNPCQPSPCGPNAQCQVINDQASCSCLQEFIGSPPNCRSECNSNSECSNKMA--CINQKCRDPCINACGINAVCNVVSHTPMCACTPGYTGDPFTQCSPQQFDIQPSISTPCTPSPCGANAVCRVQQNAGSCSCSTDYIGNPYEGCRP-----ECTLNSDCPSNQACI--------------GLKCKD--PCPGT---CGQNAQCYVINHAPTCTCFEQYTGNPFIFCNLIVEAPIIADNINPCQPSPCGPYSQCRESNGQAVCSCLPTYIGAPPGCKPECTVSTDCATNRACENNKCVDPCPNSCGQGTTCRVVNHSPICICKPGFSGDPFIRCLFVPPTPSYLPSLPSDPCIPSP--CGSNSQCRNINGYPSCSCMINYIGTPPNC-----RPECVIPADCPSNQACIRE--KCQDPCPG----------SCGLNADCTVHNHIPICRCIESYTGDPFIGCQPIPIYNEPIQPTDPCNKSPCGPNAQCNN----GICICLPEYFGDPYVGCRPE----CVLSTDCSTDKACIRNKCVDPCPGTCGQNSLCNVINHTPMCSCPPGTSGNAFISCDVIRVPSVTRPCSPNPCGPNSICRELNEQAVCTCAPEFLGAPPLCRPECTLSS-DCRPNEACANQKCKNPCPGTCGIQAKCVVVNHN-PVCSCPERYTGDPFIR-CDIMKPIAPVVINPCQPSPCGPYAQCQVVNDLPSCSCLPEYRGSPPY-----CRPECISNHECPSHQSCVRQKC----------------RDPCPGL-CGENAECHVIQHVPHCVCTYGLTGDPYTRCSAIPRPIELEPISSPCVNFECGANAICKERDSVAICQCISSYVGNPYL-----ACRPECIINPDCASNLMCVRNKCTNPCAGM-CGRNAECSVVNHQPICTCLPGYTGDSFISC--FIDKIISDENV-CAPSPCGPNSKCKE------------------------------VSGQAVCSCLPSYVGTPPACRPE-----CVASSECSPQLVCKDYKCVNPCPSPCGLNTNCVVVNHSPICSCMSGYSGDPFTICSLIPLITPPLVQKDPCVPSPCGSFSQCRNIGDSPACTCLENYIGQPPNCRPECTIHSECPSDKACINMKCVDPCPGSCGTNALCSVINHIPTCRCPEGYTGNTFVLCEILPAISKRYEPSTTPSPVEDACVPSPCGPNAQCFDGICTCLPEFRGD-PNVGCRPECVLNADCPRDRACIRNKCLDPCPGACAVNALCTVIGHIPMCSCPGNMTGNAFSQCTPLQDIPLANPCTPSPCGPNSECRVINNQAVCSCIRGYLGSP----PTCRPE--CIVSTDCPQNEAC-----SNQKCTNPC-LGSCGLGASCQVVNHNPICIC-----PPSQTG--DPFVRCYLSPP--------QIPVSLTPCKPN----PCGPNSQCQPRGDESVCTCLPDFIGSPPN-------CRAECVSNSECSNHLACINKKCRDPCIGSCGANANCHVVSHTPMCSCINDYTGDPFTQCTLREPTPLPPAPIDPCNPSPCGSNAVCKEFNGAGSCTCLPN-YTGNP-YEGCRP-ECVLNSDCPANSAC--VNMKCRDPCPGS-CGRNALCQVVNHLPVCNCYPRYTGDAFSYCTPIEIEGENAVSNPCEPSPCGPNSLCRVVDNTSVC-------TCLPDFQ----WVASPPNCRAECTVSAECAFNLACISYKCNDPCRTLCGSNARCETINHNPICSCPSRFTGDPFVA--CFEMPSKDEESRPLVNPCTHSPCGPYSECRDISGQASCACLSTYVGTPPNCRPECSVNPECPTNQACIQRKCRNPC--DGVCGVGAICNVIRHTPTCSCSNGFTGDPFVMCRPIPEEDTTLKPTDPCLNCGANTQCFNGICSCLPEYQGNPNFGCHPECILNSDCPRHRACIKNKCQDPCGLGICGVNALCSVINHIPVCTCAQRMSGNAFVQCSP----------------IADTIPK-----DPCNPSPCGPNSQCRKIKEQAVCSCLPGYLDAPPNCRAECIISSDCLANRACNNQKCIDPCPG-TCGIRAQCTVVNHNPICSCSSELTGDPFTQCIPRPIESPTPINPCVPSPCGLNSKCEVVNNAYSCSCLPEFIGDP--PNCRP--ECVSNSECSTQLACINQKCRDPCPGSCGINSDCRVISHTPMCVCLIGFEGDPFVLCNPKQSKCSDVINAVKPTPCIPSPCGFNAVCRELNGVGSCMCLSDYTGNPYEGCRPECTINSDCTADRACVGSKCQNPC--PGFCGYNAICQVVNHAPLCTCQPGYSGNPFVSCNRIVQDTCKSLELNPCSPSPCGLNSQCRELNGQAVCSCLPTFIGTPPNCRAECTVSSDCPVNRACKNRKCVDPC--PGICGINARCEVINHSPICSCNQGFTGDPFITCFQT----LIDKDTP---QTPENPCVPSPCGPFATCRDSGYAGVPTCT--------CMENYIGSPPNCRPECTVDSECNNNQACLRQKCRDPCLGS-CGIGAQCLVVNHMAICLCPKGYTGDA--FTNCFPEPA--------PASIPQDP--CNP-----SPCGANTVCRDGVC--TCMPEFHGDPY-----TACRPECVQNPDCPLDKACVRNKCFDPCIGVCGQNAKCTVINHTPMCACPDGMSGNAFAACYPVIQDQTIIENPCNPSPCGPNSRCQNFNNQAVCTCITGFIGNP-PACRPE---CIVNTDCALNEACINMKCGNPCLGACGISARCQVLNHNPVCTCPPVFTGDPFIRCVPRPEDIPKPINPCQPSPCGPNSQCQIINDTPSCSCTIEFIGTPPNCRPECISNSECPSQMACINRKCRDPCPGS---CHSLANCYVINHVPTCTCHVGYTGDPFVQCMIMPSELPAPRQPCQPSPCGTNAVCREQNGVGSCTCLLE-YIGNP-YEG-CRPECTISSDCPAHLACIGSKCQNPCPGSCGTNTNCQVINNIPICTCIPGYTGNPYINCIYQTLSISDEKHEPCKPSPCGPNSQCTNNNGQAVCSC--LLQFIGTPPNCRPECLVNSECGSNRACVNQKCVDPCI--GTCGRDAQCKVVHHSPICVCANGYTGDPFIYCFAVAISNPEDQYLKDPCLPSPCGPNALCRAIGDAPACSCMQNYMGVPPNCRPECSINSDCPANRACIREK--CRDPC--PGSCGLLARCSVINHTPSCICPEGYTGDPFI------SCNVLPQIPLLPPDR--CNPSPCGQNAQCNNGVCT-------------CIPEYLGDPYVGCRPECVINT-----------------DCPRDKACMFHKCRDPCIGT-CGVNADCIVVNHLPMCSCP---------------RNMTGSAFVSC------TPLQDSTIMKQPCNPSPCGPNSHCRVSNNQAICACIAGFRGTPPSCRPECLISADCARNRACSNQKCIDPCLGA-CGLTAQCTVVNHNPICSCPPLYTGDPFVQCIRQPEEPQPPIDPCQPSPCGPNAICRVLNDAPS-CSCLPQFIGTP-PRCRPECVSNSECPSQQACINQKCRDPCPGSCGRNAECRTVSHTPICICAGDFTGDPFIQCNPRPIPLNPCQPSPCGANAMCREISGSASCTCLPDFYGNPYEGCRPECVINSDCTSNRACIRNRCQDPCPGTCGVNAICEIVNHIPMCSCQLRYTGDPFRYCELMQETPPIGDPCQLSPCGPNSRCLNVNGKASCSCLPTYQGIPPDCRPECIVSTECPINRACVNQKCVDPCPGVCGINAKCDALSHSPFCSCGPSQIGDPFVK----LMPVPTLQVNPCVPSPCGPFSTCQDKGGYPFCTCMPNYIGSPPYCRTECSINSDCTSNKACIREKCRDPCPGSCGFNALCTVIKHTPTCTCLNGYTGDPFSNCYLAPMPIPTEIPTVTSDPCNPSPCGLNADCR-----NGICNCIPEYHGDPYRECRPECVQNSDCPFNRACANNKCVDPCVGICGQNAECAVINHVSTCSCVKDYEGDPFTLCKRVQSRVKPCEPSPCGPNSICRE-FGDQASCSCLSGYFGIPPSCRPECLVSTDCEQSKACVNMRCRNPCENACGQNALCV----------------------------------------VRNHNPICRCPVQHSGDPFINCFPITTPDVEPTRDPCYPSPCGLNSQCAVSADNIPSCSCSPTFIGSP-PNCRPECHVNSECPTNQACIKQKCTDPCV--GLCGFNALCQVTL-HQARCTCPESYTGDPFTVCSEIISIPTPPVSSKPCSPSPCGINAYCHERFDIAICECVPNYRGNPYQGCQPECLVNTDCSKSQACIKTKCQDPC-PGTCGVGATCTVSNHVPICSCPLPTIGDAFTLCQVPVEDT---KEMDPCYPSPCGPNTMCEKIGNTAICKCLPGLQGVPTSITGCHPECVLSSDCPGDKACIQSKCKDPCSQNVCGSKAVCKTINHSPLCSCPSPLIGNPFEEC---YTKIETNPCSPSPCNYNGECRVRNDVAVCI-------------YPECVINSDCPRDKACFS-QKCKDPCIGACGINSICQTVNHKPICSCPIGFMGNARVQCTIPALEEPIPECTQNSECSNDKTCFNQKCVDPCTLDSCGLNSRCHVQMHRAICICNDGYTGYPQQYCHQLGCRSDSECSLIQSCINNECVDTCLVTQCGINAMCTADGYHKTRCYCPDGYTGNPYEICERPE-------CTSDNDCAPSLVCRNLRCVNPCN---CPPPALCNVVNHRPICKCPPGYVGNPYTSCLMDLLEPET-ECQVDADCPSKLACFNGICKDPCTETKPCIVSAKCSVVDTLPMRTMICECLPNFAGDATVACVPVDKQIAAVCESDSQCTPDMACLNRRCINPCTVNPCSPNAECHIENH--------------RQNIVLAECRINTECPSDKACINQLCQDPCSSNRCGLNAECITINHHPSCHCQHGLAGDPQAQCFRP---------ECKTDNDCPYDKTCRNDNCISPCFIGDVVCGRSAECRAV----SHRAQCICPQGTQGDPRVACISAI------CHYNEDCADHEACDRLNRVCRPVCDDDACGETAICVARDHQPKCTCPLGTTGNPYVTCIGEPSIEPECTQDNECTLNLACINTKCQDPC-ISAGMCTSEQECKVLNTEPLRTMICLCPSNTITDVNGQCKQIVLGDVQCHLDQDCANYETCLNGKCVDACLTTQCGFNAQCKSTSHTGICFCSQDFTGNAYIECIRVPVVPLPGPRPECYTNSECARDKQC-INSLCVNPCVAGDPCGKSSLCHVDNHNPICKCPIGYIGDPKTKCI--PPEITPECVSNSECAGNYACVN-GMCINPCN----CGLNAKCNVINHYPS----CVCPPGYSGNPQLGCFK----LDCESDSECDYAATCYNGQCVNPCILDNKCAINAECYGKNHRSACRCGPGYYGNPQIHCERVECNTDHDCPHNLACNDGRCINPCAENSLCAQNAVCYVQDHIASCRCPENIPLGNPFSYCERHTAVEIEEPECKVDIDCLDKLVCIREKCIDPCPVIKPCLENARCDVLDTVPVRTMICTCPEGWITDVDGVCRP---IQLTVIGTCTTNDDCSDRETCINRQCRNPCN----CGTNAACYVKNHKP----ICSCEQGYQGNPEIACYSV------ECQHDSQCTLDKTCKNNNCVNPCLVTDLCGTNAECFPNNHVADCRCRKGYHGNPLDRCRVIGCYSNGDCPGDHSCI-NMQCIDPCIHDNPCSPRAECRVLNHLPICRCPSGFTGNPYINCQLEVRPECREDSDCPDSLACLSNKCQIPCPIIQPCTEPSECRVLPTHPIRTMVCVCPSGYVSSGSGTCRATKPILKIECTKDDDCSSERSCVNAICKDPCACRPNAVCNVINHKPICSCTLGYDGNPDILCTRVAGCKTDNDCSGSHVCVQRNCVPACSPSLASCGKNAVCHGIHHKAICECPPGFGGNPRVSCVLLGCRTNSDCPTNKACINNRCENPC-IQNPCTDNMDCNVYNHIVECACPPGYIGDIKSGCTKVKEKCKADNECPSQTACFNGQCINPCTKIAPCGINAECKVLDTSPIRTMICECLPGYRGNAIIRCDQIPAEICPIGKGQIRDEYGNCVCPPGFGKDANDVCIPCRKQSNMVINEEGFCVCDLEKGFSIDEYGR-CVCPTRYGYEIDTKGYCRQIGVIECRHNDDCADDRYCDKVTHTCQDPCKKQQCGVHALCNTTRHQAICICINGYLGNPYTQC----CTKDGRTDFPRPEMDVSCLSDGVQVVIHLQDQDFDGVLYVKGRSKDEQCRRVVSIPAETDHKTETFKVAFGNCGLIH-VNGQASFVLVIQKHPKLMTYKAQAYHIKCIYQTGEQNVTLGFNVSMLTTAGTIANTGPPPICVMKIVAQNGNEINSAEIGDNLMLQVEVQPSTIYGGFARNCVAKTM-EDNLENEYIVTDENGCATDPTIFGEWEQNPDTQSLMASFNAFKFPSSDNIRFQCNIRVCFGRCQPVNCRGYNAFGRRRRDVDSEINDTSLSVSDGYEGQLREEITIQSNLIFTLERREERYTADPAEAPSAQRVEDICVSMVGFIIALIITALLALVAVAIAVSCWLMAYRRQPKTAGPLPHPPEFPNPLFTT-ESVAEPSPDY 13889          

HSP 3 Score: 1665.59 bits (4312), Expect = 0.000e+0
Identity = 1860/6323 (29.42%), Postives = 2505/6323 (39.62%), Query Frame = 0
Query:  120 PCDVFGYCTNTLGSFFCSCNEGYEGD------GFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDI-DECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQG-ACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCR-EGFTGDPKISCV---DINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDEC-DKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQEC----------------IGNAVCF-NGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQ-CLPGFKLS-----------------PNGRSCID---IDECA-GNPCGQDAICENLLGSFVC-----------KCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCL-----PP--YQDIEGRCQLADCS--NCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECL----QGKCIC------SPPFFVDTLDGNHC----------------------------KSP------------CHRFSCGFNAECTPSNPPQCLCKAGFTGNPLTGC-----EDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCV---------SLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCS---LLS--CSSASPCLEQ------------GQTCQ--------------GGRCITQCGQEQ-------------CGVNAFC--DPNRLSCTCQSGFLGDP---------------TLVCMPPTQQAECSSECGTNSHCIYGNPNS-CACNIGYFGNPYTGC-EVTTSVE-DCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQ----------DVDECL--------FSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAIC----NLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGF--EKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCIC-PQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFI-------------PSPTPEVLCEKNDRGDLCPFGQCQTTCASSS-QCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFEN-LCQCPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKL-CHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKN---NICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQ---------VEYPCEGF--------TCGHGS-CHPEDHAPKCHCQDGYQLIGSNCQDIDECA------SGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGFCGIGAKCVVKNHSPKCSCLPRWRGNPKI----------------------------KCELL---------------------ECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDP----------RECEQNLDCP------------------GDGKCDNFVCVKPHEK---SCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCI-------GRSSKRKVTNRTGSIIAHLA----------------DPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVPCSSASDCPQSKTCSQGTCV----------AQCQLQ-------------GD-----CLQNEVCNE---------------GLCVQICNSNT-QCQAGLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGF---CLQQCQIASDCQNGAECI----EGVCISGCGSNRDCPYGEMCEGGQCRNPCNGFECEPNSFCQVNGRNP---------------------LCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLL-----PNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKG------ACLN-----PCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICT---------------------KDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPK---DACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQC-------VVDRVP----------------------------KPPIRPLPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCIVRG---------------------NREVCSCQPGYFGGP-PNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNPPEP-LETDPC--SACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECSE-----------------------------PIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSP-PNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSG--IVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEER-DPC--ETCGQHAICHIHNNIAACKCEDNYIDKP-PNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQPIDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFI---RCIPAGCRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQYECKRHEECPSTLACRDFKCVDPC--DCAVGANCRVSNHKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFLFIGDFECKAPERPECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQKAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQYECLVDSDCPYTLACPNRECIDPC--QCAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTS---NGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSCLEIVTGCKSDDECQDHEACYNGNCQ--NPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQVECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPCN---CGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCSTFECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILG-----------------------------------------CVKDDECPKDSACINRMCKDPC--DCGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPC--ACGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNS-ECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGN----------------------------------SCKKVVVG--------CVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKTCPAGSGLILNEFEECVCPPGFVLDSQGICAPCRFDVGFIIENGRCICDYTKGFVLDLSGKKCVCPENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKP-PPVDID 5759
            PC +   C  +     C C EGY+G+         C   D+C   EL   C +   C N                          CL + VCG N  C   +    C C PG  GNP   C    DEC   PCGI AKC   L  ++C C  G  GDP+Q   C   +        C    CG NA C+   N   C C     +GDP  +C    D+ +C+++    CG  A CI     + C CP G +G     C        C+SD +C N   C                +  Q +D C +    CG N++C  V     C C    +G P             C   + C  +  +          Y+  E  S      EC D  +S    C VN  C        CVC  GF     +       CA +   C R+  C +        C NG   +P ++     +R C +D+ C                   ++C  +  C+         C D CR++TC  ++ C V+   P C+ C PGF                    P   +C++   ++ C  GNPC     C       VC            CP G   DP +    ++   CT +  C   E+C+   C                   CL+ N C  ++VC N     DC C  G+ GN F+ C     +   C      PP  Y D   R  +  C   +C   AKCV  +   + C C  GY+ NP     E +         PCG  A C N+ G+  C CP G  G PF+  C+P    C  N  C  N  C     Q KC C       PP F  TL    C                            +SP            C    CGF A C  +  P C C     GNP   C     +  D C L+PC + +IC       +C C P   G+PY +GC      EC  + +C   LAC    C +PC  V CG+NA+C   +H   C C  G+  D    C          + C    CG ++ C V      C C  G  G P    HC    L+S  C +   C++Q               CQ               G   TQC +E+             CG NA C    +   CTC SG  G P               +L C+       C   CG N++C   N    C C  GY G+P++GC +V   V+  CD   CG NAVC   +G   CTC   Y G PYE C+              C+           CG NAQC        C C S + G+P   C      +   D C    CGP + C    N   C C   + G  P       S    C  +TDC  N  C       ++ C DPC    CG N+ C   NH   CIC  G++GD   P  GC +EE     +  P+G              +PC    C  N +C V DG P C C   +          C + +GC  +  C Q   C +   G       C++V            H   C C  GY+G+P        F++  C+   E   +    R+         C+   CG  AVC  RN VG C C PQ  + G+P I  CR   CV N DC  ++ C  L+  C++PC    CG++A C V  H   C C P +              P P P   C+ +  G   P   C+T    +   C PG       C  GC  ++ C + R CI  KC DPC  +CG N  C     N +C C  G++G P     C RI  T  +       C    C P               N  C  +  H   +CLQ  I     C P C  +S+C     C             + Q        CKN     CG    C       IC+CP     D +  C               LA   D     +   +PC  + C P A C        C CPP   GDP +   GC++          +  C GF        TCG  S C+ + H P C C  GY        +I+E        S +PC  ++KC        CTC     G P +  C+P  +C  N+EC     C N +CVDPC   CG+ A+C+ KNH+P C+C   + G+P                               C+++                     EC+ + +C +  +C+N +C D C   G CG+N++C + NH PVC+C  G TGDP          +  EQ  + P                  GD +C       P+E     C+++  C  D+ C +++CKDPC  P  CG NA C   NH  VCSCP G+ G+  V C   P   + DS         K  C     + + C  N +C   +    C     C  G++     C+  C    +CP  ++C+N +C DPC  + CG NA C+VI     C C  G   +P    +C   P     N   P         C P     S C  N LC     +  C     C    I    SC   C  +PDC  +K+C N +C        G +++ KV N   +    L                 +PC  S CGANA C+ +++   C C +  +GNP E CQP    C  ++DC  +K C +  C           AQC +              GD      LQ EV  E                LC  + N     CQ   V +   C   C  N++CP    C + KC DPC      CG  A C   NH   C CP+G +GDP+  C    +      + C          C K     A C C ++ + G    C  +C + +DC +   CI       CI  CG N DC          C+    G+  +P + C V    P                     +C C   Y       C + ECT N  C R K+C    C++ C ++  CG++A C + NH   C CP G+ GN    C     D  +     P+ CG N+ C        C C+ G    P      PT K  C          ACLN     PC   G+CG+   C+VVNH  +C C E Y G+P  +C  Q   K  P                          A ++PC    C  N  C  +   P C+C E  +       + P    +C    +CP  L+C+   C++PC G   P+ + C V+NH A+C C                      + PC  SPCG  A+CR   G   C C     GDP   C + E    + C   MAC                    V+L C     DPC P  CG  A C  V +   C+C PG  G+PF  C P+ E  +   ++C PSPCG  + C  +    A+C+C   + G+    C  EC  +  C  D +C N KC  PCP  CGI   C V  H P C C  GY GDP+ +C       VV + P                              P    P+C+ N +CP    C++  C DPC   C + + C V NH   C C  GF GDP+  C +R                      N  +C C P Y G P   CRPECV+  DC +D  C+R +C+DPC   CG  A C V  H PMC+CP G  GN + +C I+   P +  C PSPCG N+VC+    Q  C C+ GFLG PP CRPEC    EC   + C  +KCI+PC   CGI A C   NH  IC C   + GDPF RC P PP+P L+T+PC  S CG NA+C V   D   CSC   +LG P   C+PEC++N++CP+H AC+  KC +PC G+CG NAEC                               P+ PC+P+PCG N++C+    G+  C C  DYIG+P   CRPEC  D+ C + L CV+ KC DPCPG+CG+ AEC+                                        V+ H P CTC+ G+ G+P+    + +       +  C P+PCG N++C   N    C C+  ++G+P  +CRPECV +SDC   LACL+ KC+DPC    +CG N+ C V   H+  CSC N + GDP   C + P    +V++   DPC    CG +S+  +  G+ +CSCLP Y G+PP+C+P C +N++C A++AC+   C DPC    CG    C V +H   C C P Y G+P I C+  P        + DPC    CG +  C    N   C C   Y   P   CR ECVL+ DC    AC++ KC  PC   CG+NA C V NH P+C C     G+  V C P       +PC P+PCG N++ R+     +C+C+ GF G P T C  EC+I  DCP N AC +N +C +PC G+CG   ICNVI HN +C C   + GDPFI   + I  G    +E P           +PC    CG NA+C+  +  ++C CL+ F G+P     + EC  + EC + +AC + KC DPC   C + A C V +H   C C PG+TGDP++                  +C      I      PC  +PC   A C V ++   C+C   ++      C    RPEC  + +CP + ACI  +C DPC    CG NA+C V  H P C C   Y G+P+  C            + EA I     +PC    CG  + C  +    +CSCL  Y G P   C+  EC V +DC    AC N +C+DPC   C     C V NH   C C PGF G+ +               +C      PS       D   PC+   PCG++S C+  +  P    +C+C   Y     N   EC+              DCP +Q C    C +PC     C   A C V +H+  C C    TGDP++ C  I                YN   Q  +PC+    PCG  A+C+      +C C  E+ G+P   C   EC+   DC  DKACI NKCVDPC   TCGQ +LC    H   C CPPG  GN  + C  +                R  +    C+   C   +IC   N +  C C P  +G         P      C +  DC    AC ++ +C+NPC     C     C V++ +P    VC CP   + G+          + C+           +    ++PC    CG  A C V+N  P C C P+Y G+P     + EC ++ +C  HQ C    C DPC     CG NAEC    H   C C  G  GDP+ +CS             +   +     PC VN  CG NA C+    +A CQC     G+P + C P          EC I+ DCAS+L C+   C NPC  +  C ++A CSVV+  P    IC C  G+  DS  SC     D I+                                          CV   EC     C +  C +PC   CG    C +  H P+C C  G  G+P   C+ I   +    Q  D C P           SPCGS ++C  +G    C    + +   P  R                          CT   EC   +ACIN  C DPC  +CG NA+C++ NH P C C +G+ G+  ++C+ +   S   E  TT   +   C P       PCG +A C       +CTC P   G+P V C   EC  N++C  DRACI  +C DPC     C   A C V  H   C+CP    G   +                                  SC +  +G        C+  +DCP   AC ++ C NPCL +  CG+ A C V++  PI    C+C P   GD  ++C      P    + L   +   C P      +G  + C     FI     C                                   EC  +  C+    C   N+ C DPC+   CG  A      H   C CI  YTGDP   CT +  P P PP  ID
Sbjct: 3450 PCGINALCRVSSHRAVCLCPEGYQGEPSQECYQLECHHDDDC---ELNKHCSEYGVCTN-------------------------PCLQHGVCGFNAQCRVINRKAQCSCPPGHFGNPKINCKKGGDECLRRPCGINAKCRETLNGFECTCDPGCHGDPHQVCFCDGDL--------CKDTRCGINAACRIYKNQPQCYCPPNNPSGDPMHACSSDRDLGDCRTNG---CGKNAECIRDGAIFVCRCPPGTSGSPDIEC---TTERECTSDLECPNEKAC----------------INLQCLDPC-ALRGACGINALCRVVLHKPRCSCPQCYIGMP----------HTACHPDSKCDTLNPKPTPSIGCSSDYDCPESLSCHSQTGECRDPCLSSRYTCEVNKRCQVRNHKPMCVCKYGF----VVNEIGELTCAPDTLTCSRDFDCPSNTA-----CVNGKCQNPCNV---RNKRPCPADKTCDVLDHRPVCICTKNCNPSLSICLRDSGCSPDLACRNYRCVDPCRNSTCPADAPCYVEEHKPICKFCPPGFVPDTKYGCMKDVKCTTHNDCPIQLACVNHQCVNPCTLGNPCDFIEACHVQYHRPVCVKVESNEAECPYCPPGMQCDPATNTCIKAG--CTSNKDCPLTEACIGHAC----------------QEPCLVRNPCAEHAVCINTNHGADCSCEEGYHGNGFSYCDLLEETKNICQYNEDCPPNKYCDRLNRQCINPCVEFDCGDNAKCVS-SNHQAQCTCLPGYQGNPHIGCQEIVLTVDPCIPNPCGLNALCENDNGNPVCFCPKGLTGSPFE-QCIPEGDQCEGNP-CGANSGCRVVSGQVKCFCLPGYEGHPPNFPCTLPSTSCDPSPCGPNTRCSVLDNGFAKCTCLSGYIESPNTIRGCVPKADQCEFNPCGFGARCNSTRVPPCYCPDLTIGNPYKSCGVRPEKPYDPCLLSPCGKNAICTAIDGIAKCTCIPPFVGNPYIDGCEA----ECIINRDCESHLACFNQHCRDPCPGV-CGANAHCEVVDHLPMCSCLPGYTGDPFRACKVEKPLVPDQNPCMPSPCGPHSICRVMNDRAVCSCSPGYQGTP---PHCRPECLVSTECPAHLACIDQKCNDPCPGLCGLNADCQVINHNPICSCPRQYAGDPFTQCVKEEPLPPTTNPCLPSPCGPNADCRVQEDHPICTCISGMFGAPPNCRPECVIDQDCISSLACIQKKCLDPCVGSCGFNTNCTVLNHRPICHCYEGYEGDPFSGCAKVVFPVQLPCDPSPCGTNAVCKERNGAGSCTCLPDYTGDPYEGCRPECVQNSDCAHTKACINNKCKDPCVGACGINAQCQVYNHQPSCSCLSGYTGDPLTSCHIPIKPSTPGDTCQPSPCGPYSNCRVIDNHAVCSCQPNYIGSPP-------SCRPECVVSTDCSPNTACI------NQRCKDPCL-GTCGVNADCRVINHNPVCICAIGYSGD---PFFGCVKEEITPLPK--PSG--------------NPCVPSPCGPNSQCRVIDGFPACSCLPNYVGRAPNCRPECVINEGCPGNLAC-QNEQCVDPCPGSCGVNTYCNVVK-----------HNPVCICNEGYTGDP--------FTE--CTPIVEAPITTEQPRT--------PCNPSPCGANAVCNERNEVGSCTCLPQ--YFGDPYI-ACRP-ECVTNTDCDRSKAC--LNNKCVNPCPG-TCGQDATCRVVNHAPMCSCLPGYTGDPVNGCTIIIVTPLPVPIDPCDPSPCG---PNSNCRTHDGHAVCLCQPGFSGVPPTCRPGCIVSSECSQNRACINNKCADPCPGSCGQNTNCLTVNHNPICSCASGYSGDPFVH--CTRISTTSPSPKGEGDPCLPNPCGP---------------NSQCRVIGSHPACSCLQNYIGRPPNCRPECTDNSECFNTAAC-------------INQ-------RCKNPCPGACGEIAKCTVQNHVPICTCPEGYEGDPTVRC--------------VLASPPD-----RTVSNPCSPNPCGPNAQCRERNGAGACGCPPDLIGDPYDIIKGCHRECETNNDCAPQLACVGFKCTDPCPNTCGTLSICNVQAHVPVCLCPPGYTGDPYFACEIEEMIKTLEPCSPSPCGPNSKCRVVNDQAVCTCLPEYRGIPPS--CRP--ECIVNAECPLHLACINKKCVDPCPNICGLKAQCITKNHNPICTCPAGFTGDPFTFCSPHVITEIPITERPPSCTPSPCGPNSLCQIISGNPACSCLPNYIGVPPQCRPECILSTECKSHLACVNQRCADPC--PGSCGINAQCHVLNHLPVCTCMEGFTGDPFTQCSIIPLGKNIEQLTESPSTDPCALSPCGPNAICDNGDCRCLPEYIGNPYEACRPECILNSECARDKTCLKNKCKDPC--PGICGQNAQCDIVNHIPVCSCPSGYIGDPFVSCRVQPR--VPDS--------RKDPC-----TPSPCGPNSQCRNVEDHAVCS----CLQGYLGSPPSCRPECLVSSECPPMRACVNKKCTDPCLGS-CGLNARCEVINHSPICSCLPGQTGDP--FRSCYDIP-----NISVPPEPKDRGDPCNP-----SPCGPNALCQNTNGQPSC----SCLPTYIGTPPSCRPECLINPDCPPEKSCINMKCKDPCPGSCGDNAECKVVNHAVTCSCKLGYTGNPFVQCVLEEEPMNPCEPSPCGANAICQQRDNAGACICIDDYQGNPYEGCQPE---CVLSADCSTNKACVRNKCKDPCPGVCGVRAQCSVINHIPTCTCEPGYIGDPFTTCTLQPEVDTEPTVRNPCSPSPCGPNSLCRAVNNQAVCTCQESFVGVPPNCKPECVVNSECPQNRACYKYKCTDPC---PGTCGIEANCRVINHNPLCSCPQGKTGDPFSRCFPEPVVPLPPVDPCFPSPCGLYAEC-KVVNNQAACTCLKN-YIGIPPNCRAECVVNTDCPSDQACISEKCRDPCIGSCGQNADCRVQNHIPVCLCQL---GYSGDPFTLCTVIREQPKIPEDLCSPSPCGPNAECNEGVCRCLPNYFGDPYSYC-RPECTMNSDCPRVKTCINQNCVDPCPDT--CGRDARCDVVNHVPMCSCPPGYTGNPFLLCRPHIPDDTIKQPCIPSPCGPNSICKVVNDHAVCSCQPGLISSP------PTCKPECVISADCPLTQACLNNKCQDPC--PGTCGQNTNCQVVNHNPICSCSESYTGDPFTICYPQP--KTPP--------------------------ALMNPCLPSPCGPNAECQVRGDNPACSCIENYV------GLPPNCRPECTINPECPPQLACMQQKCRDPCVGLCGPNAQ-CSVVNHHAICTCINGYTGNPFSACEQKINAPLDIRKPCEPSPCGINAVCRENNGVGSCTCLPDYLGDPYQEC-RPECTQNSDCLTRMAC--------------------VNLKC----RDPC-PGTCGVNAQCQSVNHLPICICIPGYTGNPFTLCSPIVEILQPETNSCSPSPCGPNSKCR-DINGLAVCTCLPNFIGS-SPNCRAECVMNSQCSQDLACINQKCISPCPDPCGINTQCRVIGHSPICICNLGYTGDPFTRCFPAPHFPVVSKDPCLSSPCGIYAECRNIGNTPSCSCLPTYRGSPPNCRPECRVNSECPMNLACNNERCRDPCLGSCSITSLCTVYNHIPVCTCPEGFTGDPFTNCYLRPTTAPAVIDPCNLNPCGPNARCNNGICICLPEYQGDPYVGCRPECVMNTDCAHDRACMRNKCIDPCPGTCGRNALCSVYNHVPMCTCPTGMAGNAFVQCSIVEDIPKRDSCSPSPCGPNSVCRENNGQPVCSCVAGFLGVPPACRPECTVSSECILTEACSNQKCINPCLGACGIQATCQVINHNPICSC-GELTGDPFVRCIPRPPKPVLQTNPCVPSPCGANAECRVV-GDAPSCSCLAGFLGLPPY-CKPECISNSECPAHLACMNQKCRNPCEGSCGANAECRVVSHTPMCVCPSDFTGDPFTQCTMKPPTPLPLSPCKPSPCGFNAICKEQF-GVGSCSCLPDYIGNPYEGCRPECVVDTDCISILACVQSKCRDPCPGVCGQFAECQ----------------------------------------VINHRPSCTCISGYSGNPFQYCTVIRDVGTNIFLNTCNPSPCGPNSQCRVNNNQAVCSCLPIFIGNP-PACRPECVTSSDCSLNLACLNQKCQDPCP--GSCGRNSNCRV-IKHNPICSCKNGFTGDPFTVCFQIPVSPPVVSDVTRDPCIPSPCGMFSECRDIGGVPSCSCLPTYRGSPPNCKPECTINAECSANMACMQQRCKDPC-PGSCGIMAECSVINHVPICSCLPDYTGDPFIECSVKPRKIPHPPSKPDPCTPSPCGPNTQC----NGGICVCIAEYFGDPYSGCRPECVLNNDCLNTRACVRNKCVDPCPGVCGQNAMCDVYNHVPMCTCPSGMDGNAFVLCSPVPAPPISNPCNPSPCGPNSQCRENNMQAVCSCISGFIGAPPT-CRPECVISSDCPKNEAC-TNQKCQDPCPGSCGRNTICNVINHNPVCVCRSGMTGDPFINLSQLILIGITFKAEDP-------LPVLNPCQPSPCGPNAQCQVINDQASCSCLQEFIGSPPN--CRSECNSNSECSNKMACINQKCRDPCINACGINAVCNVVSHTPMCACTPGYTGDPFT------------------QCSPQQFDIQPSISTPCTPSPCGANAVCRVQQNAGSCSCSTDYIGNPYEGC----RPECTLNSDCPSNQACIGLKCKDPCPG-TCGQNAQCYVINHAPTCTCFEQYTGNPFIFCNL----------IVEAPIIADNINPCQPSPCGPYSQCRESNGQAVCSCLPTYIGAP-PGCKP-ECTVSTDCATNRACENNKCVDPCPNSCGQGTTCRVVNHSPICICKPGFSGDPFI--------------RCLFVPPTPSYLPSLPSD---PCI-PSPCGSNSQCRNINGYP----SCSCMINYIGTPPNCRPECV-----------IPADCPSNQACIREKCQDPCPGS--CGLNADCTVHNHIPICRCIESYTGDPFIGCQPIPI--------------YNEPIQPTDPCNK--SPCGPNAQCN----NGICICLPEYFGDPYVGCRP-ECVLSTDCSTDKACIRNKCVDPC-PGTCGQNSLCNVINHTPMCSCPPGTSGNAFISCDVI----------------RVPSVTRPCSPNPCGPNSICRELNEQAVCTCAPEFLG--------APPLCRPECTLSSDCRPNEACANQ-KCKNPC--PGTCGIQAKCVVVNHNP----VCSCP-ERYTGD--------PFIRCDIMKP-------IAPVVINPCQPSPCGPYAQCQVVNDLPSCSCLPEYRGSPPYC--RPECISNHECPSHQSCVRQKCRDPC--PGLCGENAECHVIQHVPHCVCTYGLTGDPYTRCSAIP----------RPIELEPISSPC-VNFECGANAICKERDSVAICQCISSYVGNPYLACRP----------ECIINPDCASNLMCVRNKCTNPCAGM--CGRNAECSVVNHQP----ICTCLPGYTGDSFISCFI---DKIISDENVCAPSPCGPNSKCKEVSGQAVCSCLPSYVGTPPACRPECVASSECSPQLVCKDYKCVNPCPSPCGLNTNCVVVNHSPICSCMSGYSGDPFTICSLIPLITPPLVQK-DPCVP-----------SPCGSFSQCRNIGDSPACTCLENYIGQPPNCR------------------------PECTIHSECPSDKACINMKCVDPCPGSCGTNALCSVINHIPTCRCPEGYTGNTFVLCEILPAISKRYEPSTTPSPVEDACVP------SPCGPNAQC----FDGICTCLPEFRGDPNVGCRP-ECVLNADCPRDRACIRNKCLDPCP--GACAVNALCTVIGHIPMCSCPGNMTGNAFSQCTPLQDIPLANPCTPSPCGPNSECRVINNQAVCSCIRGYLGSPPTCRPECIVSTDCPQNEACSNQKCTNPCLGS--CGLGASCQVVNHNPI----CICPPSQTGDPFVRC---YLSPPQIPVSLTPCKPNPCGPNSQCQPRGDESVCTCLPDFIGSPPNC---------------------------------RAECVSNSECSNHLAC--INKKCRDPCIGS-CGANANCHVVSHTPMCSCINDYTGDPFTQCT-LREPTPLPPAPID 9072          

HSP 4 Score: 1659.43 bits (4296), Expect = 0.000e+0
Identity = 1899/6573 (28.89%), Postives = 2592/6573 (39.43%), Query Frame = 0
Query:  113 TNECKYRPCDVFGYCTNTLGSFFCSCNEGY-EGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGD-------------GKVECRDIDECLTNQ--------VCGINTLCINTHGNFSCECLPGFHGNPHDGCVD-IDECRTNP-CGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKV-------------RTTCSSDFDCTN--------NAQCLP-----NGSCACRKGFQ--PNGVL--------CQDIDECQSTEN------------------PCGANSICLNVPGDYECQCIAPLVGTPPE-----QP-----------------------------CRDPCLEVNCGQRASCQ---IVKSEAFCICEEGWAYNPKEIS------SGCLDIDECDKS---------------ISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIG----------CFDIDECAENR------------------FICGREALCTNQVGSYSCQCYNGGQY--DPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSP-NGRSCIDIDECAGNPCGQDAIC-ENLLGSFVCKCPKGTNGDP-LSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQD-----IEGRCQ-----LADCSN------------CEAPAKCVQ----ITGG-ISYCACPRGYEMNPRTKNCEDIDECQA--IGHTPCGSGADCLNNPGSFSCSCPPGQGGDPF-QGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNP------------------------PQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCI--------VSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCD--PNRLSCTCQSGFLGDPTLV-CMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLK-CGDNAVCSFASGKPECTCKRGYDGIPYERCQD--------------------VDEC-LFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICNLGQCLCASGFKGDDPNDLV------------------------EGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCL--DPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCIC-------PQGLFVG--------NPQI---------EGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNE-ICGENALCTVAGHQHKCQCPPSF--------------------------------IPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTET-CGPNALCSPEFEN-LCQCPEGFAGVPTAAQGCVRIP-PTCTT--DCPASSLCFNGYCMPECTSHGQCARGEQCSN-GMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCR---------------LGEVCGAGGQCSC----------QPGYEMTQSGCSD-LNECKNNI-CGAGKTCANTPGSYICSCPTNQVPDE-------SGACRSPDQCSSDQDCNDAL---------ACLADSLSGAKKCLDPCDI-SYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGF---CGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLECVENADCDASKSCLN-NKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPR-ECEQNLD------CPGDGKC----DNFVCV-------KPHEKSCLVDIN-CNDDQVCSRSECKDPCQQP----------------------------NACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINE---------RCDEGKCLL-----TCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINH--QCQDPCKAAQ--CGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSD--CEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCS-CPEGMEGNPIEHCQPTLVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCN----EGLCVQICNSNTQCQ---AGLVC--IDRQCV-GGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEG------VCISGCGSNRDCPYGEMCEGGQCRNPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQ-ECVVDRNDCLLPNQCGENAQCLNQLGGF-DCVCRSG----------------------------CTGDPFQGCQCP-----TPKDSCRTK-GACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICT-------------------------------KDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEES-------CGTTACGPNMACQELYGQPVCECIPGFVPKYP-------------VSLGCVEPA-DDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRP----------------------------------LPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYY---------------------------QCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPP-----PKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPY-CRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSP--NPPEPLETDPC--SACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAEC----SEPI-----------------------------DPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPF---VSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEII---DPCANRECGPYSQKVERNGICTCSCLPGYVGAPPDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPCET---CGQHAICHIHNNIAACKCEDNYIDKPPNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQPI---------DPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRCIPAGCRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQYECKRHEECPSTLACRDFKCVDPC--DCAVGANCRVSNHKTTCTCPPGFTGDPY-SRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFLFIGDFECKAPE-RPECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQKAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQYECLVDSDCPYTLACPNRECIDPCQ--CAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTS---NGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYV------------------------------------SCLEIVTG--------CKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMREC----------------------------------------HQY---ECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQVECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQC-------------------PIGM---------------FVGNGGSCIAAPSLVG--------CESSSKCKADQACLNAKCVSPCN--CGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCSTFECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEP-------------------------------------VEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILG----------------------------------------CVKDDECPKDSACINRMCKDPC--DCGRGAECFLTGHRPVCRCPEGTKGNPLIEC--TPIGCQSDNECQDPDVCAPNGNC-------------------VPACLLQSPCGSNAECY----------GLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPCACGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKTCPAGSGLILNEFEECVCPPGFVLDSQGICAPCRFDVGFIIENGRCICDYTKGFVLDLSGKKCVCPENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPI 5748
             N C   PC    YC     + +C C  G+ EG    C  + +C        C   A+C        CKC  GF G+              ++ C +   C++ +        +CGI  +C        C C P F GNP   C+  I     +P CG  A C   L   +C C  G SG+PY G C  Q      +  C+   CG++A C    N + C C  GF G+P I C DINEC  ++   CG  A+CIN    Y C C  G+ G+    C+ V+V                C  D+ C N        + +C P     NG C C  G+   PN +         C +  EC+  E                    CG N++C+       C CI    G P       QP                             C +PC +V CG    C+   +V   A C C++G+ +NP + S        C+  D+C  S               +     C  N+ C        C C  G+ G+P             C    ECAE++                    CG  ALC       +C+C   GQY  DP+  +   +   C  + +C    +C           +   C DAC +  C  N+ C+ ++    CQC PG + +P     C+ ++ C  + C   A+C    + + VC+CP    GDP ++GC+ E    C+    C     C   RC+                N C   N CG N+ C+ +     C+C   F  +       C   +  C    Q      I+G+C+     +ADCS+            C A ++C+     ++GG I  C   R  +  P T++C + ++CQ        CG  A C     + +C+CP G  G+P  +  C+ + + C +   C     C+ G C C      +   G  CK+      C  ++ C P                            +C C  GF   P   C D++EC   PC   + CIN   +Y+C CP GT GDP   GC       C    +C    AC+   C +PCS V CG N  C   +HAA C+C+ G+  D+ G     C +V C SN+ C         ++     C       GN     H S+  C S    +  G  C     + +C Q  C  +A C       +C C  G +GDP    C  P        +C T+S C    PNS AC      NP            CD+   CG NA C      P C C     G P   C                      VD C L +VCG  A C +      C C     G+P  GC  L+    D       QC   ++CN G C    G   D   D +                          C     C ++ DC  +E C    + G   C   C    CG N+ C  D+H  +C C+ GF G+A D + GCQ  E C  N+DC   + C  +      CL  +PC +     N  C     + +C C  G+                        H+C  + +        C  V C  GA C +      C C PG  G+P + SGC      +C  + +C  +  C   N    C   C+ + CG  A CV  NH   C C       P  L VG        + QI         EG  + SC  +E+C  ++ C  L+  C+DPC     CG NA C V  H  +C CPP F                                +P  T +  C  N++   C  G C  TC   + C  G +C + +C+ GC ++  C     C+  KC +PC  T CGPNA C+   +   C C  GF   PTA   C+R P P C    DC   + C  G C P C+S   C   E+C N G+C  LC  D++C  GEIC    C  GCR D +C+               L   CG   +C+            P     +  C      C + + C  G+TC        C    N + DE          C S D C ++Q C++ +          C +D      +C  PCD    C   A C V+ H A CSCP  + G   N  I C +   PC+G                C C D      ++C   ++C+ G  CH S KC   +      C  G V D    G      C ++S+C S   C NG+C +PC      CGI A C V +H   C C   ++G P  +C  LEC  + DC+ +K C     C + C   G+CG N++CR+ N    CSC  GH G+P+  C++  D      C  + KC    + F C         PH+  C  D + C D +    + C+    QP                            N CG NA C       VC CPPG +G+  +EC      C  D  CP    C    C+  C     C IN          RC   +C +      C  D+ C   +        +GCS+  DCP S SC +   +C+DPC +++  C  N  CQV   +  CVC+ GF+ N    + C  + +TC  +  CP N  C    C+  C   +   C A++ C     + VC     C              C  D  C+ D AC N +C+                    DPC  S C A+A C  + H+ +C  CP G   +    C    V C++ +DCP    C    CV  C L   C   E C+      +CV++ ++  +C     G+ C      C+  GC+SN  CP    C+   CQ+PC    + C E A C   NH   C C  G  G+ +  C  + L    TKN C    +C      K C+               C+  C +  DC + A+C+         C+ G   N   P+    E     +PC    C  N+ C+ +  NP+C C +G        C                 EG +C     E N CG N+ CR+ + + +C C  G+ G+     C +    C  P+ CG N +C     GF  C C SG                            C       C CP      P  SC  +     +PC L   CGK AIC  ++  A C C   + GNP +      GC+A           EC  + +C  +  C    C DPC    C  N  C    H P C+C    L    G+     +  + L  DQ             NPC  + C     C+V+N +A+C C+                                DPC    CG  A C+ +  N IC CP    GDP   CVKEE        C  + CGPN  C+     P+C CI G     P              SL C++    DPC  S CG   NC V+ ++  C C  G  GDPF  C  V    +  C PSPCG+ A C         C+C   Y G+P  GC PEC  + DC   ++C N KC+DPC G CGI A C+V  H+P+C C  GY GDP   C +   P  P                                      P+C  + DC     C +  C DPC   CG+NADCRV NH   C C  G+ GDP++                           QC V      CSC P Y G  PNCRPECVI E CP +  C   QCVDPC  +CG    C VVKH P+C C +G TG+P+  C  IV  P     P+ PC PSPCGANAVC        C CLP + GDP   CRPEC+ + +C   K C   KC++PC   CG +A C   NH  +C C     GDP + C+     P P+  DPC  S CG N++C    +   +C C   + G P   CRP C+ +++C  ++AC+ NKC DPC G+CG N  C      PI                             DPC PNPCG NS C   +     C C  +YIG PPNCRPECT++S C N   C+ ++C +PCPG CG  A+C                                         V  H P+CTC EG+ GDP    C+           PC PNPCG NA+C E+N +G+C C  D +GDP+     C  EC  N+DC   LAC+  KC DPC +   CG  ++CNV   H   C C   Y GDP   C         EE+I   +PC+   CGP S+    N    C+CLP Y G PP C+P C+VN++CP HLACIN  CVDPC  N+CG    C  K+H   C C  G+ G+P   C+      I   ER P  T   CG +++C I +   AC C  NYI  PP CR EC+L  +C  HLAC+  +CA PC   CG NA C V+NH P+C C+  + GDP  +C    + + I         DPC  +PCG N        N  C CLP + G+PY  C  EC+++ +C  ++ C  N +C +PC G CG  A C+++ H  +CSCP    GDPF+      CR     P +        +DPC    CG N++C      + C CL+G+ G+P     + EC    ECP   AC + KC DPC   C + A C V NH   C+C PG TGDP+ S  D P    ++V  E                 DPC  +PC   A C     +  C+C   ++         P  RPEC+ +P+CP   +CI+ +C DPC   +CG NA+C V  H   C+C+L Y G+P+            +C L E  +N     PC    CG NA C    +   C C+  Y+GNPYE C Q EC++ +DC    AC   +C DPC   C   A+CSV NH  +CTC PG+ G+ +T   +  L+P V+                 +   +NPC    PCG +S+C+  +        C C+  +     N   EC+            + +CP ++ C    C +PC     C   A C V +H   C+CP G TGDP+                                     +CL+   G        C  + +C   +AC +  C++PC      CGQ A+C   NH  VC C + + G+P   C                                        + Y   EC  ++DCP  K CI+  CVDPC +T CG+ A C    H+  C CPPG  GNP + C               +  +   T +  C    C   +IC+  N    C CQP L+          P   +  C I  DCP   AC++  +CQ+PC     C  +  CQV++ +P    +C C                   P  M                 G+  +C    + VG        C  + +C    AC+  KC  PC   CG  A C V+NH  IC C   Y+GNP  ACE             Q+    L +      + CGINA C   +   +C C P Y GDP+ +C   EC  N +C     C+  +C DPC     CG NAQC+   H+  C C PG  G+P   CSP   + +P                                       AEC ++S C+  LACI+Q C +PC   DPC  +  C V+   P    IC C +G+  D    C   P   ++                                         C  + ECP + AC N  C+DPC   C   + C +  H PVC CPEG  G+P   C   P    +  +  + + C PN  C                    P C++ + C  +  C             G  ALC    HV         +C CP G   N   QC     IV      D C             P  CGPN+VC   N +PVC+C  GF G P     E  C  +SEC  T  C N  C     P    CG  A CQ +NH  +C+C   L G+P+V C            P +  +     +PC +   C   A+C V      C+C  G+ G     CK     C+ +S+CP+  AC+++ C+NPC  +  CG NA+C V+   P+    CVC   + GD   QCT                   + PP  +  S    +PC F+          IC    G         C C  ++  N    C   PEC VD +C     C      C DPC    CG FA     +HR  C CI GY+G+P   CT I
Sbjct: 1254 VNPCDNVPCGPNAYCEPDKHAAWCRCVIGFTEGKNNEC--VSQCD----GFVCGTGAQCIVSYDGPTCKCIEGFMGNPFPGGQCVPDVCSSEIPCAEPSVCISGRCKRRCEGVICGIGAMCDPLTN--KCVCNPYFVGNPDLLCMPPIQPPHCDPFCGKNAHCEYGLQESKCICNPGTSGNPYHG-CGVQ-----EKSDCSTAVCGKDAHCNAGPNAVECLCPSGFAGNPYIQCFDINECNGNA---CGSNAVCINTLGSYDCRCKDGFFGNPFVGCQQVQVGPCADPSTCICSNTAPCPFDYICVNHKCINQCSDIKCGPRSVCQNGVCVCPPGYSGNPNDLHKGCHLHGHCLNDLECEPQEICFQVGKGVRKCVDACSKLQCGPNALCITQNHVSSCLCIDGYQGNPSNLIEGCQPSKSVIPGCVHDSDCPAGAFCITLDGGVHDCVNPCNKVVCGAYQKCEPDLVVPGHATCKCQDGYEWNPIQSSCEKPSVPDCITDDDCHSSEGCRPDALGVLKCVSLCDGFTCTANSRCIMENHHGRCDCLPGYIGNPNDRRGCHSPRENRCSTDSECAEDQTCRSTPDGPLACQLVCDFITCGPNALCVVNNHVANCEC-PPGQYAGDPNDSTSGCRAVPCVYNIDCPPAQLCNR---------LTHTCYDACDENACGVNAVCITEDHKAICQCPPGLRPNPVPDVECVAVEACHPDSCHPTALCVAGPMNNPVCQCPPNHVGDPYVNGCQPEG--HCSSPKDCPVHSVCHEHRCI----------------NPC--ENACGPNAFCEIVNDQPSCKCIHRFVPSSSGPEHGCVRGTNYCTVDTQCEDSYCIDGQCRAVCRSVADCSDGEKCINNKCMVSCIAHSQCLVDHACVSGGCILGC---RSNKNCPITESCIN-NKCQDPCSRKDVCGPNAICSCTNHAITCTCPLGFHGNPTPEQGCVRVPNVCQTPQDCPSQHLCVSGLCQCQCSEQNNCAQGERCKNGICVKICYGDSNCLPGELCIDGACEAGCTSDVGCKRDEVCINSKCRCSHGFIAGP-EHCLDINECDDQPCHPSAECINLHGSYRCTCPSGTAGDPIGLGCVLPH--HCTTHKDCSDSQACVQHNCSDPCSFVDCGLNTICSVLDHAAGCQCQPGYIGDASG-----CFKVECLSNSDCPTDKYCNQEINKCSSPCNQVNCGYGNCLAIDHVSVCKCYSGF--VLIGDICAD---VNECLQNPCHSSAICQNAEGSFACVCPHGLVGDPFKTGCKQP-------GDCFTDSDC----PNSAACIDNRCTNP------------CDAPGICGRNAECLARDHVPICRCPGQTTGNPATECIHLECNYHSDCSPSDACFDHKCVDPCSLLNVCGHGADCSSLNHSAVCTCQPGGTGDPNLGCTPLQYCKSD------SQCATGSVCNGGICTALCGSTRDCIGDQLCINGLCQPTCRSNSSCPEYQYCHNNICVQELRCTSDNDCSDDEKC-IKNNIGQAECHRACDVILCGRNAECKADDHAATCSCKHGFFGNAKDDKIGCQPIE-CEVNDDCTQEKICD-SHRCRIACLAHNPCGV-----NAICTTEKHVQVCTCQPGYTGEPT-------------------HACKLIDY--------CANVPCAPGALCENTRGHFKCHCQPGTVGDPYN-SGCQ--PPVECLQDVDCPLTAKCVNINNVPKCFDTCARIRCGPNADCVASNHAANCQCRADYEGDPNNLSVGCRPRPVVCSSQIDCLVNTYCYEGICRPSCQSDEECNLSDVC--LNGQCLDPCDVRGTCGINAECKVRSHIKQCSCPPGFTGNSEVECVRLPVSCLGSGDCNGDNTCRENVCLPVCTVDNDCALNEK---CIRGNCLLTCRLDNDCFLGHVCLNNMCSFGCRADEDCNANEACLENKCVNPCEATPCGPNAKCTVFNQRATCSCSTGFIPNPTAKVACLRTPGPICQANRDCVVGTSCIAGVCTPVCSSSANCLSNERCDNSGICKSLCRRDEDCRSGEICEGLVCISGCRADIECQDSYECINNQCIDSCSLTSACGVNAKCTIVNHQKICTCPSPLVGDARISCKQTFLPCSSELECLPGQTCYGKSCYSTCRSDANCLSDERCDGGICKTICNSDDHCLANQICHNRMCDIGCRSDNTCPSDESCINNQCRSPCDGGKACGECAGCRVVNHVAQCSCPANYYG---NALINCAKTMTPCDGL---------------CEC-DEIGFCTTSCHHQNDCSCGEVCH-SGKC-RIKCDINNACPKGYVCD----GGLCLIGCRTHSDCPSSLSCTNGQCENPCSAQGSPCGINALCRVSSHRAVCLCPEGYQGEPSQECYQLECHHDDDCELNKHCSEYGVCTNPCLQHGVCGFNAQCRVINRKAQCSCPPGHFGNPKINCKKGGDECLRRPCGINAKCRETLNGFECTCDPGCHGDPHQ-VCFCDGDLCKDTRCGINAACRIYKNQPQCYCPPNNPSGDPMHACSSDRDLGDCRTNGCGKNAECIRDGAIFVCRCPPGTSGSPDIECT-TERECTSDLECPNEKACINLQCLDPCALRGACGINALCRVVLHKPRCSCPQCYIGMPHTACHPDSKCDTLNP--KPTPSIGCSSDYDCPESLSCHSQTGECRDPCLSSRYTCEVNKRCQVRNHKPMCVCKYGFVVNEIGELTCAPDTLTCSRDFDCPSNTACVNGKCQNPCNVRNKRPCPADKTCDVLDHRPVCICTKNCNPS--------LSICLRDSGCSPDLACRNYRCV--------------------DPCRNSTCPADAPCYVEEHKPICKFCPPGFVPDTKYGCMKD-VKCTTHNDCPIQLACVNHQCVNPCTLGNPCDFIEACHVQYHRPVCVKVESNEAECPYCPPGMQCDPATNTCIKAGCTSNKDCPLTEACIGHACQEPCLVR-NPCAEHAVCINTNHGADCSCEEGYHGNGFSYC--DLLE--ETKNICQYNEDCPPN---KYCDRLNR----------QCINPC-VEFDCGDNAKCVSSNHQAQCTCLPGYQGN---PHIGCQEIVLTVDPCIPNPCGLNALCENDNGNPVCFCPKGLTGSPFEQCIP---------------EGDQC-----EGNPCGANSGCRVVSGQVKCFCLPGYEGHPPNFPCTLPSTSCD-PSPCGPNTRCSVLDNGFAKCTCLSGYIESPNTIRGCVPKADQCEFNPCGFGARCNSTRVPPCYCPDLTIGNPYKSCGVRPEKPYDPC-LLSPCGKNAICTAIDGIAKCTCIPPFVGNPYI-----DGCEA-----------ECIINRDCESHLACFNQHCRDPCPG-VCGANAHCEVVDHLPMCSC----LPGYTGDPFRACKVEKPLVPDQ-------------NPCMPSPCGPHSICRVMNDRAVCSCSPGYQGTPPHCRPECLVSTECPAHLACIDQKCNDPCP-GLCGLNADCQVINHNPICSCPRQYAGDPFTQCVKEEPLPPTTNPCLPSPCGPNADCRVQEDHPICTCISGMFGAPPNCRPECVIDQDCISSLACIQKKCLDPCVGS-CGFNTNCTVLNHRPICHCYEGYEGDPFSGCAKVVFPVQLPCDPSPCGTNAVCK-ERNGAGSCTCLPDYTGDPYEGCRPECVQNSDCAHTKACINNKCKDPCVGACGINAQCQVYNHQPSCSCLSGYTGDPLTSCHIPIKPSTPGDTCQPSPCGPYSNCRVIDNHAVCSCQPNYIGSPPSCRPECVVSTDCSPNTACINQRCKDPCLGTCGVNADCRVINHNPVCICAIGYSGDPFFGCVKEEITPLPKPSGNPCVPSPCGPNSQCRVIDGFPACSCLPNYVGRAPNCRPECVINEGCPGNLACQNEQCVDPCPGSCGVNTYCNVVKHNPVCICNEGYTGDPFTECTPIVEAPITTEQPRTPCNPSPCGANAVCNERNEVGSCTCLPQYFGDPYIACRPECVTNTDCDRSKACLNNKCVNPCPGTCGQDATCRVVNHAPMCSCLPGYTGDPVNGCTIIIVTPLPVPIDPCDPSPCGPNSNCRTH-DGHAVCLCQPGFSGVPPT-CRPGCIVSSECSQNRACINNKCADPCPGSCGQNTNCLTVNHNPICSCASGYSGDPFVHCTRISTTSPSPKGEGDPCLPNPCGPNSQCRV-IGSHPACSCLQNYIGRPPNCRPECTDNSECFNTAACINQRCKNPCPGACGEIAKCT----------------------------------------VQNHVPICTCPEGYEGDPTVR-CVLASPPDRTVSNPCSPNPCGPNAQCRERNGAGACGCPPDLIGDPYDIIKGCHRECETNNDCAPQLACVGFKCTDPCPN--TCGTLSICNVQA-HVPVCLCPPGYTGDPYFACE-------IEEMIKTLEPCSPSPCGPNSKCRVVNDQAVCTCLPEYRGIPPSCRPECIVNAECPLHLACINKKCVDPC-PNICGLKAQCITKNHNPICTCPAGFTGDPFTFCSPHVITEIPITERPPSCTPSPCGPNSLCQIISGNPACSCLPNYIGVPPQCRPECILSTECKSHLACVNQRCADPCPGSCGINAQCHVLNHLPVCTCMEGFTGDPFTQCSIIPLGKNIEQLTESPSTDPCALSPCGPNA----ICDNGDCRCLPEYIGNPYEACRPECILNSECARDKTCLKN-KCKDPCPGICGQNAQCDIVNHIPVCSCPSGYIGDPFV-----SCRVQPRVPDSR-------KDPCTPSPCGPNSQCRNVEDHAVCSCLQGYLGSPPS--CRPECLVSSECPPMRACVNKKCTDPCLGSCGLNARCEVINHSPICSCLPGQTGDPFRSCYDIPN---ISVPPEPKDR------------GDPCNPSPCGPNALCQNTNGQPSCSCLPTYIG------TPPSCRPECLINPDCPPEKSCINMKCKDPCPG-SCGDNAECKVVNHAVTCSCKLGYTGNPFV-----------QCVLEEEPMN-----PCEPSPCGANAICQQRDNAGACICIDDYQGNPYEGC-QPECVLSADCSTNKACVRNKCKDPCPGVCGVRAQCSVINHIPTCTCEPGYIGDPFT---TCTLQPEVDT----------------EPTVRNPC-SPSPCGPNSLCRAVN----NQAVCTCQESFVGVPPNCKPECV-----------VNSECPQNRACYKYKCTDPCPGT--CGIEANCRVINHNPLCSCPQGKTGDPFSRCFPEPVVPLPPVDPCFPSPCGLYAECKVVNNQAACTCLKNYIGIPPNCRAECVVNTDCPSDQACISEKCRDPC---IGSCGQNADCRVQNHIPVCLCQLGYSGDPFTLCTVIREQPKIPEDLCSPSPCGPNAECNEGVCRCLPNYFGDPYSYCRPECTMNSDCPRVKTCINQNCVDPCPDT-CGRDARCDVVNHVPMCSCPPGYTGNPFLLC---------------RPHIPDDTIKQPCIPSPCGPNSICKVVNDHAVCSCQPGLIS--------SPPTCKPECVISADCPLTQACLNN-KCQDPC--PGTCGQNTNCQVVNHNP----ICSCSESYTGDPFTICYPQPKTPPALMNPCLPSPCGPNAECQVRGDNPACSCIENYVGLPPNCRPECTINPECPPQLACMQQKCRDPCVGLCGPNAQCSVVNHHAICTCINGYTGNPFSACE-------------QKINAPLDIRKPCEPSPCGINAVCRENNGVGSCTCLPDYLGDPYQECRP-ECTQNSDCLTRMACVNLKCRDPCPGT--CGVNAQCQSVNHLPICICIPGYTGNPFTLCSPIVEILQPETNSCSPSPCGPNSKCRDINGLAVCTCLPNFIGSSPNCRAECVMNSQCSQDLACINQKCISPCP--DPCGINTQCRVIGHSP----ICICNLGYTGDPFTRCFPAPHFPVVSKDPCLSSPCGIYAECRNIGNTPSCSCLPTYRGSPPNCRPECRVNSECPMNLACNNERCRDPCLGSCSITSLCTVYNHIPVCTCPEGFTGDPFTNCYLRPTTAPAVIDPCNLNPCGPNARCNNGICICLPEYQGDPYVGCRPECVMNTDCAHDRACMRNKCIDPCPGTCGRNALCSVYNHVP--------MCTCPTGMAGNAFVQCS----IVEDIPKRDSCS------------PSPCGPNSVCRENNGQPVCSCVAGFLGVPPACRPE--CTVSSECILTEACSNQKCI---NPCLGACGIQATCQVINHNPICSCG-ELTGDPFVRCIP---------RPPKPVLQT---NPC-VPSPCGANAECRVVGDAPSCSCLAGFLGLPP-YCKP---ECISNSECPAHLACMNQKCRNPCEGS--CGANAECRVVSHTPM----CVCPSDFTGDPFTQCT-------------------MKPPTPLPLSPCKPSPCGFNA---------ICKEQFGV------GSCSCLPDYIGNPYEGCR--PECVVDTDCISILAC--VQSKCRDPCPGV-CGQFAECQVINHRPSCTCISGYSGNPFQYCTVI 7253          

HSP 5 Score: 1628.61 bits (4216), Expect = 0.000e+0
Identity = 1941/6875 (28.23%), Postives = 2634/6875 (38.31%), Query Frame = 0
Query:  135 FCSCNEGYEGDGF-HCKDIDECQI-------PELANTCVQNAECCNLPAHYVCKCKPGFEG---DGKVECRDIDECLTNQVCGINTLCIN------------THGNFS--CECLPGFHGNPHDGCVDI--------DECRTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQ--GACQAQV------APSVSQQGCN-----AQSCGQNALCQRSSNGLICTCREGFTGDPKISCV---DINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNN-------------AQCLP---NGSCACRKGF--------QPNGVLCQDIDECQS--TENPCGANSICLNVPGDYECQCIAPLVGTPPE-------------------QPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPK---EISSGCLDIDECDKSIS----PTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGC----FDIDECAENRF------------ICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQE------CIGNAVCFN----GACNCQEPYVG--PNCEDACRDAT--------------------CFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDI-------------DECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRC-----------------------VCRRGYERNPAGDCVDLNECL---LGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNC--EDIDECQAIGH----TPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNP-PQCLCKAGFTGNPLTGC--------EDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCV----------SLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYP--GGHCSLLS-CSSASPCLEQG------QTC-QGGRC-------------------------------ITQ-CGQEQCGVNAFCDP--NRLSCTCQSGFLGDP---------------TLVCMPPTQQAECSSECGTNSHCIYGNPNS-CACNIGYFGNPYTGC-----EVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIP--------------------YERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVH-LEAVTEDDDLCANQQCGPNAICN----LGQCLCASGFKGDDPNDLVEGCSSAATCQTNT-------------DCGYNEICSTIAH----------SGHRFC------------SDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGL-------------------------------------------FVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPE-VLCEKNDRGDLCPFGQC--QTTCASSS-----QCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFEN-LCQCPEGFAG-----VPTAAQGCVRIPPTCTTDCPASSLC--------------FNG---YCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGFCGIGAKCVVKNHSP----------------------------------------------------KCSCLPRWRGNPKIKCELLECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPR-ECEQN----------------LDCPGDGKCDNFVCV-------KPH---EKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFI-------------------PNPSPVV-ACTREP---------ITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNE---------------------GLCVQI--------------CNSNTQC-----QAGLVCIDRQ------CVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSC-----RTNYLRCGSTK----NQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECI----EGVCISGCGSNRDC------------------------PYGEMCEGGQCRNPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLL----PNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLN-----PCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQF----------------------------GCKARPEVEAEST--GRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLL-------------------------INSAGELICPQQDV--------------------QCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICTKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCV------KEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPV-SLGCVEPAD-------------DPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQ--PVEETP---KDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQC----VVDRVPKPPIRP-------------------------------------LPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCI-----------------------VRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQII--VRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCS---PNPPEPLETDPC--SACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECS----------------------EPID---------PCQPNPCGLNSVCESNVNGLALCRCQND--YIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENE---VTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPP-DCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPC--ETCGQHAICHIHNNIAACKCEDNYIDKPPNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQP--IDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRCIPA------------------------------------------------GCRSD----SECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQY------------------------------------------------ECKRHEECPSTLACRDFKCVDPCD--CAVGANCRVSNHKTTCTCPPGFTGDPY--------SRDDPPRP----------PILT------------------VG--------CEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFLFIGDFECKAPERPECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQKAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECR---QYECLVDSDCPYTLACPNRECIDPCQCAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVE-------------------------------PIEF---------GCQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSCLEIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQVECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMF-------------------------------------VGNGGSCIAAPSLVG--------CESSSKCKADQACLNAKCVSPC--NCGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCSTFECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSP---------------------------------------QPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTD--------------------------------TILG--------CVKDDECPKDSACINRMCKDPC--DCGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPC--ACGPNAVCTIENHRPVCTCKDGFYGDP----EIV--------------------CKEVGCQSNSECETTHECINGDCTPVC------------------GPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTV-------------------------------------------ECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKTCPAGSGLILNEF---EECVCPPGFVLDSQGICAPCRFDVGFIIENGRCICDYTKG-FVLDLSGKKCVCP-ENHSINDNGICEE--------------------EPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPPPV 5756
             CSC  GY GD F HC  I            P L N C  N++C  + +H  C C   + G   + + EC D  EC     C IN  C N            T  N    C C  G+ G+P   CV          + C  NPCG  A+C    G   C CP  L GDPY     C  +       AP ++  G         +CG  ++C   ++  +C C  G+TGDP  +C     I   +  S   CG  + C   +    C C   Y G          V   C     C N              AQC+    N  C C  GF         P+ +    I E     T +PCG NS+C  + G+  C C+   +G PP+                   Q C DPC   +CG  A C ++     C C EG+  +P     I     +I++  +S S        CG NAIC N     +C C   + G+PY  C        ECA ++             ICG+ A C        C C +G   DP  +SC+ + R   S ++      C  N+ C N      C+C + Y+G  P+C   C  ++                    C  N++C V N  P C CLPG    P  RSC DI             D C  +PCG +A+C+N  G   C C     G P S CR E    C  +  C   +SC++ +C                        C+ GY  NP   CV   E +     + CG N++C+    +  C C   +QGNP+  CQ     S  C      +  +C+      C   A+C  +   I  C C  GY  +P T      ++D    + +    +PCG  + C        C+C      + F G     +  C  NS+C +N  C + KC        D   G          +CG  A C   N  P C C  G TG+P + C          +D C  +PC   + C        C C     G P       +   EC  + +C    ACI  +C +PC    CG NA+C  +NH   C C+ G++ D    C            LC+   CG NA+C    +   C+C     G+PY      C++ S C     C+ Q        TC +  RC                               I Q C    CG N+ C    +   C+CQ G +  P               T  C+    Q  C   CG N++C   N N  C+C+  Y G+P+T C          +  C    CG NA C      P C+C   Y G+P                     ++C+D       +CG NAQC        C C + + GNPF  C   + A  +    C    CG NA+C     +G C C   + GD   +    C+  + C T                CG N  C ++ H          +G+ F             ++ C  + CGPNS C   N    C C   F G + + +  C    +CS +  C       IN      C DPC I     N +C V    PIC+CN G+  +  T         +   D                    C    C   AEC + G+   C CLP Y G+P +        + +C  N+EC  +  C     +  C  +CS     + ++C V NH+  C CP+G                                            + G+P + GCR   CV N DC  +  C R    C+DPC    CG NALC+V  H   C CP     +   +  + E   + D C    C   + C  ++      C  G +     C   C+ ++ C     C   KC +PC   CG  A C     N +C C E         +P   +  ++  P   + C A++ C              F G   YC PEC S+ +C     C N  C   C  + +C     C      P C   SD           QC+ +P   +       L+ CK + CG    C    G   CSC  + + +    CR   +C  D DC   LAC+        KC DPC    C   A C VI H+  C+C   + G   NP   C  +                           G  +  + C         +PC  +++C        C+C    +G+P    C+P  +C ++S+CS +  C N +C DPC G CG  + C V  H+P                                                     CSCLP +RG+P   C+  EC  NA+C A+ +C+  +C D C   G CG+ + C + NH P+CSC   +TGDP  EC                     C  + +C+  +CV        P+      C+++ +C + + C R++C DPC  P  CG NA+C   NH  +C+CP G  GN+ V C  +P+        P S  C+ S           C  N +C E      C     C  G +     C+  C    DCP +++C N +CQDPC  + CG N +C VI     CVC+ G                      +P PV+  C   P         I  Q +  C + F+     C+  C ++S+C     C  + C++ C +   C    +C  +S +  C   P  T D               + + +   I   ++ PC+ S CGANA CR + +   CSC     GNP E C+P    C+  SDCP ++ C    C   C   G C QN  C                        L V+               C   +QC     QA   C+         C   C+ +T C +   C   KC DPC N    CG+  TC   NH   C C  G SGDP+  C       +YL    +     + CGS   C       SC     C          C  +C I +DC +   CI    +  C   CG N DC                        P     E  Q  +PCN   C PN+ C     N +C+C   Y      GC + EC  +  CS DK+C   +C++ C    +CG+N+ C + NH   C CP G  GNA   C V R   +     PN CG N+ C        C C     G P       T    CR   AC N     PC   G+CG QA C VVNH  +C CPE Y G+P + C                                 C   PE          EC  + EC  +Q C+R  C DPC    C +N  C   +H P C C   L                                 IC ++D                     +C+    C S L C+   C NPC G                             CG  A C  V    IC C  G  GD   SC        E  C  + CGPN  C+E+ GQ VC C+P +V   P     CV  ++             +PC PSPCG   NC+VV +   C C  G  GDPF  C   P+   P   KD C PSPCGS + C  N  +   C+C E Y G P   C PEC    +CPSD++C N+KC DPCPG CG  A C V  H PTCRC EGY G+ +  C     + +  +P   P                                      P+C  N DCP  + C    C+DPCP  C +NA C V  H   C C     G+ + QC                        V  N+ VCSC  GY G PP CRPEC++  DCP +  C   +C +PC+ +CG GA CQVV H P+C CP   TG+P+ RC +     P    PC P+PCG N+ C+    +  C CLP F+G PP CR EC+++ EC +H  C  +KC DPC   CG NA CH  +H  +C C ++  GDPF +C+   P P  P   DPC  S CG NA C    N    C+C  +Y G+PY  CRPEC+ N+DCP++ AC+  KC DPC G+CG NA C                        PI+         PC+P+PCG NS+C   V+  ++C C  D  ++ SPPNCR ECT  + C  +L C+  KC DPC  +CG NA C+                                         + HNP+C+C   F GDP+   C   P   E     V PC  +PCG  +EC + +   SC C+  YVG P  +CRPEC VN +CP   AC+  KC++PC+    CG+ A+CNV   H   CSC N + GDP V C   P    T +  DPC N  CG  +Q    NGIC  SCLP Y G P   C P C++NSDCP H ACI N C DPC   +CG N  C V +H   C C     GN  + C+           +DPC    CG ++ C      A C C   Y+D PPNCR EC++  DC  + AC   KC  PC   CG  A C+V+NH+PIC C  +  GDP  +C P  +  P  I+PC+P+PCG N++     +   C+CLP F GDP   C  EC+ + +C    AC  N +C +PC G+CG+ + C VI H  +C C    EGDPF+ C P                                                 GCR +    S+C +  AC+  +C++PCP   CG NA C+  +H   C C  G+ GNP+  C +                                                 EC    +CP   AC++ KCVDPC   C + A C V NH   C+C  GFTGDP+         +D P  P          P  T                  +G        C  + EC ++ AC+  +C DPC+ + C  GA C V  H   C CP G+   GD        P   S P+             DPC    CG N  C       VC C  ++ GDPYT C +  C  N +CPL +AC+  KC DPC    CG+NA C+   H PMC+C  G  GN +  C    Q + ++++ C            +P  C  N+ C   N++A CTC+ GF GN       P   P     +C  + DC   +AC +  C NPCL    CG  + CQV +  P     C C   +T +    C+ + E                                IEF          C ++ +CP    C N  C +PC     C SLA CYV +H+  C C  G TGDP+V C+ + +   +               + PC     PCG  A C   N    CTC +E++GNP   C   EC   +DCP   ACI +KC +PC   +CG    C+   +I  C C PG  GNP + C      Q    +D +            C    C   + C   N +  C C    +G         P      C ++ +C S  AC+++ +C +PC+    C  D  C+V+   P    +C C  G                                       +G+  +C    + +G        C  +S C A++AC+  KC  PC  +CG  A C VINHTP C CP  Y+G+P I+C  L            RC  +           CG NA+C    +   C C P Y GDP+V C   EC+ N +CP  K CM ++C DPC+    CG NA C V  H+  C CP    G   + C+P                                        PP   P   EC I +DCA + AC +Q C +PC  +  C  +A C+VV+  P    IC C   +  D    C+  P +                                  +G        CV + ECP   ACIN+ C+DPC   CGR AEC    H P+C C     G+P I+C P                P   C P     SPCG+NA C  +   A                  C C   ++ N    C         C  + +C   RACI   C+DPC   CG NA+C I NH P+C+C+  + GDP    E++                    C  V  +++  C  T++ I  DC P C                   P    CG +A C  ++H   C+C P   G+P+V    V                                           EC  NS+CT ++ACI ++C+DPC  S  C   A C V  H   CTC  GY G   ++C       +     P++   ++    NP     PCG+NA C        R   C C+P Y GD   +C P   C   S    N      +CV P   +      CA     V   +    C+ DY    F L    +  V P E      N IC E                     PEC V  +C   + C   N  C +PC    CG  A     +H   CRC   ++GDP   C PI  P   P 
Sbjct: 5128 ICSCASGYSGDPFVHCTRISTTSPSPKGEGDPCLPNPCGPNSQCRVIGSHPACSCLQNYIGRPPNCRPECTDNSECFNTAAC-INQRCKNPCPGACGEIAKCTVQNHVPICTCPEGYEGDPTVRCVLASPPDRTVSNPCSPNPCGPNAQCRERNGAGACGCPPDLIGDPYDIIKGCHRECETNNDCAPQLACVGFKCTDPCPNTCGTLSICNVQAHVPVCLCPPGYTGDPYFACEIEEMIKTLEPCSPSPCGPNSKCRVVNDQAVCTCLPEYRGIPPSCRPECIVNAECPLHLACINKKCVDPCPNICGLKAQCITKNHNPICTCPAGFTGDPFTFCSPHVITEIPITERPPSCTPSPCGPNSLCQIISGNPACSCLPNYIGVPPQCRPECILSTECKSHLACVNQRCADPC-PGSCGINAQCHVLNHLPVCTCMEGFTGDPFTQCSIIPLGKNIEQLTESPSTDPCALSPCGPNAICDNG----DCRCLPEYIGNPYEACRPECILNSECARDKTCLKNKCKDPCPGICGQNAQCDIVNHIPVCSCPSGYIGDPF-VSCRVQPRVPDSRKDPCTPSPCGPNSQCRNVEDHAVCSCLQGYLGSPPSCRPECLVSSECPPMRACVNKKCTDPCLGSCGLNARCEVINHSPICSCLPGQTGDP-FRSCYDIPNISVPPEPKDRGDPCNPSPCGPNALCQNTNGQPSCSCLPTYIGTPPS-CRPE----CLINPDCPPEKSCINMKCKDPCPGSCGDNAECKVVNHAVTCSCKLGYTGNPFVQCVLEEEPMNPCEPSPCGANAICQQRDNAGACICIDDYQGNPYEGCQPECVLSADCSTNKACVRNKCKDPCPGVCGVRAQC-SVINHIPTCTCEPGYIGDPFTTCTLQPEVDTEPTVRNPCSPSPCGPNSLCRAVNNQAVCTC-----QESFVGVPPNCKPECVVNSECPQNRACYKYKC-------TDPCPG----------TCGIEANCRVINHNPLCSCPQGKTGDPFSRCFPEPVVPLPPVDPCFPSPCGLYAECKVVNNQAACTCLKNYIGIP------PNCRAECVVNTDCPSDQACISEKCRDPCIGS-CGQNADCRVQNHIPVCLCQLGYSGDPFTLCTVIREQPKIPEDLCSPSPCGPNAEC----NEGVCRCLPNYFGDPYSYCRPECTMNSDCPRVKTCINQNCVDPCPDTCGRDARCDVVNHVPMCSCPPGYTGNPFLLCRPHIPDDTIKQPCIPSPCGPNSICKVVNDHAVCSCQPGLISSPPTCKPECVISADCPLTQACLNNKCQDPCPGTCGQNTNCQVVNHNPICSCSESYTGDPFTICYPQPKTPPALMNPCLPSPCGPNAECQVRGDNPACSCIENYVGLPPNCRPECTINPECPPQLACMQQKCRDP---CVGLCGPNAQCSVVNHHAICTCINGYTGNPFSACEQKINAPLDIRKPCEPSPCGINAVCRENNGVGSCTCLPDYLGDPYQECRPECTQNSDCLTRMACVNLKCRDPCPGTCGVNAQCQSVNHLPICICIPGYTGNPFTLCSPIVEILQPETNSCSPSPCGPNSKCRDINGLAVCTCLPNFIGSSPNCRAECVMNSQCSQDLAC-------INQKCISPCPDPCGI-----NTQCRVIGHSPICICNLGYTGDPFTRCFPAPHFPVVSKD-------------------PCLSSPCGIYAECRNIGNTPSCSCLPTYRGSPPN-------CRPECRVNSECPMNLACNNERCRDPCLGSCS-----ITSLCTVYNHIPVCTCPEGFTGDPFTNCYLRPTTAPAVIDPCNLNPCGPNARCNNGICICLPEYQGDPYV-GCRP-ECVMNTDCAHDRACMR--NKCIDPCPG-TCGRNALCSVYNHVPMCTCPTGMAGNAFVQCSIVEDIPKRDSCSPSPCGPNSVCRENNGQPVCSCVAGFLGVPPACRPECTVSSECILTEACSNQKCINPCLGACGIQATCQVINHNPICSCGELTGDPFVRCIPRPPKPVLQTNPCVPSPCGANAECRVVGDAPSCSCLAGFLGLPPYCKPECISNSECPAHLACMNQKCRNPC--EGSCGANAECRVVSHTPMCVCPSDFTGDPF----TQCTMKPPTPLP------LSPCKPSPCGFNAICKEQFGVGSCSCLPDYIGNPYEGCRP--ECVVDTDCISILACVQ------SKCRDPCP-GVCGQFAECQVINHRPSCTCISGYSG---NPFQYCTVIR------------------------DVGTNIFLNTCNP-------SPCGPNSQCRVNNNQAVCSCLPIFIGNP--PACRP--ECVTSSDCSLNLACLNQKCQDPCPGSCGRNSNCRVIKHNPICSCKNGFTGDPFTVCFQIPVSPPVVSDVTRDPCIPSPCGMFSECRDIGGVPSCSCLPTYRGSPP-NCKP-ECTINAECSANMACMQQRCKDPC--PGSCGIMAECSVINHVPICSCLPDYTGDPFIECSVKPRKIPHPPSKPDPCTPSPCGPNTQCNGGICVCIAEYFGDPYSGCRPECVLNNDCLNTRACVRNKCVDPC--PGVCGQNAMCDVYNHVPMCTCPSGMDGNAFVLCSPVPAP-------PISNPCNPS----------PCGPNSQCRENNMQAVCS----CISGFIGAPPTCRPECVISSDCPKNEACTNQKCQDPCPGS-CGRNTICNVINHNPVCVCRSGMTGDPFINLSQLILIGITFKAEDPLPVLNPCQPSPCGPNAQCQVINDQASCSCLQEFIGSPPNCRSECNSNSECSNKMACINQKCRDPCIN--ACGINAVCNVVSHTPMCACTPGYTGDPF------------TQCSPQQFDIQPSISTPCTPSPCGANAVCRVQQNAGSCSCSTDYIGNPYEGCRPE---CTLNSDCPSNQACIGLKCKDPCP--GTCGQNAQCYVINHAPTCTCFEQYTGNPFIFCNLIVEAPIIADNINPCQPSPCGPYSQCRESNGQAVCSCLPTYIGAPPGCKPECTVSTDCATNRACENNKCVDPCPNS---CGQGTTCRVVNHSPICICKPGFSGDPFIRCLFVPPTPSYLPSLPSDPCIPSPCGSNSQCRNINGYPSCS----CMINYIGTPPNCRPECVIPADCPSNQACIREKCQDPCPGSCGLNADCTVHNHIPICRCIESYTGDPFIGCQPIPIYNEPIQPTDPCNKSPCGPNAQCN----NGICICLPEYFGDPYVGC-RPECVLSTDCSTDKACIRNKCVDPCP--GTCGQNSLCNVINHTPMCSCPPGTSGNAFISCDVIRVPSVTRPCSPNPCGPNSICRELNEQAVCTCAPEFLGAPPLCRPECTLSSDCRPNEACANQKCKNPC--PGTCGIQAKCVVVNHNPVCSCPERYTGDPFIRCDIMKPIAPVVINPCQPSPCGPYAQCQVVNDLPSCSCLPEYRGSPPYCRPECISNHECPSHQSCVRQKCRDPCPG-LCGENAECHVIQHVPHCVCTYGLTGDPYTRCSAIPRPIELEPISSPCVNFECGANAICKERDSVAICQCISSYVGNPYLACRPECIINPDCASNLMCVRNKCTNPCAGM----------------------------CGRNAECSVVNHQPICTCLPGYTGDSFISCFIDKIISDENVCAPSPCGPNSKCKEVSGQAVCSCLPSYVGTPPACRPECVASSECSPQLVCKDYKCVNPC-PSPCGLNTNCVVVNHSPICSCMSGYSGDPFTICSLIPLITPPLVQKDPCVPSPCGSFSQCR-NIGDSPACTCLENYIGQP-PNCRPECTIHSECPSDKACINMKCVDPCPGSCGTNALCSVINHIPTCRCPEGYTGNTFVLCEILPAISKRYEPSTTPSPVEDACVPSPCGPNAQCFDGICTCLPEFRGDPNVGCRPECVLNADCPRDRACIRNKCLDPCPGACAVNALCTVIGHIPMCSCPGNMTGNAFSQCTPLQDIPLANPCTPSPCGPNSECRVINNQAVCSCIRGYLGSPPTCRPECIVSTDCPQNEACSNQKCTNPCLGSCGLGASCQVVNHNPICICPPSQTGDPFVRCYLSPPQIPVSLTPCKPNPCGPNSQCQPRGDESVCTCLPDFIGSPPNCRAECVSNSECSNHLACINKKCRDPCIGSCGANANCHVVSHTPMCSCINDYTGDPFTQCTLREPTPLPPAPIDPCNPSPCGSNAVCKEF-NGAGSCTCLPNYTGNPYEGCRPECVLNSDCPANSACVNMKCRDPCPGSCGRNALCQVVNHLPVCNCYPRYTGDAFSYCTPIEIEGENAVSNPCEPSPCGPNSLCRV-VDNTSVCTCLPDFQWVASPPNCRAECTVSAECAFNLACISYKCNDPCRTLCGSNARCE----------------------------------------TINHNPICSCPSRFTGDPF-VACFEMPSKDEESRPLVNPCTHSPCGPYSECRDISGQASCACLSTYVGTP-PNCRPECSVNPECPTNQACIQRKCRNPCD--GVCGVGAICNVIR-HTPTCSCSNGFTGDPFVMCRPIPEEDTTLKPTDPCLN--CGANTQCF--NGIC--SCLPEYQGNPNFGCHPECILNSDCPRHRACIKNKCQDPCGLGICGVNALCSVINHIPVCTCAQRMSGNAFVQCSP----IADTIPKDPCNPSPCGPNSQCRKIKEQAVCSCLPGYLDAPPNCRAECIISSDCLANRACNNQKCIDPCPGTCGIRAQCTVVNHNPICSCSSELTGDPFTQCIPRPIESPTPINPCVPSPCGLNSKCEVVNNAYSCSCLPEFIGDP-PNCRPECVSNSECSTQLACI-NQKCRDPCPGSCGINSDCRVISHTPMCVCLIGFEGDPFVLCNPKQSKCSDVINAVKPTPCIPSPCGFNAVCRELNGVGSCMCLSDYTGNPYEGCRPECTINSDCTADRACVGSKCQNPCP-GFCGYNAICQVVNHAPLCTCQPGYSGNPFVSCNRIVQDTCKSLELNPCSPSPCGLNSQCRELNGQAVCSCLPTFIGTPPNCRAECTVSSDCPVNRACKNRKCVDPCPGICGINARCEVINHSPICSCNQGFTGDPFITCFQTLIDKDTPQTPENPCVPSPCGPFATCRDSGYAGVPTCTCMENYIGSPPNCRPECTVDSECNNNQACLRQKCRDPCLGS-CGIGAQCLVVNHMAICLCPKGY--TGDAFTNCFPEPAPASIPQ-------------DPCNPSPCGANTVCRDG----VCTCMPEFHGDPYTAC-RPECVQNPDCPLDKACVRNKCFDPC-IGVCGQNAKCTVINHTPMCACPDGMSGNAFAACYPVIQDQTIIENPC------------NPSPCGPNSRCQNFNNQAVCTCITGFIGNP------PACRP-----ECIVNTDCALNEACINMKCGNPCLGA--CGISARCQVLNHNP----VCTCPPVFTGDPFIRCVPRPEDIPKPINPCQPSPCGPNSQCQIINDTPSCSCTIEFIGTPPNCRPECISNSECPSQMACINRKCRDPCPGS--CHSLANCYVINHVPTCTCHVGYTGDPFVQCMIMPSELPAP--------------RQPCQP--SPCGTNAVCREQNGVGSCTCLLEYIGNPYEGCRP-ECTISSDCPAHLACIGSKCQNPC-PGSCGTNTNCQVINNIPICTCIPGYTGNPYINCIY----QTLSISDEK---------HEPCKPSPCGPNSQCTNNNGQAVCSCLLQFIG--------TPPNCRPECLVNSECGSNRACVNQ-KCVDPCI--GTCGRDAQCKVVHHSP----ICVCANGYTGDPFIYCFAVAISNPEDQYLKDPCLPSPCGPNALCRAIGDAPACSCMQNYMGVPPNCRPECSINSDCPANRACIREKCRDPCPGSCGLLARCSVINHTPSCICPEGYTGDPFISCNVLP---QIPLLPPDRCNPS----------PCGQNAQC----NNGVCTCIPEYLGDPYVGCRP-ECVINTDCPRDKACMFHKCRDPCIGT--CGVNADCIVVNHLPMCSCPRNMTGSAFVSCTPLQDSTIMKQPCNPSPCGPNSHCRVSNNQAICACIAGFRGTPPSCRP---ECLISADCARNRACSNQKCIDPC--LGACGLTAQCTVVNHNP----ICSCPPLYTGDPFVQCIRQPEEPQPPIDPCQPSPCGPNAICRVLNDAPSCSCLPQFIGTPPRCRPECVSNSECPSQQACINQKCRDPCPGSCGRNAECRTVSHTPICICAGDFTGDPFIQCNPRP-------------IPLNPCQP-----SPCGANAMCREISGSA-----------------SCTCLPDFYGNPYEGCRP------ECVINSDCTSNRACIRNRCQDPCPGTCGVNAICEIVNHIPMCSCQLRYTGDPFRYCELMQETPPIGDPCQLSPCGPNSRCLNVNGKASCSCLPTYQGIPPDCRPECIVSTECPINRACVNQKCVDPCPGVCGINAKCDALSHSPFCSCGPSQIGDPFVKLMPVPTLQVNPCVPSPCGPFSTCQDKGGYPFCTCMPNYIGSPPYCRTECSINSDCTSNKACIREKCRDPCPGS--CGFNALCTVIKHTPTCTCLNGYTGDPFSNCY------LAPMPIPTEIPTVTSDPCNP----SPCGLNADC--------RNGICNCIPEYHGDPYRECRP--ECVQNSDCPFNRACANNKCVDPCVGICGQNAECA-----VINHVSTCSCVKDYEGDPFTLCKRVQSRVKPCEPSPCGPNSICREFGDQASCSCLSGYFGIPPSCRPECLVSTDCEQSKAC--VNMRCRNPCENA-CGQNALCVVRNHNPICRCPVQHSGDPFINCFPITTPDVEPT 11491          

HSP 6 Score: 1617.82 bits (4188), Expect = 0.000e+0
Identity = 1914/6927 (27.63%), Postives = 2631/6927 (37.98%), Query Frame = 0
Query:   60 PDCYRGSDEANSQI----KCTKDCLYTTGRHCQ-HGACLDSQCYCNDGYGG---KGCDMPDT-----NECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDI---------------DECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTN-----------QVCGINTLCINTHGNFSCECLPGFHG---NPHDGCVDIDECRTN--------------PCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQG---CNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDI---------------NECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSC---------ACRKGF-------QPNGVLCQDIDECQSTEN---------PCGANSICLNVPGDYECQCIAPLVGTPPEQPCR------------DPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPT---------GKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDI--------DECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCID-----IDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQ--------------SCSGS---------------SCSCLPPYQDIEGRC--QLADCSNCEAPAKCV------------------QITGGISYCACPRGYEMNPRT--------KNCEDIDECQAI---GHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNP-PQCLCKAGFTGNPLTGCE--------DLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSL---------------CNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHC-IYGNPNSCACNIGYFGNPYTGCEVTTS-VEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFS--------------------VCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDDDL---CANQQCGPNAIC----NLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDA---------------------------------NDPQRGCQR---------EEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCR---------------------------------------------KVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSP---------TPEVLCEKNDRGDLCPFGQCQTTCASSS-QCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSP-EFENLCQCPEGFAGVPTAA-QGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCA-----RGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGGQ---CSCQPGYE---------MTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADS-----------------LSGAKKCL------------------------DPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCY--------------QVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQ--------LIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLE--------------------------------------------CVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDP--------------------------RECEQNLDCPGDGKCDNFVCVKPH-EKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTRE-----------PITCQGNKQCPEN-----------FLCDASFCKPVCFADSDCEANELCHGKICKE----VCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVPCSSASDCPQSKTCSQGTC----------VAQCQLQG-----DCLQNEVCNEGLCVQI-------------------CNSNTQCQAGL-VCIDRQ-------CVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCR---TNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECI----EGVCISGCGSNRDCPYGE-----MCEGGQ-------------------------CRNPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCL-------LPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCP-TPKDSCRTKGACL-----NPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKT------------------------------QFGCKARPEVEAESTG--RECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICT-------------------------------KDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVK----------EESCGTTACGPNMACQ--------ELYGQPVCECIPGFVPKYPVSL--GCVEPA-DDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVE-ETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKP---------PIRPLPQCQ--------------------------RNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCIV---------------------------RGNREVCSCQPGYFGGP-PNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNP---PEPLETDPC--SACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECS--------------------------------------EPI-DPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSP-PNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPC--ETCGQHAICHIHNNIAACKCEDNYIDKP-PNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKV---SQPIDPCLPNPCGENTEHRKAGSNCICTCLPGF-YGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRCIPAGCRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQYECKRHEECPSTLACRDFKCVDPCD--CAVGANCRVSNHKTTCTCPPGFTGDPYSRDDP---------PRPPILTVG---------------------------CEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACP-----NGFLFIGDFECKAPERP------------------------------------ECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQ----------------------------------------------KAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQYECLVDSDCPYTLACPNRECIDPCQCAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVE----------------------------------PIEFG--------CQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSCLEIVTG-------------------------------------------------CKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECH-------------------------------------------QYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQVECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGG-SCIAAPSLVGCESSSKCKADQACLNAKCVSPCN---CGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCSTFECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVF-----------------------------------------LPTDTILGCVKDDECPKDSACINRMCKDPC--DCGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQS--DNECQDP---DVCAPNG----------------------NCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPV--RRIVCECPKGYFTNE-----------------------------NNQCLTLTPIVVG---------CTSDDECGDARACINAICKDPC--ACGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEG------------------------------------TRGNSCKKVVVG--------CVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPV-------KTCPAGSGLILNEFE---ECVCPPGFVLDSQGICAPCRFDVGFIIENGRCICDYTKGFVLDLSGKKCVCPENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRT--CGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDP 5741
            P+C + SD A+++     KC   C+   G + Q         C C  GY G     C +P       + C+  PC  +  C        CSC   Y G    C+                   C+ P L  TC  NA+C  +  + VC C  G+ GD    C  + E +T              CG N+ C    G  +C CLP + G   N    CV  + C  N               CG+   C  +  N  C C  G +GDP+        AP  ++Q    CN   CG NA+C   +    CTC   + GDP I+C                  N+C +     CG  A C   +    C C  GY GD    C  + + T      D  + + C PN +C          C+ GF       +P  ++  +  + ++  N          CG N+ CL V  +  C C +   G P     R            DPCL   CG  + C+++ S   C C + +   P      C D  EC  + +           G CG  A C+       C C +G+ GDP + C           + C+ N   CG  A C  + G+ +C C      DP  +  +   R C+++ +C     C           VG  C D C + TC   S C VQ  +P C C PG+   P     I+     ++ C+ +PCG ++ C  +    VC C     G P S CR E    C  +++C    +C++ +CV                + C   N+CG+ + C     +  C CP+GF G+PFT C               SC+ S               +CSCLP Y  +  +C  +    + C++   CV                   +   +  C C  G+  +P T        KN E + E  +      +PCG  A C N      C C P   G+P++      R  C  NS+C  ++ CL+                N CK PC    CG NA+C   N  P C C +G+ G+P   C           D C  +PC   S C N      C C  G  G P       S   EC    EC    AC+  +C +PC    CG NA C   NH+  C C  G   D   +C  +               CN   CG NA C  +   P+C C    +G P         SC                       + +C +N  C P +   +C +    DP            C   CG N+ C +  +  +C+C +GY GNP+  C +    +  C+   CG NA+C        C C   Y G PYE CQ   EC+ S                    VCG  AQC        C C   ++G+PF  C     V  +  +   C+   CGPN++C    N   C C   F G  PN   E       C  N++C  N  C          C+DPC    CG  + C   NH   C C  G TGD                                  N     C +           +C  N DCP+ + C       + C DPC I SC  N  C V + +P+CLC  G+  +  T                    C  +    K     C    C   AEC    + G CRCLP Y G+P        + + +C+ N++C   + C   N    C   C     G  A C V NHV  C CP G + GNP +  CR                                             K  CV + DCP  + C  L+  C DPC    CG+N  C V  H   C C  S+   P         TP  L          P  +CQ    + +  C    +     C   C+ N  C     C+  KC+DPC   CGPNA CS      +C C  G+ G P +A +  +  P      C  S    N  C  E    G C       G+      C   C  + +CL    CV+  C   C     C +   C +      C C PGY          + +    + N C  + CG    C +  G  +C+C  N +   S  CR+  +C  +  C+  LAC+                    +  +  C+                        DPC  S C   A C  I +   CSC P +RG P N +  C               +   PC G       C   +H P C C +G+         L  +    + +  + NPC  +A+C N      C C     GDPY  GC+P  +C  N++C+ D  C   +C+DPC G CG  A C V NH P C+C     GN  ++C ++E                                            C  +++C  +++C N KC++ C   G CG+ + C++ NH P+CSC    TGDP                           EC    D P       F+ + P+ +  C+ +  C     C   +C++PC+   +CG NA C   +H  +C CP  FTG+   +C   P T +  S C  S                 C  N  C E   + +C    D ++G+    + C+  C    DC +  +C+  +C+DPC    CG  A CQVI  +  C C  G+  NP       R+           P  C  N QC  N           F+ +   C+P C   SDC  N  C  + C++     C  +S C+  +     SC  G   DP                  +  V+    S +    DPC  S CG  +ECR       CSC     G+P  +C+P    C+  ++C  +  C Q  C          +A+C +        CL +   +  +   +                   C  NTQC  G+ VCI          C   C  N  C +   CV  KC DPC     VCG+ A C   NH   C CP G  G+ +  C       +      + CG    C       + +A   C  G       C  +C I+SDC     C     +  C   CG N  C         +C  G                            NPC    C PN+ CQV      C C + +  + S    ++EC +N +CS   +C   +C + C   N+CG NA C + +H   C C  G+ G+   +C   + D          P+ CG NA C  Q     C C +   G+P++GC+   T    C +  AC+     +PC   G+CG+ A C V+NH   C C E Y GNP + C                                Q  C   P       G   EC  S +C+ N+ C    CVDPC  + C     C    H P C CK       +G+       ++CL+    PS L  +     +PC  + C     C+ +N    C C                                +DPC  S CG  A C       IC C E   GDP   C             + C  + CGPN  C         E +G P   C P  V     S    C+     DPC P  CG  + C V+ +   C CPPG  G+ FI C  +   +    C P+PCG  + C   +E QA+C+C   + G P   C PEC    DC  +++C N KC++PCPG CGI A C V  H P C C E Y GDP+ +C + +   P         P  P  QCQ                           N +CPS + C    C DPCP  CG NA+C V  H   C C  G  GDPY +C                             R +  +C C   Y G P   CRPEC+I  DC  +  C+R +C +PC   CG  A+C VV H+P+C+C  G TG+ +  C I      +  C PSPCG N+ CK V  Q  C CLP ++G PP CRPEC+A  EC    +C   KC++PC + CG+N  C   NH  IC C S   GDPF  CS  P   P  ++ DPC  S CG  + C     D   C+C ++Y+G P   CRPEC  +++CPS +AC+  KCVDPC G+CG NA CS                                       P+ D C P+PCG N+ C        +C C  ++ G P   CRPEC  ++ CP    C+R KC+DPCPG C  NA C                                     ++GH+    PMC+C     G+ +++    +   + N   PC P+PCG N+EC   N    C CI  Y+G P  +CRPEC+V++DCP   AC + KC +PC    +CG+ A C V N H+  C C     GDP V C+  P  I     + PC    CGP SQ   R     C+CLP ++G+PP+C+  CV NS+C  HLACIN  C DPC  + CG+N +C+V SH   C C   Y G+P   C       +     DPC    CG +A+C   N   +C C  NY   P   CR ECVL+ DCP + AC+  KC  PC   CG+NA C V+NH P+C C P+Y GD    C P ++   +   +PC P+PCG N+  R   +  +CTCLP F +      C  EC +  +C +N AC S ++C++PC   CG  A C  I HN ICSCP    GDPF+ C         E PS +    R   +PC    CG  +EC   S  ++C CL  + G P     + EC  + ECP+  AC   KC +PCD  C VGA C V  H  TC+C  GFTGDP+    P         P  P L  G                           C  N +CP   ACI ++C DPC    C   A C+V  H   C C      N F+         P+ P                                    EC+   +C  + AC +++C+DPC    CG+ A+CTV  H P+C+C  +  GDP+T C                                               +  C SNSEC    ACIN+KC+DPCP   CG N+DC    H PMC CL G+EG+P+  C   +    S C   +         P  C  NA C   N   SC CL  + GN Y G C P         +C  + DC + +AC    C+NPC     CG ++ICQV +  P     C C+ GY+ N    C R V+                                  P   G        C    DCP ++ C N  C++PC     C   A+C V +H   C+C  G TGDP+++C + +                                                   C  D EC +++AC    C++PC      CG  A+C   NH A+C CP  + G+    C                                            + EC+Q+ DCP DKAC+ NKC DPC+   CGQ A C    H   C CP G+ GN    C+ V   QD    +N             CN   C   + C+  N++  C C    +G+        P      C ++ DC    ACI+  +C NPCL    C     CQV++ +P    VC CP  +F G+    C+  P  +                 K ++PC    CG  + C +IN TP C C  ++ G P     + EC ++ +C     C +  C DPC     C   A C   +H  TC C  GY GDPFV+C            P++     Q   P     PCG NA CR    + SC C     G+P  GC P          EC I SDC + LACI   CQNPC     C  +  C V++ +P    IC C  G+  +   +C++                                          P +    C+ + EC  + AC+N+ C DPC   CGR A+C +  H P+C C  G  G+P I C  +   +  D   +DP     C PN                       NC P C + S C +N  C     R  C  +C ++    V      C CP+GY  +                              NN   T  P  +G         C  + +C   +AC+   C+DPC   CG NA C + NH P+C+C     G   + C  +              +   C P       PCG ++ C+  N+Q +C C  G  G P  SC   EC  +++C  +RAC N++C DPC     C   AQC V NH   C+CPP Y G                                        SC    +G        CV +S+CPSQ ACI++ C++PC  +  CG NA+C  +   PI    C+C   + GD  IQC P        +  P G+  +  E      C C P F  +    C P          N  CI +  +       G   +C     +N   +C     C++     PF YCE    T   GDPC   PCGP +     + +  C C+  Y G P
Sbjct: 4661 PECVQNSDCAHTKACINNKCKDPCVGACGINAQCQVYNHQPSCSCLSGYTGDPLTSCHIPIKPSTPGDTCQPSPCGPYSNCRVIDNHAVCSCQPNYIGSPPSCRPECVVSTDCSPNTACINQRCKDPCLG-TCGVNADCRVINHNPVCICAIGYSGDPFFGC--VKEEITPLPKPSGNPCVPSPCGPNSQCRVIDGFPACSCLPNYVGRAPNCRPECVINEGCPGNLACQNEQCVDPCPGSCGVNTYCNVVKHNPVCICNEGYTGDPFTECTPIVEAPITTEQPRTPCNPSPCGANAVCNERNEVGSCTCLPQYFGDPYIACRPECVTNTDCDRSKACLNNKCVNPCPGTCGQDATCRVVNHAPMCSCLPGYTGDPVNGCT-IIIVTPLPVPIDPCDPSPCGPNSNCRTHDGHAVCLCQPGFSGVPPTCRPGCIVSSECSQNRACINNKCADPCPGSCGQNTNCLTVNHNPICSCASGYSGDPFVHCTRISTTSPSPKGEGDPCLPNPCGPNSQCRVIGSHPACSCLQNYIGRPPNCRPECTDNSECFNTAACINQRCKNPCPGACGEIAKCTVQNHVPICTCPEGYEGDPTVRCVLASPPDRTVSNPCSPNP--CGPNAQCRERNGAGACGCPPDLIGDPYDII-KGCHRECETNNDCAPQLAC-----------VGFKCTDPCPN-TCGTLSICNVQAHVPVCLCPPGYTGDPYFACEIEEMIKTLEPCSPSPCGPNSKCRVVNDQAVCTCLPEYRGIPPS-CRPE----CIVNAECPLHLACINKKCV----------------DPC--PNICGLKAQCITKNHNPICTCPAGFTGDPFTFCSPHVITEIPITERPPSCTPSPCGPNSLCQIISGNPACSCLPNYIGVPPQCRPECILSTECKSHLACVNQRCADPCPGSCGINAQCHVLNHLPVCTCMEGFTGDPFTQCSIIPLGKNIEQLTESPSTDPCALSPCGPNAICDNG----DCRCLPEYIGNPYEA----CRPECILNSECARDKTCLK----------------NKCKDPCPGI-CGQNAQCDIVNHIPVCSCPSGYIGDPFVSCRVQPRVPDSRKDPCTPSPCGPNSQCRNVEDHAVCSCLQGYLGSP------PSCRPECLVSSECPPMRACVNKKCTDPCLGS-CGLNARCEVINHSPICSCLPGQTGDPFRSCYDIPNISVPPEPKDRGDPCNPSPCGPNALCQNTNGQPSCSCLPTYIGTP--------PSC-----------------------RPECLINPDCPPEK---SCINMKCKDP------------CPGSCGDNAECKVVNHAVTCSCKLGYTGNPFVQCVLEEEPMNPCEPSPCGANAICQQRDNAGACICIDDYQGNPYEGCQP--ECVLSADCSTNKACVRNKCKDPCPGVCGVRAQCSVINHIPTCTCEPGYIGDPFTTCTLQPEVDTEPTVRNPCSPSPCGPNSLCRAVNNQAVCTCQESFVGVPPNCKPE-------CVVNSECPQNRACYKYK------CTDPCP-GTCGIEANCRVINHNPLCSCPQGKTGDPFSRCFPEPVVPLPPVDPCFPSPCGLYAECKVVNNQAACTCLKNYIGIPPNCRAECVVNTDCPSDQACI-----SEKCRDPC-IGSCGQNADCRVQNHIPVCLCQLGYSGDPFT-------------------LCTVIREQPKIPEDLCSPSPCGPNAEC----NEGVCRCLPNYFGDP------YSYCRPECTMNSDCPRVKTCINQNCVDPCPDTC-----GRDARCDVVNHVPMCSCPPG-YTGNPFLL-CRPHIPDDTIKQPCIPSPCGPNSICKVVNDHAVCSCQPGLISSPPTCKPECVISADCPLTQAC--LNNKCQDPCPG-TCGQNTNCQVVNHNPICSCSESYTGDPFTICYPQPKTPPALMNPCLPSPCGPNAECQVRGDNPACSCIENYVGLPPNCRPECTINPECPPQLACMQQKCRDPCVGLCGPNAQCSVVNHHAICTCINGYTGNPFSACEQKINAPLDIRKPCEPSPCGINAVCR-ENNGVGSCTCLPDYLGDPYQE--CRPECTQNSDCLTRMACVNLKCRDPC--PGTCGVNAQCQSVNHLPICICIPGYTGNPFTLCSPIVEILQPETNSCSPSPCGPNSKCRDINGLAVCTCLPNFI-GSSPNCRA--ECVMNSQCSQDLACINQKCISPCPDPCGINTQCRVIGHSPICICNLGYTGDPFTRCFPAPHFPVVSKDPCLSSPCGIYAECRNIGNTPSCSCLPTYRGSPPNCRPECRVNSECPMNLACNNERCRDPCLGSCSITSLCTVYNHIPVCTCPEGFTGDPFTNCYLRPTTAPAVIDPCNLNPCGPNARCNNGI----CICLPEYQGDPYV-GCRP--ECVMNTDCAHDRACMRNKCIDPCPGTCGRNALCSVYNHVPMCTCPTGMAGNAFVQCSIVEDIPKRDSCSPSPCGPNSVCRENNGQPVCSCVAGFLGVPPACRPECTVSSECILTEACSNQKCINPCL--GACGIQATCQVINHNPICSCGE-LTGDPFVRCIPRPPKPVLQTNPCVPSPCGANAECRVVGDAPSCSCLAGFLGLPPYCKPECISNSECPAHLACMNQKCRNPCE--GSCGANAECRVVSHTPMCVCPSDFTGDPFTQCTMKPPTPLPLSPCKPS----------------PCGFNAICKEQFGVGSCSCLPD-YIGNP--YEGCRPECVVDTDCISILACVQSKCRDPCPGV-CGQFAECQVINHRPSCTCISGYSGNPFQYCTVIRDVGTNIFLNTCNPSPCGPNSQCRVNNNQAVCSCLPIFIGNPPACRPECVTSSDCSLNLACLNQKCQDPCPGSCGRNSNCRVIKHNPICSCKNGFTGDP-------------FTVCFQIPVSPPVVSDVTR--DPCIPSPCGMFSECRDIGGVPSCSCLPTYRGSP-PNCKPE---CTINAECSANMACMQQRCKDPCPGSCGIMAECSVINHVPICSCLPDYTGDPFIECSVKPRKIPHPPSKPDPCTPSPCGPNTQCNGGICVCIAEYFGDPYSGCRPECVLNNDCLNTRACVRNKCVDPC---PGVCGQNAMCDVYNHVPMCTCPSGMDGNAFVLCSPVPAPPISNPCNPSPCGPNSQCRE----NNMQAVCSCISGFIGAPPTCRPECVISSDCPKNEACTNQKCQDPCPGSCGRNTICNVINHNPVCVCRSGMTGDPFINLSQLILIGITFKAEDPLPVLNPCQPSPCGPNAQCQVINDQASCSCLQEF--IGSPPNCRSECNSNSECSNKMACINQKCRDPCI--NACGINAVCNVVSHTPMCACTPGYTGDPFTQCSPQQFDIQPSISTPCTPSPCGANAVCRVQQNAGSCSCSTDYIGNPYEGCRPECTLNSDCPSNQACIGLKCKDPC--PGTCGQNAQCYVINHAPTCTCFEQYTGNPFIFCNLIVEAPIIADNINPCQPSPCGPYSQCRESNGQAVCSCLPTYIGAPPGCKPECTVSTDCATNRACENNKCVDPCP-NSCGQGTTCRVVNHSPICICKPGF----SGDPF-----IRCLFVPPTPSYLPSLP---SDPCIPSPCGSNSQCRNINGYPSCSCMINYIGTPPNCRPECVIPADCPSNQACIREKCQDPCPGS-CGLNADCTVHNHIPICRCIESYTGDPFIGCQPIPIYNEPIQPTDPCNKSPCGPNAQCNNGICICLPEYFGDPYVGCRPECVLSTDCSTDKACIRNKCVDPC-PGTCGQNSLCNVINHTPMCSCPPGTSGNAFISCDVIRVPSVTRPCSPNPCGPNSICRELNE-QAVCTCAPEFLGAPPL-CRPECTLSSDCRPNEACANQKCKNPCPGTCGIQAKCVVVNHNPVCSCPERYTGDPFIRCDIMKPIAPVVINPCQPSPCGPYAQCQVVNDLPSCSCLPEYRGSPPYCRPECISNHECPSHQSCVRQKCRDPCPGLCGENAECHVIQHVPHCVCTYGLTGDPYTRCSAIPRPIELEPISSPCVNFECGANAICKERDSVAICQCISSYVGNPYLACRPECIINPDCASNLMCVRNKCTNPCAGMCGRNAECSVVNHQPICTCLPGYTGDSFISCFIDKIISDENVCAPSPCGPNSKCKEVSGQAVCSCLPSYVGTPPACRPECVASSECSPQLVCKDYKCVNPCPSPCGLNTNCVVVNHSPICSCMSGYSGDPFTICSLIPLITPPLVQKDPCVPSPCGSFSQCR-NIGDSPACTCLENYIGQPP-NCRPECTIHSECPSDKACINMKCVDPCPGSCGTNALCSVINHIPTCRCPEGYTGNTFVLCEILPAISKRYEPSTTPSPVEDACVPSPCGPNAQCFD-----GICTCLPEFRGDPNVGCRPECVLNADCPRDRACIRNKCLDPCPGACAVNALCT------------------------------------VIGHI----PMCSCPGNMTGNAFSQCTPLQDIPLAN---PCTPSPCGPNSECRVINNQAVCSCIRGYLGSP-PTCRPECIVSTDCPQNEACSNQKCTNPCL--GSCGLGASCQVVN-HNPICICPPSQTGDPFVRCYLSPPQIPVS--LTPCKPNPCGPNSQCQPRGDESVCTCLPDFIGSPPNCRAECVSNSECSNHLACINKKCRDPCIGS-CGANANCHVVSHTPMCSCINDYTGDPFTQCTLREPTPLPPAPIDPCNPSPCGSNAVCKEFNGAGSCTCLPNYTGNPYEGCRPECVLNSDCPANSACVNMKCRDPCPGSCGRNALCQVVNHLPVCNCYPRYTGDAFSYCTPIEIEGENAVSNPCEPSPCGPNSLCRVVDNTSVCTCLPDFQWVASPPNCRAECTVSAECAFNLACIS-YKCNDPCRTLCGSNARCETINHNPICSCPSRFTGDPFVACF--------EMPSKDE-ESRPLVNPCTHSPCGPYSECRDISGQASCACLSTYVGTPPN--CRPECSVNPECPTNQACIQRKCRNPCDGVCGVGAICNVIRHTPTCSCSNGFTGDPFVMCRPIPEEDTTLKPTDPCLNCGANTQCFNGICSCLPEYQGNPNFGCHPECILNSDCPRHRACIKNKCQDPCGLGICGVNALCSVINHIPVCTCAQRMSGNAFVQCSPIADTIPKDPCNPSPCGPNSQCRKIKEQAVCSCLPGYLDAPPNCRAECIISSDCLANRACNNQKCIDPCPG-TCGIRAQCTVVNHNPICSCSSELTGDPFTQCIPRPIESPTPINPCVPSPCGLNSKCEVVNNAYSCSCLPEFIGDPPNCRPECVSNSECSTQLACINQKCRDPCP-GSCGINSDCRVISHTPMCVCLIGFEGDPFVLCNPKQ----SKCSDVINAVKPTPCIPSPCGFNAVCRELNGVGSCMCLSDYTGNPYEG-CRP---------ECTINSDCTADRACVGSKCQNPCPGF--CGYNAICQVVNHAP----LCTCQPGYSGNPFVSCNRIVQDTCKSLELNPCSPSPCGLNSQCRELNGQAVCSCLPTFIGTPPNCRAECTVSSDCPVNRACKNRKCVDPCPGI--CGINARCEVINHSPICSCNQGFTGDPFITCFQTLIDKDTPQTPENPCVPSPCGPFATCRDSGYAGVPTCTCMENYIGSPPNCRPECTVDSECNNNQACLRQKCRDPC---LGSCGIGAQCLVVNHMAICLCPKGYTGDAFTNCFPEPAPASIPQDPCNPSPCGANTVCRDGVCTCMPEFHGDPYTACRPECVQNPDCPLDKACVRNKCFDPCI-GVCGQNAKCTVINHTPMCACPDGMSGNAFAACYPV--IQDQTIIENP------------CNPSPCGPNSRCQNFNNQAVCTCITGFIGN--------PPACRPECIVNTDCALNEACINM-KCGNPCL--GACGISARCQVLNHNP----VCTCP-PVFTGDPFIRCVPRPEDI----------------PKPINPCQPSPCGPNSQCQIINDTPSCSCTIEFIGTPPNC--RPECISNSECPSQMACINRKCRDPC--PGSCHSLANCYVINHVPTCTCHVGYTGDPFVQCMIM---------PSELPAPRQPCQP----SPCGTNAVCREQNGVGSCTCLLEYIGNPYEGCRP----------ECTISSDCPAHLACIGSKCQNPCP--GSCGTNTNCQVINNIP----ICTCIPGYTGNPYINCIYQTLSISDEKHEPCKPSPCGPNSQCTNNNGQAVCSCLLQFIGTPPNCRPECLVNSECGSNRACVNQKCVDPCIGTCGRDAQCKVVHHSPICVCANGYTGDPFIYCFAVAISNPEDQYLKDPCLPSPCGPNALCRAIGDAPACSCMQNYMGVPPNCRPECSINSDCPANRACIREKCRDPCPGSCGLLARCSVINHTPSCICPEGYTGDPFISCNVLPQIPLLPPDRCNPSPCGQNAQCNNGVCTCIPEYLGDPYVGCRPECVINTDCPRDKACMFHKCRDPCIGTCGVNADCIVVNHLPMCSCPRNMTGSAFVSCTPL---------QDSTIMKQPCNPS------PCGPNSHCRVSNNQAICACIAGFRGTP-PSCRP-ECLISADCARNRACSNQKCIDPCL--GACGLTAQCTVVNHNPICSCPPLYTGDPFVQCIRQPEEPQPPIDPCQPSPCGPNAICRVLNDAPSCSCLPQFIGTPPRCRPECVSNSECPSQQACINQKCRDPCPGS--CGRNAECRTVSHTPI----CICAGDFTGDPFIQCNPRPIPLNPCQPSPCGANAMCREISGSASCTCLPDFYGNPYEGCRPECVINSDCTSNRACIRNRCQDPCPGTCGVNAIC---EIVNHIPMCS----CQLRYTGDPFRYCELMQETPPIGDPCQLSPCGPNSRCLNVNGKASCSCLPTYQGIP 11109          

HSP 7 Score: 1613.97 bits (4178), Expect = 0.000e+0
Identity = 1880/6490 (28.97%), Postives = 2575/6490 (39.68%), Query Frame = 0
Query:  147 FHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVD---IDECRTNP-CGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTG---DPKISCV----------------DINECQSSSLYQ--CGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCL--------DID--------------------ECDKS--------ISP---TGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGAC----------NCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGR-SCIDIDE--CAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCR----GESTFECTQDSQCDQGESCLSSRCV--CRRGYERNPAGDCVD---LNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCS---GSSCSCLPPYQDIEGRCQLADC---SNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHR-FSCGFNAECTPSN-PPQCLCKAGFTGNPL-------TGCEDLDEC-----------ALNPCKQGSICINKLATYQCE----CPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQE-QCGVNAFCDP--NRLSCTCQSGFLGDPTLVCMPPTQQAECSSE-CGTNSHCIYG-NPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCK-RGYDGIPYERC---QDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTED-----DDLCANQQC----------GPNAICNL---------GQCLCASGFKGDDPNDLVEGCSSAAT----CQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQ--CGPNSFCITDNHQKSCICQDGFTGD-------ANDPQRGCQREEKCSTN-----------------EDCPAGRTCHI-----------NFNGEQT------------------CLDPCQIMSCPTNEKCMVSDGMPIC-LCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCN-EVSFGMKNCVPACDLVN-CPSGAECVSEGHRGYC-----------RCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGL----FVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSF------------------IPSP-TPEVLCEKNDRGD---LCPFGQCQTTCASSSQC-PPGQICKSGICAAGCSSNTHCEEGRV---CITG--------KCQDPCTE----TCGPNALCSPEFENL--CQCPEGFAGVPTAAQGCV--------------------RIPPTCTTDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKL------------------------CHTDKNCLQGEICVDKFCE---PG-CRTDSDCRLGEVCGAGGQCSCQPGY--------EMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGA---CRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVE------YPCEGFTCG-HGSCHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQN--GRCVDPCD-GFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDP-RECEQNL--DCPGD-------GKCDNFVCVKPH----------------EKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNP----SPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCI-------GRSSKRKVTNR------------------TGSIIAHL---ADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVP-CSSASDCPQSKTCSQGTCVAQCQLQGDCLQNE-----------VCNEGL-------CVQI------------------CNSNTQCQA-----------GLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSC-------RTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCI----SGCGSNRDC------------------PYG--EMCEGGQCRNPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQEC---------VVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLN-----PCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKT-------------------------------QFGCKARPEVEA---ESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICTK-------------------------------DPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCV-------------KEESCGTTACGPNMACQELYGQPVCECIPGFV-------------PKYPVSLGCVEPA-DDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCV----VDRVP--KPPIRP-------------------------------LPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDP-------------------------YYQCIVRGNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPP--PKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDP-PYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNPPEPLETDPC--SACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECS----EPI--------------------------DPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPCET--CGQHAICHIHNNIAACKCEDNYIDKPPNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKC--EPPKVSQPIDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRCIPAGCRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQYECKRHEECPSTLACRDFKCVDPC--DCAVGANCRVSNHKTTCTCPPGFTGDPYSR--DDPPRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFLFIGDFECKAPERPECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQKAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQYECLVDSDCPYTLACPNRECIDPCQ--CAANAECSVQNHKASCTCLPGFQGNAYTG------------------------------------GCSPIL--EPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIR-QVEPIEFGCQTHQDCPPS-------------------------------------------QVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSCLEIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQVECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPCNCGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCSTFECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRT----------MICKCRVG--WVPDSSRSCVFLP------------------TDTILG--------CVKDDECPKDSACINRMCKDPC--DCGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPC--ACGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVV------------------------------------------GCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKTC--------------PAGSGLILNEFEECVCPPGFVLDSQGICAPCRFDVGFIIENGRCICDYTKGFVLDLSGKKCV--CPENHSINDNGICEEEPECRVD---PNCT--------PFEYCEGFNRTC-----GDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKP 5753
            F  K +D C    L N C   A+C +L    VC C+PG  GD  + C  +  C ++  C   ++C        C       G+    C++      CR+N  C     C N +   + +C +       +   +  +  +   + C+   CG+NA C+   +   C+C+ GF G   D KI C                 D + C+ + L    CGV AIC  +     C C  GY G+   AC+ +          D   N  C P   C   +G       CQ         + C     CL    D +C   A  V       C D C  + CG  A C      A C C   +  +P  +S GC          ID                    EC+ S        + P    G CG+NA C        C C  GF G+  + C  +         C  +  C   V    C   N    +   +       +C+ D +C    VC N  C          N  E  +   C + C    C PN++C V N    C C  GF  +P  + +C+      C  N   +D +      + VC     ++ + LS  R    G     C +D  C  GE C    C+  CR   E   + +C++   ++ C L + CGVN+ C  +     C CPS   G+   SC+       S   CLP  Q   G+   + C   +NC +  +C    GGI                       C+ I    C S   CL N    +  C  G                C S++ C  +E C+                 N C+SPC    +CG  A C   N   QC C A + GN L       T C+ L EC             N C  G +C +     +C+    CP G   D       G   + C    +C   L+C   QC NPCS+                            QG+         CG NA C VS     C C EG  G P     C  L C     C       + G C   C Q   CG NA C     +  C+C  G  G+P + C       EC    CG N+ C    N   C C+ G  G+P+  C     +  C   +CG NA C     +P+C C      G P   C   +D+ +C  + CGKNA+CI     + CRC     G+P   C      T D     +  C N QC          G NA+C +          QC          P+   +  +   T    C ++ DC  +  C    HS    C DPC  ++  C  N  C   NH+  C+C+ GF  +       A D    C R+  C +N                   CPA +TC +           N N   +                  C+DPC+  +CP +  C V +  PIC  C  GF         D   GC+ D  C   + C  +++     CV  C L N C     C  + HR  C            C PG   +P   + C+   +  C+SN +C  +E C    G    +P      C   AVC+  NH   C C +G     F     +E  + + C  NEDCP N++CDRL+  C++PC    CG+NA C  + HQ +C C P +                  IP+P     LCE ND G+    CP G    T +   QC P G  C+   C A  +S      G+V   C+ G         C  P T      CGPN  CS        C C  G+   P   +GCV                    R+PP    D    +   +    PE   +  C       N +C  +                        C  +++C     C ++ C    PG C  ++ C   EV      CSC PGY        ++ +    D N C  + CG    C       +CSC     P   G    CR   +C    +C   LAC+       +KC DPC    C   A C VI H   CSCP ++ GDP      C + E       PC    CG +  C  ++  P C C  G      NC+   EC     C +S  C  ++    C    G   +      +P   CY   E    + C         PCD   CG  A C  +N +  C+CLP + G+P   C   ECV+N+DC  +K+C+NNKC D C   G CG+N++C++ NH P CSC SG+TGDP   C   +    PGD       G   N   +  H                   C+V  +C+ +  C    CKDPC     CGVNA C   NH  VC C  G++G+    CV+   T +     P    C  S           C  N +C        C     C   +V     C+  C   + CP + +C N QC DPC  + CG N  C V++    C+C  G+  +P    +P+V     PIT +  +          + C P     S C AN +C+ +     C    Q         I+C   C ++ DC   KAC NN+C+       G+ +  +V N                   T  I+  L    DPC  S CG N+ CRT +  A+C C  G  G P     PT  P C  +S+C Q++ C    C   C   G C QN             C  G        C +I                  C  N+QC+              +     C   C+ N++C + + C+  +C++PC      CGE A CT QNH   C CP G  GDP   C       RT    C  + N CG    C     A +C    +           C ++C+  +DC     C+   C     + CG+   C                  PY   E+ E  +   PC+   C PNS C+V     +C C   Y+ +      + EC  N +C    +C   +C++ C   N CG  A+C   NH   C CP+GF G+    C         + +R     P+ CG N+ C    G   C C     G P Q          C++  AC+N     PC   GSCG  A C V+NH  +C C E + G+P   C                                    C+  PE      E+   EC  ++EC+ ++ C++  C DPC    C  N +C    H P C+C    + +           V C  + + P +        ++PC  + C     C+ +   A+C C +                               DPC +  CG  A C  +  + IC C  G  GDP  SC              + + C  + CGPN  CQ   GQP C C+P ++             P  P    C+     DPC P  CG  A C VV + + C C  G  G+PF+QC  +EE P + C+PSPCG+ A C   D N   C C + Y GNP  GC PEC    DC ++++C   KC+DPCPG CG+ A C V  H PTC C  GY GDP+  C     VD  P  + P  P                                P+C  N +CP  + C    C DPCP  CG+ A+CRV NH   C C  G  GDP                         Y +C V  N+  C+C   Y G PPNCR ECV+  DCP D  C+  +C DPC+ +CG+ A C+V  H P+C C  G +G+P+  C +I   P  P+  C PSPCG NA C     +  C CLP + GDP  YCRPEC  + +CP  K C  + C+DPC + CG +A C   NH  +C CP    G+PF  C P+ P+     PC  S CG N+ C V  ND  +CSC    +  P   C+PEC+ +ADCP  QACL NKC DPC GTCG N  C      PI                          +PC P+PCG N+ C+   +  A C C  +Y+G PPNCRPECT +  CP  L C+++KC DPC G+CG NA+C                                         V+ H+ +CTC+ G+ G+P++  C +K  A  +   PCEP+PCG NA C E N  GSC C+ DY+GDP+  CRPEC  NSDC   +AC++ KC+DPC     CG+NA C  + NH   C C+  Y G+P   C   P   + +   + C+   CGP S+  + NG+  C+CLP ++G+ P+C+  CV+NS C   LACIN  C+ PC  + CG NT C V  H   C C  GY G+P   C   P   + +  +DPC +  CG +A C    N  +C C   Y   PPNCR EC ++ +CP +LAC   +C  PC+  C   + C+V NH P+C C   + GDP   C   P      IDPC  NPCG N       +N IC CLP + GDPY GC  EC+++ DC ++RAC  N +C +PC G CG  A+C+V  H  +C+CP  + G+ F++C                  D   RD C    CG N+ C   +    C C+ GF G P     + EC    EC  T AC + KC++PC   C + A C+V NH   C+C    TGDP+ R    PP+P + T                     +PC+ +PC   A C V      C+C  GFL +  + CK    PEC+S+ ECP HLAC++++C +PC   +CG NA+C V +H P+C C  D+ GDP+T C     +  +  PLS          PC    CG NA C     V  CSCL  Y GNPYE CR  EC+VD+DC   LAC   +C DPC   C   AEC V NH+ SCTC+ G+ GN +                                       C PI    P     +C    DC    AC +  C++PC     CG +S C+V     K    C+C++G+T +    C +  V P      T   C PS                                             C    C +PC     C  +A+C V +H+  C+C    TGDP++ C             +  +  +  +  +PC+    PCG   +C+      +C C  E+ G+P   C   EC+ +NDC N +AC+ NKCVDPC    CGQ A+C    H+  C CP G+ GN  V C  V                 A      CN   C   + C   N +  C C    +G         P      C I  DCP   AC ++ +CQ+PC     C  +  C VI+ +P    VC C  GM    G   I    L+    + K +     LN    SPC  G  A C VIN    C C  ++ G+P     + EC ++ +C +   C +  C DPC+  N CGINA C   SH   C C PGY GDPF +CS           P +F +      PC  + PCG NA CRV Q+  SC C     G+P  GC P          EC ++SDC S+ ACI   C++PC     C ++A C V++  P  T          + C   V    + D+   C   P                    T +G        C    +C  + AC N  C DPC   CG+G  C +  H P+C C  G  G+P I C  +          P +  P+  C+P     SPCGSN++C  +     C    + + T P  R  C  P                         +C   +ACI   C+DPC  +CG NA CT+ NH P+C C + + GDP I C+ +    N   + T  C           +  PCG +A C    +  +C C P   G+PYV C   EC  +++C+ D+ACI  +C DPC     C   + C V NH   C+CPPG  G    SC  + V                                           C   SDC    AC ++ C+NPC     CG+ AKC V++  P+    C C   Y GD  I+C  +K                P     ++N+   C C P +   S   C P             CI ++          +KC   CP        G+C E  EC V    P+C         P+  C    R         PC+ + CG  A     D    C+CI  Y G+P   C P  +  P
Sbjct: 2546 FDHKCVDPC---SLLNVCGHGADCSSLNHSAVCTCQPGGTGDPNLGCTPLQYCKSDSQCATGSVCNGGICTALCGSTRDCIGD--QLCINGLCQPTCRSNSSCPEYQYCHNNICVQELRCTSDNDCSDDEKCIKNNIGQAECHRACDVILCGRNAECKADDHAATCSCKHGFFGNAKDDKIGCQPIECEVNDDCTQEKICDSHRCRIACLAHNPCGVNAICTTEKHVQVCTCQPGYTGEPTHACKLI----------DYCANVPCAPGALCENTRGHF--KCHCQPGTVGDPYNSGCQPPVECLQ---DVDCPLTAKCVNINNVPKCFDTCARIRCGPNADCVASNHAANCQCRADYEGDPNNLSVGCRPRPVVCSSQIDCLVNTYCYEGICRPSCQSDEECNLSDVCLNGQCLDPCDVRGTCGINAECKVRSHIKQCSCPPGFTGNSEVECVRLPVSCLGSGDCNGDNTCRENVCLPVCTVDNDCALNEKCIR-GNCLLTCRLDNDCFLGHVCLNNMCSFGCRADEDCNANEACLENKCVNPCEATPCGPNAKCTVFNQRATCSCSTGFIPNPTAKVACLRTPGPICQAN---RDCVVGTSCIAGVCTPVCSSSANCLSNERCDNSGICKSLCRRDEDCRSGEICEGLVCISGCRADIECQDSYECINNQCIDSCSLTSACGVNAKCTIVNHQKICTCPSPLVGDARISCKQTFLPCSSELECLP-GQTCYGKSCYSTCRSDANCLSDERC---DGGI-----------------------CKTI----CNSDDHCLANQICHNRMCDIG----------------CRSDNTCPSDESCIN----------------NQCRSPCDGGKACGECAGCRVVNHVAQCSCPANYYGNALINCAKTMTPCDGLCECDEIGFCTTSCHHQNDCSCGEVCHSGKCRIKCDINNACPKGYVCD------GGLCLIGCRTHSDCPSSLSCTNGQCENPCSA----------------------------QGS--------PCGINALCRVSSHRAVCLCPEGYQGEP--SQECYQLECHHDDDCELNKHCSEYGVCTNPCLQHGVCGFNAQCRVINRKAQCSCPPGHFGNPKINCK--KGGDECLRRPCGINAKCRETLNGFECTCDPGCHGDPHQVCFCDGDL--CKDTRCGINAACRIYKNQPQCYCPPNNPSGDPMHACSSDRDLGDCRTNGCGKNAECIRDGAIFVCRCPPGTSGSPDIECTTERECTSDLECPNEKACINLQCLDPCALRGACGINALCRVVLHKPRCSCPQCYIGMPHTACHPDSKCDTLNPKPTPSIGCSSDYDCPESLSC----HSQTGECRDPCLSSRYTCEVNKRCQVRNHKPMCVCKYGFVVNEIGELTCAPD-TLTCSRDFDCPSNTACVNGKCQNPCNVRNKRPCPADKTCDVLDHRPVCICTKNCNPSLSICLRDSGCSPDLACRNYRCVDPCRNSTCPADAPCYVEEHKPICKFCPPGFVP-------DTKYGCMKDVKCTTHNDCPIQLACVNHQCVNPCTLGNPCDFIEACHVQYHRPVCVKVESNEAECPYCPPGMQCDPATNT-CI---KAGCTSNKDCPLTEACI---GHACQEPCLVRNPCAEHAVCINTNHGADCSCEEGYHGNGFSYCDLLEETKNI-CQYNEDCPPNKYCDRLNRQCINPCVEFDCGDNAKCVSSNHQAQCTCLPGYQGNPHIGCQEIVLTVDPCIPNPCGLNALCE-NDNGNPVCFCPKG---LTGSPFEQCIPEGDQCEGNPCGA--NSGCRVVSGQVKCFCLPGYEGHPPNFPCTLPSTSCDPSPCGPNTRCSVLDNGFAKCTCLSGYIESPNTIRGCVPKADQCEFNPCGFGARCNSTRVPPCYCPDLTIGNPYKSCGVRPE-KPYDPCLLSPCGKNAICTAIDGIAKCTCIPPFVGNPYIDGCEAECIINRDCESHLACFNQHCRDPCPGVCGANAHC---EVVDHLPMCSCLPGYTGDPFRACKVEKPLVPDQNPCMPSPCGPHSICRVMNDRAVCSC----SPGYQGTPPHCRP--ECLVSTECPAHLACID------QKCNDPCP-GLCGLNADCQVINHNPICSCPRQYAGDPFT---QCVKEEPLPPTTNPCLPSPCGPNADCRVQEDHPICTCISGMFGAPPNCRP--ECVIDQDCISSLACIQKKCLDPCVGSCGFNTNCTVLNHRPICHCYEGYEGDPFSGCAKVVFPVQLPCDPSPCGTNAVCKERNGAGSCTCLPDYTGDPYEGCRP-ECVQNSDCAHTKACINNKCKDPC--VGACGINAQCQVYNHQPSCSCLSGYTGDPLTSCHIPIKPSTPGDTCQPSPCGPYSNCRVIDNHAVCSCQPNYIGSPPSCRPECVVSTDCSPNTACINQRCKDPCL--GTCGVNADCRVINHNPVCICAIGYSGDPFFGCVKEEITPLPK---PSGNPCVPS----------PCGPNSQCRVIDGFPACS----CLPNYVGRAPNCRPECVINEGCPGNLACQNEQCVDPCPGS-CGVNTYCNVVKHNPVCICNEGYTGDPFTECTPIV---EAPITTEQPR----------TPCNP-----SPCGANAVCNERNEVGSCTCLPQYFGDPY---IACRPECVTNTDCDRSKACLNNKCVNPCPGTCGQDATCRVVNHAPMCSCLPGYTGDPVNGCTIIIVTPLPVPIDPCDPSPCGPNSNCRTHDGHAVCLCQPGFSGVP-----PTCRPGCIVSSECSQNRACINNKCADPCP--GSCGQNTNCLTVNHNPICSCASGYSGDPFVHCTRISTTSPSPKGEGDPCLPNPCGPNSQCRVIGSHPACSCLQNYIGRPPNCRPECTDNSECFNTAACINQRCKNPC---PGACGEIAKCTVQNHVPICTCPEGYEGDPTVRCVLASPPDRTVSNPC--SPNPCGPNAQCRERNGAGACGCPPDLIGDPYDIIKGCHRECETNNDCAPQLACVGFKCTDPCPNTCGTLSICNVQAHVPVCLCPPGYTGDPYFACEIEEMIKTLEPCSPSPCGPNSKCRVVNDQAVCTCLPEYRGIPPS--CRPECIVNAECPLHLACINKKCVDPCP--NICGLKAQCITKNHNPICTCPAGFTGDPFTFCSPHVITEIPITERPPSCTPSPCGPNSLCQIISGNPACSCLPNYIGVPPQCRPECILSTECKSHLACVNQRCADPC--PGSCGINAQCHVLNHLPVCTCMEGFTGDPFTQCSIIPLGKNIEQLTESPSTDPCALSPCGPNAICDNGDCRCLPEYIGNPYEACRPECILNSECARDKTCLKNKCKDPCPG-ICGQNAQCDIVNHIPVCSCPSGYIGDPF---------VSCRVQPRVPDSR-------KDPCTPSPCGPNSQCRNVEDHAVCSCLQGYLGSPPSCRPECLVSSECPPMRACVNKKCTDPC-LGSCGLNARCEVINHSPICSCLPGQTGDPFRSCYDIPNISVPPEPKDRGDPCNPSPCGPNALCQNTNGQPSCSCLPTYIGTPPSCRPECLINPDCPPEKSCINMKCKDPC-PGSCGDNAECKVVNHAVTCSCKLGYTGNPFVQCV-LEEEPMNPCEPSPCGANAICQQRD-NAGACICIDDYQGNPYEGCQPECVLSADCSTNKACVRNKCKDPCPGVCGVRAQCSVINHIPTCTCEPGYIGDPFTTCTLQPEVDTEPTVRNPCSPSPCGPNSLCRAVNNQAVCTCQESFVGVPPNCKPECVVNSECPQNRACYKYKCTDPCPGTCGIEANCRVINHNPLCSCPQGKTGDPFSRCFPEPVVPLPPVDPCFPSPCGLYAECKVVNNQAACTCLKNYIGIPPNCRAECVVNTDCPSDQACISEKCRDPCIGSCGQNADCRVQNHIPVCLCQLGYSGDPFTLCTVIREQPKIPEDLCSPSPCGPNAECN----EGVCRCLPNYFGDPYSYCRPECTMNSDCPRVKTCINQNCVDPCPDTCGRDARCDVVNHVPMCSCPPGYTGNPFLLCRPHIPDDTIKQPCIPSPCGPNSICKVV-NDHAVCSCQPGLISSPPT-CKPECVISADCPLTQACLNNKCQDPCPGTCGQNTNCQVVNHNPICSCSESYTGDPFTICYPQPKTPPALMNPCLPSPCGPNAECQVRGDNPA-CSCIENYVGLPPNCRPECTINPECPPQLACMQQKCRDPCVGLCGPNAQCS----------------------------------------VVNHHAICTCINGYTGNPFS-ACEQKINAPLDIRKPCEPSPCGINAVCRENNGVGSCTCLPDYLGDPYQECRPECTQNSDCLTRMACVNLKCRDPCP--GTCGVNAQCQ-SVNHLPICICIPGYTGNPFTLCS--PIVEILQPETNSCSPSPCGPNSKCRDINGLAVCTCLPNFIGSSPNCRAECVMNSQCSQDLACINQKCISPC-PDPCGINTQCRVIGHSPICICNLGYTGDPFTRCFPAPHFPVVS--KDPCLSSPCGIYAECRNIGNTPSCSCLPTYRGSPPNCRPECRVNSECPMNLACNNERCRDPCLGSCSITSLCTVYNHIPVCTCPEGFTGDPFTNCYLRPTTAPAVIDPCNLNPCGPNAR----CNNGICICLPEYQGDPYVGCRPECVMNTDCAHDRACMRN-KCIDPCPGTCGRNALCSVYNHVPMCTCPTGMAGNAFVQC--------------SIVEDIPKRDSCSPSPCGPNSVCRENNGQPVCSCVAGFLGVPPA--CRPECTVSSECILTEACSNQKCINPCLGACGIQATCQVINHNPICSCG-ELTGDPFVRCIPRPPKPVLQT---------------------NPCVPSPCGANAECRVVGDAPSCSCLAGFLGLPPY-CK----PECISNSECPAHLACMNQKCRNPCEG-SCGANAECRVVSHTPMCVCPSDFTGDPFTQCTM---KPPTPLPLS----------PCKPSPCGFNAICKEQFGVGSCSCLPDYIGNPYEGCRP-ECVVDTDCISILACVQSKCRDPCPGVCGQFAECQVINHRPSCTCISGYSGNPFQYCTVIRDVGTNIFLNTCNPSPCGPNSQCRVNNNQAVCSCLPIFIGNPPACRPECVTSSDCSLNLACLNQKCQDPCPGS--CGRNSNCRVI----KHNPICSCKNGFTGDPFTVCFQIPVSPPVVSDVTRDPCIPSPCGMFSECRDIGGVPSCSCLPTYRGSPPNCKPECTINAECSANMACMQQRCKDPCPGS--CGIMAECSVINHVPICSCLPDYTGDPFIEC-----------SVKPRKIPHPPSKPDPCTP--SPCGPNTQCNG----GICVCIAEYFGDPYSGCRP-ECVLNNDCLNTRACVRNKCVDPC-PGVCGQNAMCDVYNHVPMCTCPSGMDGNAFVLCSPVP----------------APPISNPCNPSPCGPNSQCRENNMQAVCSCISGFIG--------APPTCRPECVISSDCPKNEACTNQ-KCQDPC--PGSCGRNTICNVINHNP----VCVCRSGM---TGDPFINLSQLILIGITFKAEDPLPVLNPCQPSPC--GPNAQCQVINDQASCSCLQEFIGSPPNC--RSECNSNSECSNKMACINQKCRDPCI--NACGINAVCNVVSHTPMCACTPGYTGDPFTQCS-----------PQQFDIQPSISTPCTPS-PCGANAVCRVQQNAGSCSCSTDYIGNPYEGCRP----------ECTLNSDCPSNQACIGLKCKDPCPGT--CGQNAQCYVINHAPTCTCFEQYTGNPFIFCNLIVEAPIIADNINPCQPSPCGPYSQCRESNGQAVCSCLPTYIGAPPGCKPECTVSTDCATNRACENNKCVDPCPNSCGQGTTCRVVNHSPICICKPGFSGDPFIRCLFV---PPTPSYLPSL--PSDPCIP-----SPCGSNSQCRNINGYPSCSCMINYIGTPPNCRPECVIPA------------------------DCPSNQACIREKCQDPCPGSCGLNADCTVHNHIPICRCIESYTGDPFIGCQPIPIY-NEPIQPTDPC-----------NKSPCGPNAQC----NNGICICLPEYFGDPYVGCRP-ECVLSTDCSTDKACIRNKCVDPCP--GTCGQNSLCNVINHTPMCSCPPGTSGNAFISCDVIRVPSVTRPCSPNPCGPNSICRELNEQAVCTCAPEFLGAPPLCRPECTLSSDCRPNEACANQKCKNPC--PGTCGIQAKCVVVNHNPV----CSCPERYTGDPFIRCDIMKPIAPVVINPCQPSPCGPYAQCQVVNDLPSCSCLPEY-RGSPPYCRP------------ECISNHECPSHQSCVRQKCRDPCP--------GLCGENAECHVIQHVPHCVCTYGLTGDPYTRCSAIPRPIELEPISSPCVNFECGANAICKERDSVAICQCISSYVGNPYLACRPECIINP 8479          

HSP 8 Score: 471.47 bits (1212), Expect = 2.354e-128
Identity = 717/2697 (26.59%), Postives = 1008/2697 (37.37%), Query Frame = 0
Query:  111 PDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKD----IDECQIPEL----------ANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTN----QVCGINTLCINTHGNFSCECLPGFHGNP---HDGCVDIDECRTNP--------------CGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQV-----APSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDI---------------NECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNG---SCACRKGF-------QPNGVLCQDIDECQST---------ENPCGANSICLNVPGDYECQCIAPLVG----------TPPEQPCRDPCLEVNCGQRASCQIVKSEA-FCICEEGWAYNPKEISSGCLDIDEC--------DKSISP-TGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAE--------NRFICGREALCTNQVGSYSCQC---YNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQC-LP----GFKL-SPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDP--LSGCRGESTFECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLA-DCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSA----CSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAEC-TPSNPPQCLCKAGFTGNPLTGCEDL--------------------DECALNPCKQGSICI-NKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPT-CQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECT---CKRGYDGIPYERCQDV---DECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDD----DLCANQQCGP---------------NAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQT-CLDPC-QIMSCPTNEKCMVSDGMP----ICLCNSGFEKNKLTGSCD-VYQG---CLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDD---RSGCMIFS--QNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQ---IEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCT--ETCGPNALC-SPEFENLCQCPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQG-------EICVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKNNI-CGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQ------CSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPC--DGFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELL---ECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGP----VCSCNSGHTGDPR------------ECEQNLDCPGDGKCDNFVCVKP---------------------------------HEKSCLVDINCNDDQVCSRSECKDPCQQPNA-CGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLD-KMCKVGCSAPKDCPNSQSCINHQCQDPC-KAAQCGPNALCQVIE----RQAFCVCQRGFIPNPSPVVACTREPITC-----------QGNKQCPENFLCDASFCKPVCFADSDCEANE-------LCHGKICKE----VC--RSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHC 2521
            P  + C+  PC     C N  G   CSC   Y+G    C+       EC I                C  NA+C  L     C C P   GD  V+   +     N      CG  + C +  G   C C+P + G+P      C    +C +N               CG  A CT +     C C  G +GDP+     A +      P+V+   CN   CG NA C+      IC C   + GDP   C                  N+C    +  CG  A C   +    C C   Y GD    C+ V+ R        C  N+ C   G   SC+C  G+       +P  ++  D ++ ++          EN CG N++C+    +  C+C     G          TP  +P RDPC    CG  + C +       C C   +  +P      C    EC         K   P  G CG NA+C  +     C C + + GDP+  C +I             +   CG  A C  +     C+C   Y G  Y      C      C   Q CI           CQ+P  G          TC   + C V N +P C C LP     F L         ++D C  +PCG + +CE +  + +CKC  G  G P  ++GC  E    C   S C   ++C+ S+C       ++P             NVCG  +VCK +  S  C CPS   GNPF  C +    +  C P   +  G C++  D + C  P +CV  +      AC      +P    C     CQ + H P               CSCP G  G+      +P        C+ NS+C  ++ C   KC+                 PC   SCG N+ C    +   C+C  G+TG P   C  L                    D C +  C   ++C  +     +C CP G TG+PY       +  EC +D++C   L C   +C+NPC+   C   A C   NH   C+C  G+     GN  + C   +     +C V    P+   CF G+  +P          C+   PC+   +               C V        + C C   F GD T+ C+P  +Q   ++ C ++S C                 P   C     +  C    C  NA C   + +       C+   +    + C +    D C  + CG NA+CI       C C     G+P   C   E  T++D      C N  C                  A+ +  QC+C  G +GD     +     +A C  N DC  +E C  +    +R C   C    CG  + C+  +HQ  C C  G TG+   P   C  E   S   +C     C +N     T C DPC     C + ++C V +  P    ICLC S    + + G C  +  G   C  D DCA   +C         CV AC    C   A+C S  H G C C   ++GN      R   +     + +C +N+ECA  + C  S       P  +   CG  ++C V NH   C CP G ++G+P+   I       CV N +C  N  C  ++  C++PC    CG NA C V  H   C CPP +  S  P++ C K D                                  C S++ C+    C  G+C +PC     C  NA C      + C+C  G+ G P     C R+      DCP +  C +G C+  C  +  CA+   C     +  C   +N   G            +  EP C+ D DC    VC            E     C  +  C  N  C    T      + IC+CP   + D  G CR P Q      C+++ DC+D   C+       ++C +PC+   C   A C V  HK  CSC   ++G   NP+I CY VE       C H S           C        +NC  ++ C   + C  +A+C        C C  G  G+P  + C+    CYSN +C  D  C N +C+DPC  D  C   A+C V NH P C C   + GNP I C+L    EC E++DC  S +CL+NKC   C +   C   S CR+    P    VC C SG+                 EC ++ DC  +  C N +C  P                                     C  D +C+   VC +  C   C    A CG NA+C   +H+ +C CPPGF GN +V CV +   C  +S+CP +  C  + C + C   N C  N  C+    ++ C      ++G +       K  C A  +CP+  +C N QC +PC K A CG NA C+V++    R   C C  G+  N   ++ C + P               GN  CP  F  DA+     C   S+   NE       L  G    E    VC  R   +  +K  C+ I   + CR + DC  D+ C            KVT+          DPC    CG +A C T  HQA+C C  G  GNP   C
Sbjct: 11074 PIGDPCQLSPCGPNSRCLNVNGKASCSCLPTYQGIPPDCRPECIVSTECPINRACVNQKCVDPCPGVCGINAKCDALSHSPFCSCGPSQIGDPFVKLMPVPTLQVNPCVPSPCGPFSTCQDKGGYPFCTCMPNYIGSPPYCRTECSINSDCTSNKACIREKCRDPCPGSCGFNALCTVIKHTPTCTCLNGYTGDPFSNCYLAPMPIPTEIPTVTSDPCNPSPCGLNADCRNG----ICNCIPEYHGDPYRECRPECVQNSDCPFNRACANNKCVDPCVGICGQNAECAVINHVSTCSCVKDYEGDPFTLCKRVQSRVKPCEPSPCGPNSICREFGDQASCSCLSGYFGIPPSCRPECLVSTDCEQSKACVNMRCRNPCENACGQNALCVVRNHNPICRCPVQHSGDPFINCFPITTPDVEPTRDPCYPSPCGLNSQCAVSADNIPSCSCSPTFIGSPPNCRPECHVNSECPTNQACIKQKCTDPCVGLCGFNALCQVTLHQARCTCPESYTGDPFTVCSEIISIPTPPVSSKPCSPSPCGINAYCHERFDIAICECVPNYRGNPYQGCQPECL-VNTDCSKSQACIKT--------KCQDPCPG----------TCGVGATCTVSNHVPICSCPLPTIGDAFTLCQVPVEDTKEMDPCYPSPCGPNTMCEKIGNTAICKCLPGLQGVPTSITGCHPE----CVLSSDCPGDKACIQSKC-------KDPCSQ----------NVCGSKAVCKTINHSPLCSCPSPLIGNPFEECYT-KIETNPCSPSPCNYNGECRVRNDVAVCIYP-ECVINSDCPRDKACFSQKCKDPCIGACGINSICQTVNHKP--------------ICSCPIGFMGNARVQCTIPALEEPIPECTQNSECSNDKTCFNQKCV----------------DPCTLDSCGLNSRCHVQMHRAICICNDGYTGYPQQYCHQLGCRSDSECSLIQSCINNECVDTCLVTQCGINAMCTADGYHKTRCYCPDGYTGNPY----EICERPECTSDNDCAPSLVCRNLRCVNPCN---CPPPALCNVVNHRPICKCPPGYV----GNPYTSCLMDLLEPETECQVDADCPSKLACFNGICKDP----------CTETKPCIVSAK---------------CSVVDTLPMRTMICECLPNFAGDATVACVPVDKQI--AAVCESDSQC----------------TPDMACLNRRCINPCTVNPCSPNAECHIENHRQNIVLAECRINTECPSDKACINQLCQDPCSSNRCGLNAECITINHHPSCHCQHGLAGDPQAQCFRPECKTDNDCPYDKTCRNDNCISPCFIGDVVCGRSAECRAVSHRAQCICPQGTQGDPRVACI-----SAICHYNEDCADHEACDRL----NRVCRPVCDDDACGETAICVARDHQPKCTCPLGTTGN---PYVTCIGEP--SIEPECTQDNECTLNLACINTKCQDPCISAGMCTSEQECKVLNTEPLRTMICLCPSNTITD-VNGQCKQIVLGDVQCHLDQDCANYETCLN-----GKCVDACLTTQCGFNAQCKSTSHTGICFCSQDFTGNAYIECIRVPVVPLPGPRPECYTNSECARDKQCINS---LCVNPCVAGDPCGKSSLCHVDNHNPICKCPIG-YIGDPKTKCIPPEITPECVSNSECAGNYAC--VNGMCINPCN---CGLNAKCNVINHYPSCVCPPGY--SGNPQLGCFKLD----------------------------------CESDSECDYAATCYNGQCVNPCILDNKCAINAECYGKNHRSACRCGPGYYGNPQIH--CERVECNTDHDCPHNLACNDGRCINPCAENSLCAQNAVCYVQDHIASCRCPENIPLGNPFSYCERHTAVEIEEPECKVDIDCLDKLVCI----------REKCIDPCPVIKPCLENARCDVLDTVPVR--TMICTCPEGWITDVDGVCR-PIQLTVIGTCTTNDDCSDRETCIN------RQCRNPCN---CGTNAACYVKNHKPICSCEQGYQG---NPEIACYSVE-------CQHDS----------QCTLDKTCKNNNC--VNPCLVTDLCGTNAECFPNNHVADCRCRKGYHGNPLDR-CR-VIGCYSNGDCPGDHSCINMQCIDPCIHDNPCSPRAECRVLNHLPICRCPSGFTGNPYINCQLEVRPECREDSDCPDSLACLSNKCQIPCPIIQPCTEPSECRVLPTHPIRTMVCVCPSGYVSSGSGTCRATKPILKIECTKDDDCSSERSCVNAICKDPCACRPNAVCNVINHKPICSCTLGYDGNPDILCTRVAGCKTDNDCSGSHVCVQRNCVPACSPSLASCGKNAVCHGIHHKAICECPPGFGGNPRVSCVLL--GCRTNSDCPTNKACINNRCENPC-IQNPCTDNMDCNVYNHIVECACPPG-YIGDIKSGCTKVKEKCKADNECPSQTACFNGQCINPCTKIAPCGINAECKVLDTSPIRTMICECLPGYRGNA--IIRCDQIPAEICPIGKGQIRDEYGNCVCPPGFGKDANDVCIPCRKQSNMVINEEGFCVCDLEKGFSIDEYGRCVCPTRYGYEIDTKGYCRQIGVIE-CRHNDDCADDRYCD-----------KVTHT-------CQDPCKKQQCGVHALCNTTRHQAICICINGYLGNPYTQC 13502          
BLAST of GH13743 vs. nr
Match: gi|195052558|ref|XP_001993322.1| (GH13743 [Drosophila grimshawi] >gi|193900381|gb|EDV99247.1| GH13743 [Drosophila grimshawi])

HSP 1 Score: 2701.78 bits (7002), Expect = 0.000e+0
Identity = 2231/6680 (33.40%), Postives = 2998/6680 (44.88%), Query Frame = 0
Query:   11 QLVGRQPNDLSIDKG-VFFLNVEDGFFGCQVNASVDVLQLFEISKLCDGVPDCYRGSDEANSQIKCTKDCLYTTGRHCQHGACLDSQCYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDECRT-NPCGIGAKCTNLLGNYQCQCPAGLSGD--PYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGY---------------------NGDGRFACEPVKVRTTCSSDFD------------CTNNAQCL---PNGSCACRKGFQPNGVL-CQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRD----PCLEVNCGQRASCQIVKSEAFCICEEGWAYNP--------------------------------------KEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDP------------------------------------------YIGCFDIDEC--AENRF-ICGREALCTNQVGSYSCQCYNGGQYDPSS--LSCQEKRR--SCQSDQECI--------------------------------------GNAVC-FNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGF---KLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLS-GCRGESTFECTQDSQCDQGESCL------SSRCVCRRGYERNP-AGDCVDLNECL---LGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSN---CEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQ-GKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGC---SGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNS-CACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDD------------------------DLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQ-------REEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVS-DGMPICLCNSGFEKNKLTGSCD--VYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQR--SCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQ--IEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTC-------ASSSQCPPGQICKSGICAAGCSSNTHCEEG-------RVCITGKCQDPCTETCGPNALCS-PEFENLCQCPEGFAGVPTAAQ-GCVRIPPTCTTDCP-ASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKNNI-CGAGKTCANTPGSYICSCPT----NQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPC-DISYCTPLATCNVIQHKAFCSCPPK-FRGDPTNPKIGCYQVEYPCEGFTCGHGSCHPED--HAPKCHCQDGYQLIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYT-QGCKPKAQCYSNSECSSDTRCQNGRCVDPC-DGFCGIGAKCVVKNHSPKCSCLPRWRGNPK---IKCELLECVENADCDASKSC--LNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGH---------------------------------------------TG--DPRECEQNLDCPGDGKCDNFVCVKP--HEKSCLVDINCN----------------------------------DDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMC--KVGCSAPKDCPNSQSCI-----NHQCQDPCKA-AQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVC----------------------------------RSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEH---CQPTLVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQAGLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCRNPCNGFECEPNSFCQVNGRNPLCLCDRGY--QRLASGGCAKT---ECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINS--AGELICPQQDVQ--CLYEDQCPSTLSCIDGACQNPCQG-TSCPDGKSCQVLNHQALCICTKDPCSISPCGDEAICRAVEG-NAICECPEGTRGDPLDSCVKEESCG----------TTACGPNMACQELYGQPVCE---CIPG-------FVPKYPVSLGCVEP-ADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPKDACQPS----------------PCGSKANCNINDENQAICSCWEGYFGNPLTGCLP--------ECQTDQDCPSDQSCNNLKCQDPCPGF-------------------CGIGASCEV-EQHKPTCRCREGY-KGDPYRQCVVDRVPKPPIRPLPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADC---RVQNHQVQCFCQPGFKGDPYYQCIVRGNREVCSCQPGYFGGP-PNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQI-----------------------IVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNPPEPLET------DPC--SACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECS----------------EPIDPCQP--------------------------------------NPCGLNSVCESNVNGLALCRCQNDYIGSPP-NCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEIID-------------------PCANRECGPYSQKVERNGICTCSCLPGYVGAPPDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPC--ETCGQHAICHIHNNIAACKCEDNYIDKP-PNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDP-----LVKCEPPKVSQPIDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRCI--------------------PAG------------------------------CRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQY-----------------------------------------------ECKRHEECPSTLACRDFKCVDPC--DCAVGANCRVSNHKTTCTCPPGFTGDPYSRDDPP-------------------------------------RPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFLFIGDFECK---APERPECVSDP------------------------------------------ECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQK------------------AGCQSNSECPL---------------------------------SEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQYECLVDSDCPYTLACPNRECIDPCQCAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKEC---IRQVEPIEFG-CQTHQDCPPSQVCNNAA-CINP-CTTQNPCSSLAKCYVQ-------------------DHMGKCACPAGMTGDPYVSCLEIVTG-------CKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEF-HISHCFCPPGLQGNPIVRCFQVECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSL-VGCESSSKCKADQACLNAKCVSPC----NCGTGALCDVINHTPICYCPPKYSGNPQIACEK-----LECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCSTFECLTNDECPPTKFCMVNQCLDPCVVNE-PCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLAC--IDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPCD----CGRGAECFLTGHRP----VCRCPEGTKGNPLIECTPI-------GCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALC----------RSTCHVVDTS-------------------------------------------PVRRIVCECPKGYFTNENNQCLTLTPIV-VGCTSDDECGDARACINAICKDPCACGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYE-GTRGNSC--KKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTP-VKTCPAG--SGLILNEFEECVCPPGFVLDSQGICAPCRFDVGFI--IENGRCICDYTKGFVLDLSGKKCVCPENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRTCGDPCL-KWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPI 5748
            Q     PN  S  +G VFFLN+EDG+FGCQVN S D LQL+++SK+CDG  DC+ GSDE + ++KCT DC    G  C +G CL+  C+CNDG+GG  C   D NECK RPCDVF +CTNTLGSF C+C  GY G+GF C+DIDECQ P +A+ CV+NAECCNLPAH++CKCK G+ GDG+V C DIDEC   Q CG N  C+NT GN +C C  GF GNP+DGC D+DEC   N CG GA CTNL G+++C CP G  GD    QG         V    C    CG+NA C  +     C C +GF+GDP   C D++EC  ++   CG+GA C+N    ++C CP G+                      GDG     P +      +  D            C  NA+C+    +  C C  GFQ  G L C++I+ECQ  +NPCG N+IC +  G + C C +   G  P + C D      L+  CGQ A C+       C C +G+   P                                      + I S C+DIDEC         CG +A C N+PGS+ C C  G+ G P                                            GC DIDEC      F  CG+ A CTN  G++SC C  G   DP S  L   E R    C +  +C+                                      GNA+C     C C EP +G +C   C    C  ++QC++ NG   C C PG+      P G  C DIDEC  NPC  +AIC N  GS++C+CP G+ GD    GC    T  C+  + C  GESC+      SS C+CR+GYERN  +G C D++EC        CG+N++CKNLPGSY+C CP G  GNPF  C+ CS + C C  PY+ +   C LA CS+   C + A+C+ I GG+SYCACP+GY+  P   +C D++EC+  G   C  GA C+N  G +SC CP G  GD + G C P +  C+++ +C  NE+C+Q G+C+C PP+F+D  D N CKSPC RF CG NA+CTPS+PPQC+C+ GF G+PL GC D DECA  PC  G+ C+NK   YQC CP G TGDPY +GC   +G     C  +++C   LAC+   C++PC+S+ CGSNA C  + HA WCRC+ GF +++ G+CVS C  VICG  A CI +  GPTC+C +G +GNP+PGG CS   C+++ PC E+ Q C  GRC  +C    CG+ A CD N   C C+  F+G+P L+CMPP +QA+CS  CG N+HC YG   S CACN G +GNPY GC        C    CG NA C     +  C C +G+ G PY  CQDVDEC    CG NA C+NT G ++C C S   GNP+  C  +E+    D                        +LC+N  CGP AIC+ G+CLC  G+ G DP+DL +GC+    C  + DC + EIC  +   G R C D C + QCGPN+ C+ D+H+ SCIC DG+ G+ ++ Q GCQ        E+KC T++DC  G  C  +  G + C++ C  + C  NE C ++  G  IC C   F  N +  SC+      C +D +C    +C     G+  CV  CD   CP+ + CV+  H+G C CL G++GNP+DR+GC    +++C  NAEC ESE C +    +  SC+ AC  ++CG  AVC+  NH  +C CP G + G+P     GC+ V CV N DCP N+ C+R+++TC D C  E CGENA+C    H+  CQCPP +  +P PEV C K      C  G C TT         ++ +CPP  + +    + GC  +  C  G        +C  G+C +PC   CG NA C     + +C CP  F  +  +A+ GC R    C TD      LC+NG C   C +   C+ GE+C   +C+  C     C +G  C++  C  GCR++ +C+  + C  G  C               L+ C ++  CG    C+       C+CP     N  P E G  R P  C +   C     C+ +      +C  PC   S C     C     +  C        G+  N    C   +  CE        C P +   + KC C  G+      C DI+EC    PCH SAKC N  GSY+C C +G VGD YT QGC    QC+ + +C++   C +G+C DPC    CG  A C  + H   CSC   + G+P    + C  +EC+++ DC + ++C    N+C+  C L+  CG  S C++ +H  +C CN G+                                             TG  DP EC  + DCP    C N  C  P  H+ +C ++ NC                                    D+ C  ++C DPC  PNACG  A C+ +NH  +C+C  G TG++K  CV +   C  D+ CP    C   IC   C S+ DC   + C +G C  TC  ++ C     C + +C  ++ C+   DC   ++C+        C+  C   A CG NA C        CVC+ GF  +      C +  I C  ++ C  +  CD   CK  C     C  N LC  +  ++VC                                  R   +C       G   ++GCRS  +C     C  +      +K     +   + AHL        CG NAEC  K H A C+C  G +G P +    C+P  VPC   SDCP +  CS   C   C L  +C  +EVC  G C                                           DPCQ +   CG+ A C   +H  QC CP G +GD  + C    + C      C  G  C   +C   C    EC   E C  G C+  C++ +DC  G  C+   C+ GC  + DC   E C   +C NPC    C PN+ C V+     C C            GC +T   EC  N  CS+  +C    C  LC++   C  N  C+    +  C                 R+D    N+C     CL    G +CV  +GC  D  Q C    P         C++PC+   +CG  A C+ ++H   C CPE   GN +VLCK              +    CGR+ +C  NQ C  G+C       KC +++ C++     + TC+     +S  A   IC  +  Q  C  +  C S  +C++  CQNPCQ    C     C V+NH   C C   P +    G        E  +  CEC E + G     C + E C              CG    C    GQ +CE   CI G          +   +  CV+P ADD      CG  A C V  +++ C CP G  G+P  +C   E      C+ S                 CG+ A C + +  +A CSC   +FGNP + C P         C  +  C          C D C G                    CG  A+C V   ++  C C E +  GD Y  C V         PL      +DC + + CD G+CV     R G    C   R+ N QV   C+P   G     C  R     C C P YFG P  +CRPECV   DC  +  C + +C DPC   CG  A C+V  H P C+C  G TG+PY  C +                       I +  P QPC PSPCG N+ C+ +  Q  C C+  ++G PP CRPEC+   ECP+ K C  ++C DPC  +CGINA C  +NH  +C C     GD F RC   PP P+E       DPC  + CG +++C    N    CSC   ++G     CRPEC  N++CPS QAC+  KC DPC G CG+NA CS                 P   C P                                      +PCG N+ C +      +C C  +Y G P   CRPEC  ++ C  +  C+R KC+DPCPGICG NA C+                                        V  H P+C C E   G+ + E    +P        PC+P+PCG N++C    Q+  C C+ DY+G P   CRPECV NSDC    AC + KC+DPC     CG NA+CNV  NH   CSC     G+P V C +    +V    +D                   PC    CGP S+        +CSCLP ++GAPP+C+P C+ NS+C  + AC+N  CVDPC   +CG N +C V SH A C C  G+ G+P   C+  P      E   PC    CG +A C       +C+C   +   P   CR EC+L+ DCP + AC Q KC  PC   CG+NA+C VINH   C C   Y GDP     +++ EPP  +  ++PC P PCG N++ R++    IC+CLP F G P   C  EC+I  +C  ++AC  N +C +PC G CG+ A C+V  H+ +CSC     GD FIRC+                    P G                              C  ++EC S  ACI+ +CRDPCP   CG  A+C   +H  +C C  G+ G+P+  C                                                  EC  + ECP   AC   KCVDPC   CA  A C   NH   C CP   TG+ +    P                                      +PP   + C  + +C   HACIN++CVDPC    C   A C   +H   C C  G+       C       +PE   DP                                          +C  +LACI+++C DPC   +CG NA+C VT H P C C     GDP+ +CQ                   + C SN+EC +                                 + ACI  KC DPCP   CG  A CS N HVP+CSC  GY GN + +C +         P   +           C  N+ C VQ  +  C CLPGF GN    GC P         +C    DC   +AC +  C + C     CG  ++CQ  +  P     C+C      N   +C      V+P +   C+++  C   +V NNAA C  P C T   CS    C  Q                   +H   C+CP    G PY  C+  V         C SD +C + +AC N  C+NPC    + C QQA C    HR +C C   + GN ++ C+   C    +C   +ACI+ KCVDPC  T CG  A+C+S+F H + C CP G +GNP+VRC + EC+ D +CA +  C  R + C   CN   C  GA C   NHR  C C     G+  V C + P   E GC +D +CPS+ AC + G C+NPC V +PC ++  C+V+DT P RT++C+C  G        C   P    GC S  +C+  +AC +  CV+PC     C   A C    H  IC CP    G+P   C +       C +D +C     C +  C DPC   N C  NAEC  ++ +  C CP G+ GDP V+C   EC +N +CP  K C+   C++PC   +  CG  A+C    H A C+CP GT G+P + C         +   C+ + DCA   AC  +++ C+ P    D C  +A+C      P     C+CR G+  +    C    ++    C +D +CP   ACIN+ C +PC     C     C +    P    +C+CP  T  +    C PI       GCQ + EC   +VC  +G+C+ AC L+  CG NA+C    H A C          R  C+  + +                                             R  VC CP GY  +   +CL  + ++ VGC SD +C    ACINA C  PC CGPNA CT++NH P+C CK GF G+ +  C  +GCQS+ EC    +C+N +C   C     PC  +A C G NH+  C CP  LEG+P+V C  +EC  N +C  + AC+   C DPCA S  C   A C    H+  C CP     G     C  + V   C  D +CPS  ACI   C NPC    PC  +A C+VLD++P+RTM C C      DAS +C   V   P G  S L   E E CV        ++    PC      I  ++  R +C                C + +  N  G C     CRVD  C   + C   N  C +PCL   PCGP A       R QCRC+ GY G+P   C  I
Sbjct:   55 QPFKTNPNKHSRFRGEVFFLNLEDGYFGCQVNESTDYLQLYDLSKICDGKQDCFLGSDELSKELKCTNDC-DKDGTQCTNGVCLNGVCHCNDGFGGCNCVDQDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFQCEDIDECQDPAIASRCVENAECCNLPAHFLCKCKEGYTGDGEVLCTDIDECSNPQACGANAQCLNTPGNHTCVCPDGFVGNPYDGCQDVDECAYPNVCGPGAICTNLEGSHRCDCPPGYDGDGRTEQGC--------VDLDECGRSPCGRNADCLNTDGSFRCLCPDGFSGDPMHGCEDVDECAINN--PCGLGAQCVNLGGSFQCRCPLGFVLEHDPHAEAPMLATPTLQLGYGDGDTLITPAQTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQ--DNPCGENAICTDTVGSFICTCKSDYTGD-PFRGCVDIDECAALDKPCGQHAICENAVPGYNCKCPQGYDGKPDPKVACEQVDVNVLCRSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAE---ACGPHAQCMNTPGSYRCDCEAGYVGSPPRMPCKQPCEDVHCGAHAYCKPDQNEAYCVCEEGWTYNPSDVAAGCIDIDECDVLHGPFGSCGQNASCTNTPGAFSCACPPGFSGDPHSKCLDVDECRAGGKCGAGADCVNMQGGGYTCRCPEGTLPDPDPSVRCVPIVSCATNEECPGNAICDETKRCLCPEPNIGNDCRHPCETRDCGAHAQCMLANGEAQCLCAPGYTGNAALPGG--CSDIDECRANPCSANAICSNTAGSYLCQCPGGSTGDAYKDGCATAKTVGCSDSNPCALGESCVQDAFAGSSVCICRQGYERNSQSGQCQDVDECAGERAKPACGLNALCKNLPGSYECRCPQGHTGNPFVLCEICSSAECQCQAPYKLLGNSCVLAGCSSGQPCPSGAECISIAGGVSYCACPKGYQTQP-DGSCVDVNECEERGSQLCAYGAQCVNQQGGYSCHCPEGYQGDAYNGLCAPAQRKCAADKECSSNEKCIQPGECVCPPPYFLDAQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEVGFKGDPLLGCTDEDECAHLPCAYGAYCVNKKGGYQCVCPKGFTGDPYKSGCILENGVPKSTCLNNEDCASNLACLDGSCLSPCASLLCGSNAYCETDQHAGWCRCRVGFVKNADGDCVSQCQDVICGDGALCIPTSEGPTCKCPQGYLGNPFPGGSCSTDQCTASRPCDER-QICINGRCKERCEGVVCGIGATCDKNNGKCVCEPNFMGNPDLLCMPPIEQAKCSPNCGENAHCEYGLGQSRCACNPGSYGNPYEGCGAQKK-NVCQPNSCGPNAECLAVDNQITCICPQGFSGNPYVSCQDVDECANKPCGLNAACLNTAGSFECLCLSGHAGNPYSSCQPIESKFCQDASQCQCSDRVECPDGYSCQNGQCKNLCSNTACGPRAICDAGKCLCPLGYVG-DPHDLSQGCTIRGQCGNDADCRHTEICFQLG-KGLRKCVDACSKIQCGPNALCVADDHRSSCICADGYFGNPSNLQVGCQPERKVIDLEDKCKTDKDCERGFGCQSDALGTRECINLCSNVVCGPNELCKINPAGHAICNCADSFVWNPVVSSCEKPSLPDCTSDENCPDASACRPDVLGVLKCVSICDAFTCPANSICVARHHQGRCDCLSGFAGNPNDRNGCQPERKHQCRGNAECPESEACIKDEITQSLSCRSACDTVKCGPRAVCITNNHQAQCQCPPGPYAGDPNDPFNGCKSVPCVYNHDCPTNQMCNRMTHTCYDVCDEESCGENAICLAEDHRAVCQCPPGYRGNPLPEVACVKQSG---CAAGSCHTTAICEVTPEGATCKCPPLFVGEPQTNSRGCRPDGQCPNGDADCPANTICAGGRCLNPCDNACGSNADCKVVNRKPVCSCPLRFQPISESAKNGCERSASKCLTDVDCGGQLCYNGQCRVACRNTQDCSDGERCEGNVCVVTCLDHSQCAKGLACLEGHCAIGCRSNKECKQEQSC-IGNNC---------------LDPCLSSTSCGPNALCSIHQHRSQCACPDGFEGNPTP-EQGCVRVPTPCQATNQCPSGHMCIGN------QCNLPCTKTSACAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTC---QPGCE----SDADCPPTELCLSGKCKCASGFIGTPFGCSDINECTE-QPCHASAKCENVPGSYRCVCPEGTVGDGYTQQGCVQPRQCHKHEDCANSLSCIHGKCTDPCLHTVCGANAHCQAEAHQSMCSCPAGYLGDPNDTGVGCFKVECIDHVDCASDRACDAETNRCIKPCDLTS-CGKGS-CQVLDHKAICECNEGYQLVNGVCEDINECLTQPCHSTAFCDNLPGNYICKCPEGLIGDPLQTGCRDPSECLSDADCPATASCQNSRCRSPCEHQNACGLNSNCEAKLHRAICSCPANSRGDPQVECVHIECADNGDCAADKACLDAKCIDPCSLPNACGALAHCSVQNHIGLCACESGSTGDAKQGCVSL-QYCQKDAQCPQGSICAHGICSPLCSSNRDCISEQLCLQGVCQPTCKSNSTCPQFQFCQNNICAKELECTIDSDCGEDETCLVDAYGRAHCESVCLGRAACGRNAECVARSHAPDCVCKEGFFGDAR--SGCRK--IECNSDEDCSNDKSCDNHMCKIACLIGQPCGENALCTTENHRQVCHCQPGFSGDPRVHCDVIDFCKDAPCGPGARCRNSRGSYKCTCPPALVGDPYNEGCRSSVECETHDDCPPH---AACTKTNGVPKCQDVCAHL-------QCGPNAECVPKGHVAHCACRNGYDGQPADRVAGCKPLPVPCQITSDCPTNTYCSDSVCKPACFLDTECGPSEVCQGGQCF------------------------------------------DPCQ-QPQACGQNAECQMHSHVKQCHCPEGFTGDAGKECVRVPVAC---DGDCSPGYTCRDSMCLPVCHNDLECASNEKCLRGNCMLTCRVDNDCFLGHVCLHNKCVYGCHVDDDCSASESCRNDKCINPCLENPCGPNAACSVSNHRASCSCLDNMVPNPTPQVGCVRTPPLECHENRDCSKGLACFESVCRPLCADDAGCLTNERCQQGVCKPLC-----------------RHD----NECANGELCL----GLNCV--TGCRSD--QSC----PNHLACIGQQCVDPCSEPTACGTNAHCQAIDHHKQCTCPEGLSGNANVLCK--------------APRTACGRNEDCESNQLCYAGSC-----QGKCRNDQNCLSDERCMRGTCRTVCNTDSACAQGQICENRVCQTGCRNDLSCASEEACVNKMCQNPCQTPGQCGQCAECLVINHGVQCQC---PATFIGDGLTGCQLPPERCHPGCECDE-SGGYCAAKCSRSEDCACGQQCARGKCRNKCGAKRQC--TVGQ-LCERGACIAGCKSNGDCAADQSCANGKCVDPCADD----KACGRNALCTVSEHRMLCYCPDGYEGEPSKECVQFECRQDSDCESSKRCDQGKCRNPCLEYGACGTNAQCRVVNR-KAQCSCPPDFFGNPASECQPLDGGCSNNPCGVNSKCIEVPGGYECACMDGCMGDAHKGCLCEEQLVNACHEQPCGQNAACRVLRNNQAECYCPEDFPNGDAYVHCYV--------TPL-----QEDCRT-RGCDVGDCV-----RQGYEYVCQRERIVNEQVT-PCEPNPCGSNAV-CRERNGIGSCQCLPDYFGDPYQSCRPECVRNSDCQSNKACQQQKCRDPCPGTCGTNADCRVTNHLPACTCRSGYTGDPYNYCHVEPTQRKLRPTVQLNNEYKITFAAIRQAEPTQPCRPSPCGPNSQCRELNGQAVCSCVELYIGLPPNCRPECVLSTECPTDKACISQRCQDPCPGICGINAECRVRNHSPLCQCRRGFTGDAFTRCYVLPPPPIEVQREPLRDPCVPTPCGPHSECR-NINGVSACSCLATFIGQ-APNCRPECTINSECPSQQACINQKCRDPCPGACGLNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPERRCSQSSFENNHQCLHSVIFAATSPPISDDPCNPSPCGANAQCNN-----GICTCIAEYQGDPSVGCRPECVLNTDCAPNRACIRNKCIDPCPGICGVNAICE----------------------------------------VNNHVPICRCPEQMSGNAFFEC---RPVPAPPAQNPCQPSPCGPNSQCRVVQQTAVCSCLLDYIGSP-PQCRPECVTNSDCATNQACQNMKCRDPCPG--TCGFNAICNV-VNHSPFCSCPTGMSGNPFVRCEQTSKPLVYLNDLDGLQHKLFTVIPQRDVPPQNPCQPSPCGPNSECRVSGDSPSCSCLPEFLGAPPNCRPECISNSECATNQACVNQKCVDPC-PGLCGLNANCRVFSHTAMCLCDSGFTGDPFAQCS--PIREAPVERIQPCNPSPCGVNAKCEERGGAGSCQCLPEHFGNPYEGCRPECILNSDCPSNRACQQQKCRDPCPGTCGQNAECQVINHLATCNCFNGYTGDPYSFCRIIENEPPTPTPYVNPCQPTPCGSNSQCRESQGQAICSCLPEFIGTP-PACRPECVISTECAADKACI-NQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDAFIRCLPLPPKPADPPAQPPMPCVPSPCGPYSQCREVNGGASCSCLPNYIGAAPNCRPECTINAECASNLACINEKCRDPCP-GACGFAAQCNVINHTPSCSCPTGYTGDPFTSCRLLPPTPPPTTPTHDDPCIPSPCGANAQCRNGQCTCLPEYQGDPYTGCRPECILNSECPRNRACVRNKCVDPCPGRCAQNALCDAINHIAMCRCPERMTGNAFVACTPVQDEIIVNPCQPSPCGANAQCIARNGNAICSCITGYFGQPPNCRLECYTSSDCSPQHACINNKCVDPCPGQ-CGLNAICQAVQHRAHCECIAGYTGNAYTLCNLIVVERKPETARDPCHPSPCGPNSQCSSENGQARCSCLSEYQGTPPNCRPECTNNDDCANNLACINQKCRDPCPG-SCGQNAQCQVTLHTPNCHCPAGMTGDPFRLCQPLPQTPPKQPPTQKNPCYPSPCGSNTECRVRGESFVCECIHEYIGNPYEGCRPECVGNSDCSANRACIRNKCADPCPG-TCGLEAVCSVNNHVPICSCAAGYTGNAFVQCTRQVTPPPPSDPCYPS----------PCGLNSVCRVQRGQPVCECLPGFFGNPLGQGCRP---------ECTLSSDCAKDRACVNNKCVDACAGF--CGYGAVCQTINHSP----ICSCPGNMVGNPFVQCEAPRDNVDPCQPSPCRSNGVC---RVHNNAATCSYPECVTNEDCSRDRSCVSQKCRDPCLHACGLNAVCNVVNHKAICSCPPNFYGSPYAQCVRQVPHLDPPKPECTSDTDCTNDKACINQVCRNPCEQ-SNLCAQQARCHVQLHRPLCVCNEGYTGNALQHCYLLGCRSDGECAPTEACINEKCVDPCGFTQCGTGAICRSDFNHHARCHCPDGYRGNPLVRCERPECRSDDECAFHLAC--RNERCGDPCN---CGIGAQCRVDNHRAQCRCPAGYSGNPAVRCELVPVQPE-GCTMDAECPSKLACFN-GECKNPCDVTHPCGANAICEVVDTLPLRTMMCRCEPGYVGDADIGCRKEPVQDQGCVSHDQCQDMEACRSGICVNPCLDASPCARTAQCLAQKHRAICSCPQGTQGDPFTNCYQPPKITAGCSHDSECTPTTACINKRCQDPCAEANPCAGNAECRVQNFRPICYCPSGWGGDPQVQCFKPECKSNPDCPYDKACLNENCVNPCTHGQVRCGSGAECLPQNHQAVCRCPAGTQGNPFVAC---------ITGHCQFNEDCADHEACDRLNRVCR-PVCEQDTCTANAICVGRRHQP----QCECRPGYQGNPFVLCELPKSEPKPQCTQDADCPSKLACINQRCANPCATPHVCTPQQTCSVLDTLPLRTMICKCPSDTVSDNSGNCVPIQPVIVAGGCQHNAECSSSEVCL-HGSCLDACSLER-CGVNAQCSARDHYAQCACPAGYQGNPRIECYTTEIALPKIPGAECTRNDDCPRDKNCQNERCVNPCAADACGRGAYCHVQDRAAVCRCPPGYTGDARVRCLPPSDVITVGCKSDSDCPVTEACINAQCISPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCQSDDECANDKQCLNRECINPCLTSD-PCALNAECYGRNHRASCRCPAELEGDPFVRCVRLECHSNHDCATNLACVANHCVDPCAQS-PCAQNAICQSLQHRAVCRCPDQMPLGNPYAYCEPRPVEPVCRDDGNCPSGLACIDAKCLNPCTELSPCARSAHCSVLDSVPVRTMVCECPESQVPDASGECRELVLQSPPGCESDLDCGEQEACV--------NRQCRNPCNCGTNAICHVQQHRAVCS---------------CQDGYEGNPYGTCRSI-GCRVDGECDSGKAC--LNGNCLNPCLINDPCGPNAECYVQSSRAQCRCLSGYRGNPYERCRVI 6385          

HSP 2 Score: 2390.15 bits (6193), Expect = 0.000e+0
Identity = 2191/6924 (31.64%), Postives = 2955/6924 (42.68%), Query Frame = 0
Query:   89 HGACL----DSQCYCNDGYGGKGCDMP----DTNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGF------------------------------------------------HCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRD--------------------IDECLTNQVCGINTLCINTHGNFS-CECLPGFHGNPHDGCVDIDECR---TNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQS--------------------------------CGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFA---CEPVKVRTTCSSDFDCTNNAQCLPN-----------------------GSCACRKGFQPNG-----VLCQDI-----------------------------------DECQSTENPCGANSICLNVPGDYECQCIAPLVGTP-----------------PEQPCRDPCLEV----NCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDP-------SSLSCQEKRR-------------SCQ--------SDQECIGNAVCFNGACNCQEPYVGP--NCEDAC-------RDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLS---GCRGESTF-----ECTQDSQCDQGESCLSSRCVCRRGYERNPAGDCVDLNECLLGNVCGVNSVCK-NLPGSYDCECPSGFQGNPF-TSCQSCSGSSCS----------CLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKN---------CEDIDEC------------------QAIGHTPCGSGADCLNNPGSFSCSCPPG----QGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSN-PPQCLCKAGFTGNPL--TGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVEC-GADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGF---AEDSQGNC---VSLC-NQVICGS----NAQCIVS-------PSGPTC-------------QCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQC-GQEQCGVNAFCD--PNRLSCTCQSGFLGDPT--LVCMPPTQQAECSSECGTNSHCIYGNPNSCACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLF-SVCGKNAQCINTPG--------------GYDCRCHSDFVGNPFEGCVHLEAVTEDDDLCANQQCGPNAICN----LGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQ-NEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSSQCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFE----NLCQCPEGFAGVPTAAQGCVRIPPTCTTDCPASSLCF-----NGYCMPECTSHGQCARGEQC------------------SNGMCLKL-CHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGGQ---CSCQPGYEMT-QSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPD-ESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCYQVEYPCEGFT-------------------------------------------CGHGS-CHPEDHAPKCHCQDGYQL-IGSNCQDIDECASGN--------------PCHNSAKCTNEQ----GSYQCTC---HDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPC-DGFCGIGAKCVVKNHSPKCSCLPRWRGNPK-----IKCELLECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPRECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKA-AQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTG--SIIAHLA---------------------------------------DPC-SVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQP-----TLVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQAGLVCIDRQCVGGCSSNTQCPSESV----------------------CVEGKCQDPCQNEASV-----------CGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCH----RGLCAKSCEASAECNCGE-----SCHEGFC---LQQCQIASDCQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCRNPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVV-----------DRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLN-----PCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACV---------DPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCIC-------------------TKDPCSISPCGDEAICRAVEGNAICECPEGTRGDP---LDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPVSLGCVEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEET------------------------PKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCV-VDRVPKPPIRP-----------------------------------LPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCIVRGN----------------------------REVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRC------QIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCS-----PNPPEPLETDPC--SACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECSEP----------------------------IDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCI----RKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEII--DPCANRECGPYSQKVERNGICTCSCLPGYVGAPPD-CQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPCETCGQHAICHIHNNIAACKCEDNYIDKP--PNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQPIDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRCI---------PAGCRSDSECPSTEACIDRECRDPCP-FQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQYECKRHEECPSTLACRDFKCVDPC---DCAVGANCRVS-NHKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFLFIGDFECK-APERPE-CVSDPECPLHLACISERCLDPC-TSQACGVNAKCTVTTHVPV----CACELDYVGDPYTVCQKA-----GCQSNSECPLSEACINRKCQDPC-PFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQ-----YECLVDSDCPYTLACPNRECIDPCQ----CAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRP---CGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACI-NPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSC----LEIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASN----HRAVCTCPIEWVGNPMRECHQYECI------QHN-DCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQVE----------CQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPC----NCGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGY-QGDPFVKCSTFE----CLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHM----ASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPC----DCGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCR---------------------------------------------------STCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVV--GCTSDDECGDARACINAICKDPCACGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPG-YEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKTCPAGSGLILNEFEECVCPPGFVLDSQGICAPCRFDVGFII-ENGRCICDYTKGFVLDLSGKKCVCP--ENHSINDNGICE--EEPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPPPVDIDRPEIVVNCLSDGVGVGLTISDPRYHGLIYVKGHSQDPNCRLRVD-EGQNGQRID-FHVKFGTCDLAYDEDGYAHFILVI-GHAKLMTYKSQAYRIRCIYSTGEQNISHGFNVSILTTAGTIANTGPPPTCIMRICNSNGEDISQAEIGDKLMLKVEVSPGEIYGGFARNCIARTVDETNEETVYTVTDDNGCATDPSIFKDWEYNRDKGYLSAVFDAFKFPNSNTIKFKCNIRVCFGQCQPQNCAGRNAFGRRRR-------ESEHEIAGTVYTGQLREEIKIESNAILAIERKA-KRLQD-NLQNRYIGNEEVCVSKIGFIIALVITALLALVAVAIAVSCWLMAYRRRPRTEGPLPHPPEFPNPLFTTPEPLAEPTPDYL 6129
            H  C+    ++QC C  GY G    +P    D +EC+  PC     C+NT GS+ C C  G  GD +                                                 C+D+DEC        C  NA C NLP  Y C+C  G  G+  V C                      +  C + Q C     CI+  G  S C C  G+   P   CVD++EC    +  C  GA+C N  G Y C CP G  GD Y G C        + + C++                                  CG NA C   S+   C C  GF GDP + C D +EC   +   C  GA C+N+  GY+C CP G+ GD   +    E    ++TC ++ DC +N  CL                         G C CR GF  N        CQD+                                   D+C ++  PC    IC+N      C+ +   +G                   P+  C  P  +     NCG+ A C+    ++ C C  G   NP E   GC       K++     CG NA C        C+C +GF+G+PY+ C D+DECA     CG  A C N  GS+ C C +G   +P        S  CQ+  +             SCQ        S+  C   A+C  G C C   YVG   +    C        DA C     C              F+L    R C+D   C+   CG +A+C        C C  G  G+P +   GC+ E        +C  D  C++G  C S     R         +C++L       VCG N +CK N  G   C C   F  NP  +SC+  S   C+          C P    +     + D   C A + CV        C C  G+  NP  +N         C    EC                   A     CG  A C+ N     C CPPG       DPF G        C  N  C  N+ C +                + C   C   SCG NA C   +    C C  G+ GNPL    C     CA   C   +IC        C+CPP   G+P TN        +C   D +C     C G +C+NPC +  CGSNA+C   N    C C   F   +E ++  C    S C   V CG     N QC V+         G  C             QC +G+       GHC++  C S   C +Q Q+C G  C+  C     CG NA C    +R  C C  GF G+PT    C+      + +++C +   CI GN     CN                      L C   + C+          +R Y  +  + C   + CL   +C  +  C   PG                 C+C S F+G PF GC  +   TE       Q C  +A C       +C+C  G  GD      +GC     C  + DC  +  C       H  C+DPC    CG N+ C  + HQ  C C  G+ GD ND   GC + E C  + DC + R C    N    C+ PC + SC     C V D   IC CN G++   + G C+    CL                             C S A C +      C+C  G  G+P  ++GC   S+  C S+A+C  +  C+ S  +  C+       CG+ + C  + H   C CP     G+PQ+E C  + C +N DC  ++ C  L   C+DPC     CG  A C+V  H   C               CE    GD          C   +QCP G IC  GIC+  CSSN  C   ++C+ G CQ     TC  N+ C P+F+    N+C                  +  T  +DC     C        +C   C     C R  +C                  +   C K+ C++D++C   + C +  C+  C     C    +C        C CQPG+    +  C  ++ CK+  CG G  C N+ GSY C+CP   V D  +  CRS  +C +  DC    AC     +G  KC D C    C P A C    H A C+C   + G P +   GC  +  PC+  +                                           CG  + C    H  +CHC +G+    G  C  +     G+               CHN  +C + +    G+   TC   +D  +G       K    C+ + +CS+   C+N +C++PC +  CG  A C V NH   CSCL     NP      ++   LEC EN DC    +C  + C   C     C  N RC+     P+C               + +C     C    CV      C  D +C +   C   +C DPC +P ACG NA C + +H + C+CP G +GN+ V C    + C  + +C  +  C+   C  +C++  +C  +ERC  G C   C  D+ C  G +C +++C+ GC     C + ++C+N  CQ+PC+   QCG  A C VI     C C   FI +   +  C   P  C    +C E+      +C   C    DC   + C    C+  C +  QC   ++C+  +C  GC+S+ DC AD++C N +C+   +  K   R    ++  H                                         +PC     CG NA+CR  N +A CSCP    GNP   CQP     +  PC   S C +     +  C+  C   GD  +  +C E L V  C+     Q     + R     C      P+                         CV    +  CQ E  V           CG  A C  +N    CQC     GDPYQSCR   +R     + C S   C     R  C  +C  +A+C         +C  G+       C +    +     ++        +N            +   PC    C PNS C+      +C C   Y  L      + EC  + +C  DK+C   RC + C     CG NAECR+ NH   C C  GF G+A   C V              D  +P  CG +++C N  G   C C +   G         T    C ++ AC+N     PC   G+CG  A+C V+NH  LC C + Y GNP   C  +      PE       R C +S+    N +C+              DPC    C  N +C    +   CTC      + +          +C+    C    +CI   C +PC G  C     C+V NH  +C C                    ++PC  SPCG  + CR V+  A+C C     G P      CV    C T     NM C+                             DPC P  CG  A C VV +   C CP G+ G+PF++C+   +                         P++ CQPSPCG  + C ++ ++ + CSC   + G P   C PEC ++ +C ++Q+C N KC DPCPG CG+ A+C V  H   C C  G+ GDP+ QC  +   P   I+P                                    P+C  N DCPS + C    C DPCP  CG NA+C+V NH   C C  G+ GDPY  C +  N                            + +CSC P + G PP CRPECVI  +C  D  C+  +C DPC   CG  AQC V  H P+CSC  G TG+ + RC             P  PC PSPCG  + C+ V     C CLP ++G  P CRPEC  + EC S+  C  EKC DPC   CG  A C+  NH   C CP+   GDPF  C      P P  P   DPC  S CG NA C    N Q  C+C  +Y GDPY  CRPEC+ N++CP ++AC+RNKCVDPC G C  NA C                               ++PCQP+PCG N+ C +  NG A+C C   Y G PPNCR EC   S C     C+  KCVDPCPG CG NA C+                                         ++H   C C+ G+ G+ Y    +    RKPE   +   PC P+PCG N++C  +N    C C+ +Y G P  +CRPEC  N DC   LAC++ KC+DPC    +CG NA C V   H   C C     GDP   C   P     +     +PC    CG  ++   R     C C+  Y+G P + C+P CV NSDC A+ ACI N C DPC    CG    C V +H   C C  GY GN  + C +  T    ++   P   CG +++C +      C+C   +   P    CR EC L  DC K  AC+  KC   C   CG  A C  INH PIC C     G+P V+CE P+ +  +DPC P+PC  N   R   +   C+               EC+ ++DC  +R+C S  +C +PC+  CG+ A+CNV+ H AICSCP    G P+ +C+            C SD++C + +ACI++ CR+PC     C   A C  + H   C+C EG+ GN  + C    C+   EC  T AC + KCVDPC    C  GA CR   NH   C CP G+ G+P  R + P        C  + EC    AC N RC DPC    C  GA C V+ H   C CP G+       C+  P +PE C  D ECP  LAC +  C +PC  +  CG NA C V   +P+    C CE  YVGD    C+K      GC S+ +C   EAC +  C +PC     C R A C   +H  +CSC  G +G+P+  C Q       C  DS+C  T AC N+ C DPC     CA NAEC VQN +  C C  G+ G+       P         +CK + DCP  +AC + +C NPC   +     GA  + Q H  V      C C +G   N    CI         CQ ++DC   + C+    +  P   Q+ C++ A C  + H  +C C  G  G+P+V C     E    C  D +C    AC N  C NPC+ P   C  Q  C   +       +C CP + V +    C   + +      QHN +C + + C+   C+D C    CG  A C +  H + C CP G QGNP + C+  E          C ++ DC  ++ C  + + C   C A +C  GA C  ++    C C P   GD  V C    + I  GC+ D DCP   ACI+  +C +PC     C  +  C V +  P    +C C  G F GN     A    +GC+S  +C  D+ CLN +C++PC     C   A C   NH   C CP +  G+P + C +LEC ++ DC  +  C  N CVDPC   + C  NA C    H++ C CP     G+P+  C        C  +  CP    C+  +CL+PC    PC R+A C V   +      C+CP     D S  C        P    C  D DC    AC+++ C+NPC     C  +A+C V         +C C+ G+  +   +C        +GC  D EC    AC+N  C +PC     CG  AEC++   R  CRC  G +GNP   C  IGC S+N+C     C  N  CV  C   + C   AEC    H A+CR                                                   + C V  T+PVR ++C CP GY ++ +  C   T +V   GC SD +C   ++C+N IC+DPC CG NA C I++H+PVCTC+ GF G+PE  C ++ C  NSEC  TH C N  C P C  +   CG +A C  +NH+ VC C PG  GN  + C+ + CR+++EC  DRAC+N +C +PC  +  C     C V  H+  C CPPG   G  G   ++V   C+ D DC +Q AC+   C NPC   +PCGVNA+C VLDTLP+RTM C CL GY G+A++QC     C    G + +   +CVCPPG  LD    C PC  + G+ I E+G C+C   +G V+D  G+ C CP    + +   G C+  E+PEC  +  C    YC    +TC DPCL   CG  A+    +HR QC+CI GYTG+P   C           D  RP++VV+CL+DGV V + I++P ++G++YVKGHS+D  CR  V+  G+   R + F V FG+C +   +D  A F+LVI  H KL+TYK+QAY I+C+Y TGE+N++ GFNVS+LTTAGTIANTGPPP C MRI  + GE+I+ AEIGD L L+V+V P  IYGGFAR+CIA+T+ E N +  Y VTD+NGCATD SIF +WEYN D   L A F+AFKFP+S+ I+F+CNIRVCFG+CQP NC G NAFGRRRR       ++      T   GQLREEI I SNAIL  E+++   L D N++      E++CVS +G IIALVITALLALVAVA+AVSCWLMAYRRRP+T  PLPHPPEFPNPLF  P+   EPTPDY+
Sbjct:  822 HAQCMLANGEAQCLCAPGYTGNA-ALPGGCSDIDECRANPCSANAICSNTAGSYLCQCPGGSTGDAYKDGCATAKTVGCSDSNPCALGESCVQDAFAGSSVCICRQGYERNSQSGQCQDVDECAGERAKPACGLNALCKNLPGSYECRCPQGHTGNPFVLCEICSSAECQCQAPYKLLGNSCVLAGCSSGQPCPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVNECEERGSQLCAYGAQCVNQQGGYSCHCPEGYQGDAYNGLCAPAQRKCAADKECSSNEKCIQPGECVCPPPYFLDAQDNNKCKSPCERFPCGINAKCT-PSDPPQCMCEVGFKGDPLLGCTDEDEC---AHLPCAYGAYCVNKKGGYQCVCPKGFTGDPYKSGCILENGVPKSTCLNNEDCASNLACLDGSCLSPCASLLCGSNAYCETDQHAGWCRCRVGFVKNADGDCVSQCQDVICGDGALCIPTSEGPTCKCPQGYLGNPFPGGSCSTDQCTASR-PCDERQICINGRCKERCEGVVCGIGATCDKNNGKCVCEPNFMGNPDLLCMPPIEQAKCSPNCGENAHCEYGLGQSRCACNPGSYGNPYE---GCGAQK---KNVCQPNSCGPNAECLAVDNQITCICPQGFSGNPYVSCQDVDECANKP--CGLNAACLNTAGSFECLCLSGHAGNPYSSCQPIESKFCQDASQCQCSDRVECPDGYSCQNGQCKNLCSNTACGPRAICDAGKCLCPLGYVGDPHDLSQGCTIRGQCGNDADCRHTEIC--------------FQLGKGLRKCVDA--CSKIQCGPNALCVADDHRSSCICADGYFGNPSNLQVGCQPERKVIDLEDKCKTDKDCERGFGCQSDALGTR---------ECINL---CSNVVCGPNELCKINPAGHAICNCADSFVWNPVVSSCEKPSLPDCTSDENCPDASACRPDVLGVLKCVSICDAFTCPANSICV-ARHHQGRCDCLSGFAGNPNDRNGCQPERKHQCRGNAECPESEACIKDEITQSLSCRSACDTVKCGPRAVCITNNHQAQCQCPPGPYAGDPNDPFNGC---KSVPCVYNHDCPTNQMCNRMT--------------HTCYDVCDEESCGENAICLAEDHRAVCQCPPGYRGNPLPEVACVKQSGCAAGSCHTTAICEVTPEGATCKCPPLFVGEPQTNSRGCRPDGQCPNGDADCPANTICAGGRCLNPCDNA-CGSNADCKVVNRKPVCSCPLRFQPISESAKNGCERSASKCLTDVDCGGQLCYNGQCRVACRNTQDCSDGERCEGNVCVVTCLDHSQCAKGLA---CLEGHCAI-GCRSNKEC-KQEQSCIGNNCLDPCLSSTSCGPNALCSIHQHRSQCACPDGFEGNPTPEQGCVRVPTPCQATNQCPSGHMCI-GN----QCN----------------------LPCTKTSACAVG--------ERCYQQVCRKVCYTSNNCLAGEICNSDRTC--QPGCESDADCPPTELCLSGKCKCASGFIGTPF-GCSDINECTE-------QPCHASAKCENVPGSYRCVCPEGTVGDGYTQ--QGCVQPRQCHKHEDCANSLSCI------HGKCTDPCLHTVCGANAHCQAEAHQSMCSCPAGYLGDPNDTGVGCFKVE-CIDHVDCASDRACDAETN---RCIKPCDLTSC-GKGSCQVLDHKAICECNEGYQL--VNGVCEDINECLTQP--------------------------CHSTAFCDNLPGNYICKCPEGLIGDPL-QTGCRDPSE--CLSDADCPATASCQNSRCRSPCE---HQNACGLNSNCEAKLHRAICSCPANSR-GDPQVE-CVHIECADNGDCAADKAC--LDAKCIDPCSLPNACGALAHCSVQNHIGLC--------------ACESGSTGDAKQGCVSLQYCQKDAQCPQGSICAHGICSPLCSSNRDCISEQLCLQGVCQ----PTCKSNSTC-PQFQFCQNNICA---------------KELECTIDSDCGEDETCLVDAYGRAHCESVCLGRAACGRNAECVARSHAPDCVCKEGFFGDARSGCRKIECNSDEDCSNDKSCDNHMCKIACLIGQPCGENALCTTENHRQVCHCQPGFSGDPRVHCDVIDFCKDAPCGPGARCRNSRGSYKCTCPPALVGDPYNEGCRSSVECETHDDCPPHAACT--KTNGVPKCQDVCAHLQCGPNAECVPKGHVAHCACRNGYDGQPADRVAGCKPLPVPCQITSDCPTNTYCSDSVCKPACFLDTECGPSEVCQGGQCFDPCQQPQACGQNAECQMHSHVKQCHCPEGFTGDAGKECVRVPVACDGDCSPGYTCRDSMCLPVCHNDLECASNEKCLRGNCMLTCRVDNDCFLGHVCLHN-KCVYGCHVDDDCSASESCRNDKCINPCLENPCGPNAACSVSNHRASCSCLDNMVPNPTPQVGCVRTPPLECHENRDCSKGLACFESVCRPLCADDAGCLTNERCQQGVCKPLC-------------RHDNECANGELCLGLNCVT----GCRSDQSCPNHLACIGQQCVDPCSEPTACGTNAHCQAIDHHKQCTCPEGLSGNANVLCKAPRTACGRNEDCESNQLCYAGSCQGKCRNDQNCLSDERCMRGTCRTVCNTDSACAQGQICENRVCQTGCRNDLSCASEEACVNKMCQNPCQTPGQCGQCAECLVINHGVQCQCPATFIGDG--LTGCQLPPERCHPGCECDES----GGYCAAKCSRSEDCACGQQCARGKCRNKCGAKRQCTVGQLCERGACIAGCKSNGDCAADQSCANGKCVDPCADDKACGRNALCTVSEHRMLCYCPDGYEGEPSKECVQFECRQDSDCESSKRCDQGKCRNPCLEYGACGTNAQCRVVNRKAQCSCPPDFFGNPASECQPLDGGCSNNPCGVNSKCIEVPGGYECACMDGCM--GDAHKGCLCEEQL-VNACHEQPCGQNAACRVLRNNQAECYCPEDFPNGDAYVHCYVTPLQEDCRTRGCDVGDCVRQGYEYVCQRERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDYFGDPYQSCRPECVR----NSDCQSNKACQQQKCRDPCPGTCGTNADCRVTNHLPACTCRSGYTGDPYNYCHVEPTQRKLRPTVQL-------NNEYKITFAAIRQAEPTQPCRPSPCGPNSQCRELNGQAVCSCVELYIGLPPN--CRPECVLSTECPTDKACISQRCQDPCP--GICGINAECRVRNHSPLCQCRRGFTGDAFTRCYVLPPPPIEVQREPLRDPCVPTPCGPHSECRNINGVSACSCLATFIGQAPNCRPECTINSECPSQQACINQKCRDPC--PGACGLNAVCSVINHTPLCACIDGYIGNPFTNCNPK-----PPE-------RRCSQSSF-ENNHQCLHSVIFAATSPPISDDPCNPSPCGANAQC----NNGICTCIAEYQGDPSVGC-----RPECVLNTDCAPNRACIRNKCIDPCPGI-CGVNAICEVNNHVPICRCPEQMSGNAFFECRPVPAPPAQNPCQPSPCGPNSQCRVVQQTAVCSCLLDYIGSPPQCRPECVTNSDCATNQACQNMKCR-----------------------------DPC-PGTCGFNAICNVVNHSPFCSCPTGMSGNPFVRCEQTSKPLVYLNDLDGLQHKLFTVIPQRDVPPQNPCQPSPCGPNSECRVSGDSPS-CSCLPEFLGAP-PNCRPECISNSECATNQACVNQKCVDPCPGLCGLNANCRVFSHTAMCLCDSGFTGDPFAQCSPIREAPVERIQPCNPSPCGVNAKCEERGGAGSCQCLPEHFGNPYEGCRPECILNSDCPSNRACQQQKCRDPCPGTCGQNAECQVINHLATCNCFNGYTGDPYSFCRIIENEPPTPTPYVNPCQPTPCGSNSQCRESQGQAICSCLPEFIGTPPACRPECVISTECAADKACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDAFIRCLPLPPKPADPPAQPPMPCVPSPCGPYSQCREVNGGASCSCLPNYIGAAPNCRPECTINAECASNLACINEKCRDPCPGACGFAAQCNVINHTPSCSCPTGYTGDPFTSCRLLPPTPPPTTPTHDDPCIPSPCGANAQCR---NGQ--CTCLPEYQGDPYTGCRPECILNSECPRNRACVRNKCVDPCPGRCAQNALCDAINHIAMCRCPERMTGNAFVACTPVQDEIIVNPCQPSPCGANAQCIAR-NGNAICSCITGYFGQPPNCRLECYTSSDCSPQHACINNKCVDPCPGQCGLNAICQ----------------------------------------AVQHRAHCECIAGYTGNAYTLCNLIVVERKPETARD---PCHPSPCGPNSQCSSENGQARCSCLSEYQGTP-PNCRPECTNNDDCANNLACINQKCRDPCPG--SCGQNAQCQVTL-HTPNCHCPAGMTGDPFRLCQPLPQTPPKQPPTQKNPCYPSPCGSNTECRVRGESFVCECIHEYIGNPYEGCRPECVGNSDCSANRACIRNKCADPC-PGTCGLEAVCSVNNHVPICSCAAGYTGNAFVQCTRQVTPPPPSDPCYP-SPCGLNSVCRVQRGQPVCECLPGFFGNPLGQGCRPECTLSSDCAKDRACVNNKCVDACAGFCGYGAVCQTINHSPICSCPGNMVGNPFVQCEAPRDN--VDPCQPSPCRSNGVCRVHNNAATCS-------------YPECVTNEDCSRDRSCVS-QKCRDPCLHACGLNAVCNVVNHKAICSCPPNFYGSPYAQCVRQVPHLDPPKPECTSDTDCTNDKACINQVCRNPCEQSNLCAQQARCHVQLHRPLCVCNEGYTGNALQHCYLLGCRSDGECAPTEACINEKCVDPCGFTQCGTGAICRSDFNHHARCHCPDGYRGNPLVRCERPE-------CRSDDECAFHLACRNERCGDPCN---CGIGAQCRVDNHRAQCRCPAGYSGNPAVRCELVPVQPEGCTMDAECPSKLACFNGECKNPCDVTHPCGANAICEVVDTLPLRTMMCRCEPGYVGDADIGCRKEPVQDQGCVSHDQCQDMEACRSGICVNPCLDASPCARTAQCLAQKHRAICSCPQGTQGDPFTNCYQPPKITAGCSHDSECTPTTACINKRCQDPCAEANPCAGNAECRVQNFRPICYCPSGWGGDPQVQCFKP---------ECKSNPDCPYDKACLNENCVNPCTHGQVRCGSGAECLPQNHQAV------CRCPAGTQGNPFVACITG------HCQFNEDCADHEACDRLNRVCRPVCEQDTCTANAICVGRRHQPQCECRPGYQGNPFVLCELPKSEPKPQCTQDADCPSKLACINQRCANPCATPH-VCTPQQTCSVLDTLPLRTMICKCPSDTVSDNSGNCVPIQPVIVAGGCQHNAECSSSEVCLHGSCLDACSLERCGVNAQCSARDHYAQCACPAGYQGNPRIECYTTEIALPKIPGAECTRNDDCPRDKNC--QNERCVNPCAADACGRGAYCHVQDRAAVCRCPPGYTGDARVRCLPPSDVITVGCKSDSDCPVTEACIN-AQCISPCN----CGPNAECTVKNHHP----ICYCKPG-FSGNAQFGCAP---IGCQSDDECANDKQCLNRECINPCLTSDPCALNAECYGRNHRASCRCPAELEGDPFVRCVRLECHSNHDCATNLACVANHCVDPC-AQSPCAQNAICQSLQHRAVCRCPDQMPLGNPYAYCEPRPVEPVCRDDGNCPSGLACIDAKCLNPCTELSPCARSAHCSVLDSVPVRTMVCECPESQVPDASGECRELVLQSPP---GCESDLDCGEQEACVNRQCRNPCN----CGTNAICHVQQ----HRAVCSCQDGYEGNPYGTC------RSIGCRVDGECDSGKACLNGNCLNPCLINDPCGPNAECYVQSSRAQCRCLSGYRGNPYERCRVIGCISNNDCPTDKTCQ-NEQCVNPCAYHNECAPRAECRPQNHMAVCRCPPDYLGNPYVACRPQPQPVCKLDTDCPARFACINEQCVDPCVVLEPCQRPAQCQVTPTAPVRTMICICPDGYISSGSGSCKPTTSVVKVGGCISDSDCAADKSCVNGICRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECAKIECTINSECPATHACRNQLCVPACQGEL--CGPNAECLAINHRAVCECAPGHGGNARLGCTPLGCRNDNECPSDRACVNGKCGNPCDTTAICASDELCKVYQHKPQCACPPGTVPGRNGCEQERVAPICISDGDCHTQRACLRGECVNPCNSTQPCGVNAECRVLDTLPVRTMICECLEGYTGNAAVQCDKRSLCVIEKGFVRDVDGQCVCPPGSALDIYEYCTPCLVEQGYRIDESGHCVCALERGMVIDERGR-CTCPIELGYRLTPLGECQPVEQPECVTNEECADNRYCNPVTKTCEDPCLTKTCGVNAFCNAVNHRAQCQCITGYTGNPELHCNHTNFR----TDFPRPDMVVSCLADGVQVEIHITEPGFNGVLYVKGHSKDEECRRVVNLAGETVPRTEIFRVHFGSCGMQAVKD-VASFVLVIQKHPKLVTYKAQAYNIKCVYQTGEKNVTLGFNVSMLTTAGTIANTGPPPICQMRIITNEGEEINSAEIGDNLRLQVDVEPATIYGGFARSCIAKTM-EDNVQNEYLVTDENGCATDTSIFGNWEYNPDTNSLLASFNAFKFPSSDNIRFQCNIRVCFGRCQPVNCGGYNAFGRRRRSIADNSSDTTAIATSTGVEGQLREEITISSNAILTFEKRSGPGLNDANIKPAAQRVEDICVSMVGLIIALVITALLALVAVAVAVSCWLMAYRRRPKTLAPLPHPPEFPNPLFANPDAAPEPTPDYI 7302          

HSP 3 Score: 758.059 bits (1956), Expect = 0.000e+0
Identity = 1282/4988 (25.70%), Postives = 1768/4988 (35.45%), Query Frame = 0
Query:   62 CYRGSDEANS----QIKCTKDCLYTT---GRHCQHGACLDSQCYCNDGYGG-----------------------KGCDMPDTNECKYRPCDVF----GYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDG-KVECRDIDECLTN---------------------QVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDI--------------------DECRT-NPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPS-------------------------VSQQGC----------NAQSCGQNALCQRS--SNGLICTCREGFTGDPKISCVDI---NECQSSSLYQ--CGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQC------------LPNGS------------CACRKGFQPN-GVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCR---------------------------DPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDI-------DECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSS----------------LSCQEKR--RSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACR-DATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGT--NGDPLSGCRGESTFECTQDSQCDQGESCLSSRC-----------------------VCRRGYERNPAGDCVDLNECLLG-------------------------NVCGVNSVCKNLPGSYDCECPSGFQGN-------PFTSC---------QSCSGSSC--------SCLPPYQDIEGRCQLADCSNCEAPAKCVQ---------ITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNPLTGCEDLDECALN----------------PCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSV-PCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSL---CNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDP---NRLSCTCQSGFL-GDPTLVCMPPTQQAECSSE---------------------------------CGTNSHCIYGNP-NSCACNIGYFGNPYTGCEVT-TSVEDCDSLK--------------CGDNAVCSFASGKPECTCKRGYDGIPYERC-----------------------------QDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNP---FEGCVHLEAVTEDDDLCANQQC--------GPNAICNLGQ----CLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVY--QGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCRKV--------------------------------------------SCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDR---------------------GDLCPFGQCQTT-CASSSQCP-----------PGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSP-EFENLCQCPEGFAGVPTAAQGCVRIPPTCTTD-CPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCY--------------QVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQ------------LIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELL-----------------------------------------------ECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGD------------------PRECEQNLDCPGDGKCDNFVCVKPH-------EKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQ--CHKSIC--MHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTRE--------------PITCQGNKQCP---ENFLCD---------ASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPI-EHCQPTLVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQIC--------NSNTQCQA---------------GLVCIDRQCVGGCS-----SNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRG------LCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCRNPCNGFECEPNSFCQVN-GRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVN----HQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCA-THKCEDNERCIAQRHKPKCTCKERLLINSAGELICPQQ-DVQCLYEDQCPSTLSCIDGACQNPC-QGTSCPDGKSCQVLNHQALCIC------------TKDPCSISP-----------------------CGDEAICRAVEGNAICECPEGTRGDPLDSCVK----------------------EESCGTTACGPNMACQELYGQPVCECIPGF---------VPKYPVSLGCVEPAD-------------DPC-TPSPCGAFANCLVV----LNQLKCVCPPGLFGDPFIQCQPVEETP----------------------KDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGC------LP-----ECQTDQDCPSDQSCNNLKCQDPCPG-FCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDRVPKPPIRPLPQ-CQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYY--------------------------------------QCIVRGNREVCSCQPGYFGGPPNCR---PECVIQEDCPYDHHCLRGQCVDPCVNN-CGEGAQCQVVKHKPMCSCPDGS-TGNPYKRCQIIVRPPPKQPC-----------------------FPSPCGANAVCKIVRA----QEKCHCLPGFLGDPP-YCR-------PECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSP------------------NPPEP-LETDPCSACGINADCDVRPNDQVICSCPKDYLGDPYIECRP-ECLTNADCPSHQACLRNKCVDPCIGTCGVNAECSEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSP-----PNCRPECTEDSACPNHLKCVREKCVDPCPGI--CGRNAECKHTNMSSAQ---CAHFQGQKLASFSSLRRANNPLIVD-------------------------LLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENE------------VTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRP-ECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPDCQ-----PICVVNSDCPAHLACINNDCVDPCFQNV-CGSNTHCYVKS----HQAKCECFPGYDGNPLIGCNKGPTGTIT---------------AEERDPCETC-------------GQHAICHIHNNIA-------ACKCEDNYIDKP-----PNCRRECVLHEDCPKHLAC--IQYKCASPCINQ-CGKNADCSVINHDPICRCLPQYFGDPLVKC 4082
            C++  D ANS      KCT  CL+T      HCQ  A   S C C  GY G                       + CD  +TN C  +PCD+     G C        C CNEGY+     C+DI+EC    L   C   A C NLP +Y+CKC  G  GD  +  CRD  ECL++                       CG+N+ C        C C     G+P   CV I                    D C   N CG  A C+       C C +G +GD  QG    Q                             +S+Q C          +  +C Q   CQ +  +  L CT  +   G+ +   VD      C+S  L +  CG  A C+ +S    C C  G+ GD R  C  ++    C+SD DC+N+  C             P G             C C+ GF  +  V C  ID C+  + PCG  + C N  G Y+C C   LVG P  + CR                           D C  + CG  A C      A C C  G+   P +  +GC  +         T  C  N  CS+S      VC      D   G  ++       D C + +  CG+ A C        C C  G   D                    +C++      C +D EC  N  C  G           NC   CR D  CF    CL    +  C        S + R+   I+ C  NPCG +A C        C C      N  P  GC      EC ++  C +G +C  S C                       +CR   E      C+ LN C+ G                           CG N+ C+ +     C CP G  GN       P T+C         Q C   SC        +CL   + + G C+      C   + C Q          TG  +  +C    E     K C++   CQ  G   CG  A+CL       C CP    GD   G  LP    C    +C E+      KC  S     D   G  C     R  CG   +CT       LC+ G     + GC+   +CA +                 C + ++C        C CP G  G+P           EC  D +C     C   +C NPC     CG+NA C   N  A C C   F  +    C  L   C+   CG N++CI  P G  C C +G +G+ + G             CL + Q       +  C ++ CG NA C     N+  C C   F  GD  + C     Q +C +                                  CG+N+ C   N   SC C   YFG+PY  C        DC S K              CG NA C   +  P CTC+ GY G PY  C                             +    C  S CG N+QC    G   C C   ++G P      CV L      D  C +Q+C        G NA C +      C C  GF GD                  T C    +             DPC    CGP+S C   N   +C C   F G A +    C+ E  C+ N +CP+ + C IN    Q C DPC   +C  N  C V +  P+C C  G+  N  T +C+    +   + S     H C           P  D    PS     ++ + G C C+  Y G+P       +  + +C  N +CA +  C R+     C   C  + CGV A+C V NHV  C CP+ +  GN   E CR V                                             CV N DC  N+ C  +   C DPC    CG NA+C V  H   C CP     S  P V CE+  +                      D+ P   CQ + C  +S+C            P  +     C   C SN+ C   + C+  KC DPC   CG NA C       +C C  GF G P A    +R  P      C  S    N  C             E+   G C  L     N  +G       C P C  +SDC     C               Q  C D        CG    C        C+C      D    CR                 + +        ++PC  + C   + C   Q +A CSC P+F G P   +  C               + + PC G    +  CH  +H+P C CQ G+                            +PC   ++C    G   C+C    +G      C+P  +C  N+EC+S+  C N +C DPC G CG  A+C V NH+P CSC   + G+P   C LL                                               EC+ N++C  +++C+ NKCVD C   G C  N+ C   NH  +C C    TG+                  P  C  N  C          C+  +          C    +C+    C  ++C DPC  P  CG+NA+C +  H+  C C  G+TGN+   C       I+    P + +  CH S C    QC S N  A   RC              C   +      C+  C+   DC N+ +CIN +C+DPC  + CG NA CQV      C C  G   +P  +     +              P  C  N +C    E+F+C+            C+P C  +SDC AN  C    C + C     C  + +C   +        P C+       N  +     R+VT    S           S CG N+ CR +  Q +C C  G  GNP+ + C+P    C+ +SDC + + C    CV  C   G C    VC       IC        N   QC+A                 VC        CS     +N  C  +  CV  KC+DPC +    CG  A C   NH+  C CP    G PY  C          K +C S  +C         +C   CE S  C     CH       C         A  ++   + GC S+ +C   E C   +C +PC   +C   + C+ +   +  C C  GY+      C + EC ++ +C+   +C   RC + C+    CG  A+CR++NHRAQC CP+G+ GN    C +     + P  C  +A+C ++L  F+                           G C NPC++   CG  AIC+VV+       +C C   Y G+ D+      GC+  P  +     + C    +C   + C  G CV+PC     C    +C+AQ+H+  C+C +    +       P +    C ++ +C  T +CI+  CQ+PC +   C     C+V N + +C C             K  C  +P                       CG  A C      A+C CP GT+G+P  +C+                          C    C  N  C     QP CEC PG+         +PK      C + AD             +PC TP  C     C V+    L  + C CP     D    C P++                          DAC    CG  A C+  D + A C+C  GY GNP   C      LP     EC  + DCP D++C N +C +PC    CG GA C V+     CRC  GY GD   +C+      PP   +   C+ + DCP  + C +  C+ PC   CG NA+C V+NH   C+C+PGF G+  +                                      +C  R +R  C C P    G P  R    EC    DC  +  C+   CVDPC  + C + A CQ ++H+ +C CPD    GNPY  C+    P P +P                          SPC  +A C ++ +       C C    + D    CR       P C +D +C   + C   +C +PC   CG NA+CH + H+ +C C    +G+P+  C                    N   P L  DPC   G NA+C V+ + +  C C   Y G+PY  CR   C++N DCP+ + C   +CV+PC      + EC+ P   C+P             N +A+CRC  DY+G+P     P  +P C  D+ CP    C+ E+CVDPC  +  C R A+C+ T  +  +   C    G   +   S +   + + V                           LN    +  H P+CTC +GF G+P  E C +    I +E            V  C+   CG NAEC+  N    C C   + G+  + C P  C  +++CP   AC++ KC +PC+    C  + +C V                      HKP                                C+C PG V     C+     PIC+ + DC    AC+  +CV+PC     CG N  C V          CEC  GY GN  + C+K     I                    D  E C               H +C +   +         C  E  Y   P     P  + ECV +E+C  +  C  +   C  PC+ + CG NA C+ +NH   C+C+  Y G+P + C
Sbjct: 2298 CHKHEDCANSLSCIHGKCTDPCLHTVCGANAHCQAEA-HQSMCSCPAGYLGDPNDTGVGCFKVECIDHVDCASDRACDA-ETNRC-IKPCDLTSCGKGSCQVLDHKAICECNEGYQLVNGVCEDINEC----LTQPCHSTAFCDNLPGNYICKCPEGLIGDPLQTGCRDPSECLSDADCPATASCQNSRCRSPCEHQNACGLNSNCEAKLHRAICSCPANSRGDPQVECVHIECADNGDCAADKACLDAKCIDPCSLPNACGALAHCSVQNHIGLCACESGSTGDAKQGCVSLQYCQKDAQCPQGSICAHGICSPLCSSNRDCISEQLCLQGVCQPTCKSNSTCPQFQFCQNNICAKELECT-IDSDCGEDETCLVDAYGRAHCESVCLGRAACGRNAECVARSHAPDCVCKEGFFGDARSGCRKIE----CNSDEDCSNDKSCDNHMCKIACLIGQPCGENALCTTENHRQVCHCQPGFSGDPRVHCDVIDFCK--DAPCGPGARCRNSRGSYKCTCPPALVGDPYNEGCRSSVECETHDDCPPHAACTKTNGVPKCQDVCAHLQCGPNAECVPKGHVAHCACRNGYDGQPADRVAGCKPLP---VPCQITSDCPTNTYCSDS------VCKPACFLDTECGPSEVCQGGQCFDPCQQPQ-ACGQNAECQMHSHVKQCHCPEGFTGDAGKECVRVPVACDGDCSPGYTCRDSMCLPVCHNDLECASNEKCLRG-----------NCMLTCRVDNDCFLGHVCLHNKCVYGCHVDDDCSASESCRNDKCINPCLENPCGPNAACSVSNHRASCSCLDNMVPNPTPQVGCVRTPPLECHENRDCSKGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDNECANGELCLGLN-CVTGCRSDQSCPNHLACIGQQCVDPCSEPTACGTNAHCQAIDHHKQCTCPEGLSGNANVLCKAPRTACGRNEDCESNQLCYAGSCQGKCRNDQNCLSDERCMRGTCRTV----CNTDSACAQGQICENRVCQTGCRNDLSC--ASEEACVNKMCQN--PCQTPGQ--CGQCAECLVINHGVQCQCPATFIGDGLTGCQLPPER-CHPGCECDESGGYCAAKCSRSE----DCACGQQCARGKCRNKCGAKRQCTVGQ----LCERGAC---IAGCKSNGDCAADQSCANGKCVDPCADDKACGRNALCTVSEHRMLCYCPDGYEGEPSKE----CVQFECRQDSDCESSKRCDQGKCRNPCLEYGACGTNAQCRVVNRKAQCSCPPDFFGNPASECQPLDGGCSNNPCGVNSKCIEVPGGYECACMDGCMGDAHKG-------------CLCEEQL------VNACHEQPCGQNAACRVLRNNQAECYCPEDFPNGDAYVHCYVTPLQEDCRTRGCDVGDCVRQGYEYVCQRERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDYFGDPYQSCRPECVRNSDCQSNKACQQQKCRDPCPGTCGTNADCRVTNHLPACTCRSGYTGDPYNYCHVEPTQRKLRPTVQLNNEYKITFAAIRQAEPTQPCRPSPCGPNSQCRELNGQAVCSCVELYIGLPPNCRPECV-LSTECPTDKACISQRCQDPCPGICGINAECRVRNHSPLCQCRRGFTGD----------------AFTRCYV--LPPPPIEVQREPLRDPCVPTPCGPHSECRNINGVSACSCLATFIGQAPN----CRPE--CTINSECPSQQAC-IN----QKCRDPCP-GACGLNAVCSVINHTPLCACIDGYIGNPFT-NCNPKPPERRCSQSSFENNHQCLHSVIFAATSPPISDDPCNPSPCGANAQCNNGICTCIAEYQGDPS------VGCRPECVLNTDCAPNRACIRN----KCIDPCPGI-CGVNAICEVNNHVPICRCPEQM-SGNAFFE-CRPVPAPPAQNPCQPSPCGPNSQCRVVQQTAVCSCLLDYIGSPPQCRPECVTNSDCATNQACQNMK--CRDPCPG-TCGFNAICNVVNHSPFCSCPTGM--SGNPFVRCEQTSKPLVYLNDLDGLQHKLFTVIPQRDVPPQNPCQPSPCGPNSECRVSGDSPSCSCLPEFLGAPPNCRPECISNSECATNQACVNQKCVDPCPGLCGLNANCRVFSHTAMCLCDSGFTGDPFAQCSPIREAPVERIQPCNPSPCGVNAKCE------------ERGGAGSCQCLPEHFGNPYEG-------CRPECILNSDCPSNRAC--------------QQQKCRDPCP---GTCGQNAECQVINHLATCNCFNGYTGDPYSFCRI----------------IENEPPTPTPYVNPCQPTPCGSNSQCRESQGQAICSCLPEFIGTPPACRPECVISTECAADKACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDAFIRCLPLPPKPADPPAQPPMPCVPSPCGPYSQCREVNGGASCSCLPNYIG--AAPNCRP--ECTINAECASNLACINEKCRDPCPGACGFAAQCNVINHTPSCSCPTGYTGDPFTSCRLLPPTPPPTTPTHDDPCIPSPCGANAQCRNGQCTCLPEYQGDPYTGCRPECILNSECPRNRACVRNKCVDPC--PGRCAQNALCDAINHIAMCRCPERMTGNAFVACTPVQDEIIVNPCQPSPCGANAQCIARNGNAICSCITGYFGQPPNCRLECYTSSDCSPQHACINNKCVDPC--PGQCGLNAICQAVQHRAHCECIAGYTGNAYTLC-----NLIVVERKPETARDPCHPSPCGPNSQCSSENGQA---RCS-------------CLSEYQGTPPNCRPECTNNDDCANNLACINQKCRDPCPGS-CGQNAQCQVTLHTPNCHCPAGMTGDPFRLCQPLPQTPPKQPPTQKNPCYPSPCGSNTECRVRGESFVCECIHEYIGNPYEGCRPECVGNSDCSANRACIRNKCADPC--PGTCGLEAVCSVNN------HVPICSCAAGYTGNAFV--QCTRQVTPPPPSDPC------YPSPCGLNSVCRVQRGQPVCECLPGFFGNPLGQGCRPE---CTLSSDCAKDRACVNNKCVDACA--GFCGYGAVCQTINHSPICSCPGNMVGNPFVQCEAPRDNVDPCQPSPCRSNGVCRVHNNAATCSYPECVTNEDCSRDRSCVSQKCRDPCLH---ACGLNAVCNVVNHKAICSCPPNFYGSPYAQCVRQVPHLDPPKPECTSDTDCTNDKACINQVCRNPCEQSNLCAQQARCHVQLHRPLCVCNEGYTGNA--LQHCYLLGCRSDGECAPTEACINEKCVDPCGFTQCGTGAICRSDFNHHARCHCPDGYRGNPLVRCERPECRSDDECAFHLACRNERCGDPCN----CGIGAQCRVDNHRAQCRCPAGYSGNPAVRCELVP---VQPEGCTMDAECPSKLACFN---------------------------GECKNPCDVTHPCGANAICEVVDTLPLRTMMCRCEPGYVGDADI------GCRKEPVQD-----QGCVSHDQCQDMEACRSGICVNPCLDASPCARTAQCLAQKHRAICSCPQGTQGDPFTNCYQPPKITAGCSHDSECTPTTACINKRCQDPCAEANPCAGNAECRVQNFRPICYCPSGWGGDPQVQCFKPECKSNPDCPYDKACLNENCVNPCTHGQVRCGSGAECLPQNHQAVCRCPAGTQGNPFVACITGHCQFNEDCADHEACDRLNRVCRPVCEQDTCTANAICVGRRHQPQCECRPGYQGNPFVLCELPKSEPKPQCTQDADCPSKLACINQRCANPCATPHVCTPQQTCSVLDTLPLRTMICKCPSDTVSDNSGNCVPIQPVIVAGGCQHNAECSSSEVCLHGSCLDACSLERCGVNAQCSARD-HYAQCACPAGYQGNPRIECYTTEIALPKIPGAECTRNDDCPRDKNCQNERCVNPCAADACGRGAYCHVQDRAAVCRCPPGYTGDARVRCL------PPSDVITVGCKSDSDCPVTEACINAQCISPC--NCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCQSDDECANDKQCLNRECINPCLTSDPCALNAECYGRNHRASCRC-PAELEGDPFVRCVRLECHSNHDCATNLACVANHCVDPCAQSPCAQNAICQSLQHRAVCRCPDQMPLGNPYAYCE----PRPVEPVCRDDGNCPSGLACIDAKCLNPCTELSPCARSAHCSVLDSVPVRTMVCECPESQVPDASGECRELVLQSPPGCESDLDCGEQEACVNRQCRNPCN--CGTNAICHVQQHRAVCSCQDGYEGNPYGTCRSIGCRVDGECDSGKACLNGNCLNPCLINDPC---GPNAECYVQ-SSRAQCRCLSGYRGNPYERCRVIGCISNNDCPTDKTCQNEQCVNPC----AYHNECA-PRAECRPQ------------NHMAVCRCPPDYLGNPYVACRPQPQPVCKLDTDCPARFACINEQCVDPCVVLEPCQRPAQCQVTPTAPVRTMICICPDGYISSGSGSCKPTTSVVKVGGCISDSDCAADKSCVNGICRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPEFE-CAKIECTINSECPATHACRNQLCVPACQGELCGPNAECLAINHRAVCECAPGHGGNARLGCTPLGCRNDNECPSDRACVNGKCGNPCDTTAICASDELCKVYQ--------------------HKP-------------------------------QCACPPGTVPGRNGCEQERVAPICISDGDCHTQRACLRGECVNPCNSTQPCGVNAECRVLDTLPVRTMICECLEGYTGNAAVQCDKRSLCVIEKGFVRDVDGQCVCPPGSALDIYEYCTPCLVEQGYRIDESGHCVCALERGMVIDERGRCTCPIELGYRLTPLGECQPVEQPECVTNEECADNRYCNPVTKTCEDPCLTKTCGVNAFCNAVNHRAQCQCITGYTGNPELHC 6912          
BLAST of GH13743 vs. nr
Match: gi|1185569752|ref|XP_020724206.1| (uncharacterized protein LOC100645366 [Bombus terrestris])

HSP 1 Score: 2675.2 bits (6933), Expect = 0.000e+0
Identity = 2276/7126 (31.94%), Postives = 3055/7126 (42.87%), Query Frame = 0
Query:   22 IDKGVFFLNVEDGFFGCQVNASVDVLQLFEISKLCDGVPDCYRGSDEANSQIKCTKDCLYTTGRHCQHGACLDSQCYCNDGYGGKGCDMPDTNECKYRPCDVFGYCTNTLGSFFCSCNEGYEGDGFHCKDIDECQIPELANTCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTNQVCGINTLCINTHGNFSCECLPGFHGNPHDGCVDIDEC-RTNPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDPKISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCL---PNGSCACRKGFQPNGV-LCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPPEQPCRD----PCLEVNCGQRASCQIVKSEAFCICEEGWAYNP--------------------------------------KEISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDP------------------------------------------YIGCFDIDECAE---NRFICGREALCTNQVGSYSCQCYNG-------------------------------GQY----------DPSSLSCQEKRRSCQSDQECIGNAVCF-NGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGR-SCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGEST--FECTQDSQCDQGESCL------SSRCVCRRGYERN-PAGDCVDLNECLLGN---VCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCS---NCEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQ-GKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSNPPQCLCKAGFTGNPLTGCEDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCS--GSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSLCNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNS-CACNIGYFGNPYTGCEVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIPYERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDD------------------------DLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREE-----KCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCM--VSDGMPICLCNSGFEKNKLTGSCD--VYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSN-GQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQ--IEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPEVLCEKNDRGDLCPFGQCQTTCASSS-----QCPPGQICKSGICA----AGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCS-PEFENLCQCPEGFAGVPTAAQ-GCVRIPPTC----------------------TTDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCG---AGGQCSCQPGYE---MTQSGCSDL-NEC----------------------KNNICGAGKTCANTPGSYICSCPTNQVPDE---SGACRSPDQCSSDQDCNDALACLADS-------LSGAKKCLD--PCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGC--------------------YQVEYPCEGFTCGHGS-CHPEDHAPKCHCQDGYQLIGSNC------------------QDIDECAS-----------------------------------------GNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCD-----GFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELLECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPR-------------------------------------------------ECEQNLDCPGDGKCDNFVCVKPHEKSCLVDINCNDDQVCSR-----SECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPST-CILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVD--------NDCFLGHVCLDKMCKVG--------------------------------CSAPKDCPNSQSCIN----HQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPV-VACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKIC------KEVCRSDSQCQSKEICQGISCSQG---------------CRSDPDCTADKACHNNQCI-------------------------------------------GRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVP---CSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCN-EGLCVQICNSNTQCQAGLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCRNPCNGFE-CEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKT---------------------------------------ECTTNGQCSRDKSCEGGRCINLC----------------------SESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECV--------------------VDRNDCLLPNQCGENAQ-----------------------------------------CLNQLGGFDCVCRSGCTGDPFQGCQCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECY-GGNPDVLCKTQ----------------------FGCKARPEVEAE-----STGRECGRSAECSLNQECIRGACVDPCATH-KCEDNERCIAQRHKPKCTCKERLL--------INSAGELICPQ--QDVQCLYEDQCPSTLSCID--GACQNPCQGT--SCPDGKSCQVLNHQALCICT-------------------------------------KDPCSI---SPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCG---------------TTACGPNMACQELYGQPVCE-CIPGFVPKYPVSLGCVEPAD-------------------DPCT-PSPCGAFANCLVVLNQLKCV------------CPPGLFGDPFI------------QCQPVEETPKDACQP-----SPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPE------CQTDQDCPSDQSCNNL--KCQDPC-PGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVDR----VPKP----------PIRPLPQCQRNQDCPSFKVCDDGNCVDPCPER-CGLNADCRVQNHQVQCFCQPGFKGD-------------------PYYQCIVRGN-REVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPY--CRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRCSPNPPEPLETDPC--SACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECS------------------------------EPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNK--GPTGTITAEERDPC--ETCGQHAICHIHNNIAACKCEDNYIDKPPNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKC-----EPPKVSQPIDPCLPNPCGENT---EHRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRC-------------------------------------------IPAGCRSD----SECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQY-------------------------------------------------ECKRHEECPSTLACRDFKCVDPCDCAVG--ANCRVSNHKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFLFIGDFECKAPERPECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQ---------------------------------------------KAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECR------------------------------------------------QYECLVDSDCPYTLACPNRECIDPC--QCAANAECSVQNHKASCTCLPGFQGNAYT--GGCSPILEPVVED---------------------------------NKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFG----------------------------------------CQTHQDCPPSQVCNNAACINPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSCLEI--------------------------VTG--------------------CKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECHQYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQVECQQDGDCADNEKCDLRA--QTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPC--NCGTGALCDVINHTPICYCPPKYSGNP-----------------------------------QIACEKL------------ECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCSTF------------------------------------------ECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPC--DCGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPCA--CGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVG---------------------------------------------CVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKTCPAGSGLILNEFEECVCPPGFVLDSQGICAPCRFDVGFIIENGRCICDYTKGFVLDLSGKKCVCPENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPPPVDIDRPEIVVNCLSDGVGVGLTISD------PRYHGLIYVKGHSQDPNCRLRVDEGQN 5807
            + + VFFLN+EDG+FGCQVN S D+LQL E+SKLCD   DCY+G+DE   ++KCT DC    G  C +G CLDS C+CNDG+GG  C +PD NECKYRPCD+F +CTNTLGSF CSC  GY+GDGFHC+DI+EC  P LA  CV+NAECCNLP+H++CKCKPG+ GDG+V C D++EC  +  CG NT+C N  GN++C C PGF G+P++ C+DI+EC     CG GA C NL G ++C+CP G +GDP +          V    C    CG++A C        C+C EG +GDP + C DINEC+  +   CG  A C+N    + C C AGY  D    C  V     CS    C  NA+C+    +  C C +GF   G+ LC++++EC+   NPCG N+ C +  G + C C A   G  P + C D      LE  CG+ A C+  +    C+C  G++ NP                                      K I + C+D+DEC      +  CG  +ICSN+ GS++C C  GF G P                                            GC DI+EC         CG+ A+CTN +G +SCQC  G                               G Y          DP          +C+ D +C GNA+C     C C EP VG +C   C D +C PN+ C++ N +  C C  G+   P  +  C DIDECA NPC Q AIC N  GSF C+CP GT GDP SG   ES     C   + C  GE C+      SS C+C+RGY R+  +G C D+NEC+       CGVN++CKNLPGSY+C+CP GF GNPF+ C+ C+   C C PPY+ + G+C LA CS    C + A+C+ I GG+SYCACP+GY       +CEDI+EC  +GH  CG GA+C+N PGS  C CP G GGDP+ G C P +  C+S+++C+ NE+C+Q G+C+C PPF+ D LDGN CK+PC RF CG NA+CTPS+PP+C+C+AG+ G+P  GC D++ECA NPC  G+ CIN    + CECP GT GDPY  GC+       EC ++D+C    AC+  +C+NPC ++PCG NA C  + HAAWCRC  GF E     CVS C+  +CGS AQCIVS SGPTC+C EG +GNP+PGG C    CS   PC E    C  GRC  +C    CGV A CDP    C C   F+G+P L+CMPP   A C   CG+N+HC Y    S C CN G  GNPY GC V     DC +  CG +A C+      EC C  GY G PY +C D++EC  + CG NA CINT G YDCRC   + GNPF GC  ++     D                        + C++ +CGP ++C  G C+C  G+ G +PNDL +GC     C  + DC   +IC  +   G R C D C + QCGPN+ CIT NH  SC+C DG+ G+ ++   GC+  +     +C  + DC  G +C +   G + C++PC  + C  ++KC   +  G   C C  G+E N +  SC+      C++D DC    +C   + G+  CV  C    C   ++C++E HRG C CLPG+ GNP+DR GC    +++CS+++EC E + C+ +  G  +CQP C+++ CG  A+CVV NHV  C CP GL+ G+P   ++GCR V CV N DCP  + C+RL++TC D C    CG NA+C    H+  CQCPP   P+P P+V C   +     P  +        S     QCPP  +    +        CSS   C    +C   +C +PC   CG N++C     +  C+C   F       Q GCVR    C                       TDC A   C +  CM  C +H QC   + C NGMC+  C ++KNC   E C+D  C+  C+    C    +C        C+C  G+      Q GC  + N C                      + + C  G+ C N     +C   +N +P E    G C     C+SD  CN+   C+ +        ++G + CLD   CD   C   A C  +     C CP    GDP     GC                    +    PC    CG  + C   DH   C CQ GY    S C                  QD ++C+S                                          NPCH+SA C N +GSY C C  G+VGDP+  GCK    C+++ +C +   C + RC +PCD       CG  A+C V +H P C C  +  GNP  +C  LEC  ++DC  S +C N+KCVD C L+ +CG  + C   NH  VC+C  G TGDP                                                   C+ N  CP    C+N +CV+  E  C+ D +C+ D+ C +     +EC+  C     CG NA C + NH  VCSC PGF GN+K + +   S  C ++ +C G   C    C   C +HN C +N  C   K +  C           + C L   C D+ C  G                                C    DCP +  CIN     +C D C   QCGPNA C        C C+  +  +P+ + + C  +P+ C     C  N  C    C+P C +D +C  +++C    C      K  C  +++C  K   +  SC  G               CR   DC     C +N C+                                           G  +          I     +PC  + CG NA+C   N +A CSCP G   NP         P   C +  DC     C  G C   C    +CL NE C+  G+C  +C  +  C++G +C    CV GC ++ +C     C+  +CQDPC +   VCG  A C   NHQ  C CP    GDP   C+  +L C S + +C +G  C+   C  +C + A C   E C  G C   C     C     C   +C  GC S+  CP  E C   +C+NPC G + C   + C+V      C C   Y   A   CAK+                                       +C  N  C +   C+ G C+  C                      +  + CG NA CR++NHRA C+CP G+ G   QEC                     V  N CL    CG NAQ                                         C   L GF+C C  GC GDP Q C C    + C+         ++R  CG  A C++  +Q  C CP  Y  G+P   C  +                      F C+  P          +T REC    EC   + CI   CVDPC     C  N  C    HKP+C+C +  +         +   E + P+   ++ C  +  CP +LSC    G C++PC  +  +C   K CQV NH+ +C+C                                      ++PC++    PC  +  C  ++   +C C +      L  C+++  C                 + C  +  C     +P+C+ C PGFVP      GC++                      +PCT  +PC     C V  ++  CV            CP G+  DP               C   E   +  CQ      +PC   A C +N  +QA CSC +GY GN  + C PE      CQ ++DCPS + C+ L  KC DPC    CG+ A+C  E H+  C+C  G++G+P   C +      VP P             P+  C +      F+ C      D C E  CG+N+ CRV + QV+CFC PG++G                    P  QC V  N    C+C PGY   P   R  CV + D          QC     N CG GA+C   +  P C CP+ + GNPY+ C +        PC   PCG NAVC       KC C+P F+G+P    C  EC+ + +C +H  C  + C DPC  VCG NA C   +H  +C C     GDPF  C          +PC  S CG ++ C V  ND+ +CSC   Y G     CRPECL +++CP+H AC+  KC DPC G CG NA C                                P +PC P+PCG N+ C    +   +C C +   G+PP CRPEC+    CP++L CV++KCVDPC G CG N  C                                         V  H PMC C EG+ GDP++ GC +    +     PC+P+PCG+NA C E+N +GSC C+ DY GDP+  CRPECV NSDC +  AC+++KCKDPC    ACGINA C V  NH   CSCL+DY GDP   CH  P   VT    DPC    CG YS     +    CSC P YVG+PP C+P CVV++DC  ++ACI+  C DPC    CG N  C V +H   C C  GY G+P  GC K   P         +PC    CG ++ C + +   AC C  NY+ + PNCR ECV++E CP +LAC   +C  PC   CG N  C+V+ H+P+C C   Y G+P  +C      P    QP  PC P+PCG N    E    GS   CTC P + GDPYTGC  EC+ + DC  ++AC  N++C NPC G CG  A C VI H   CSC     GDPF  C                                           +P  CR +    SEC   +ACID +C DPCP  +CG+N +C T +H   C C  G+ GNP   CT++                                                 EC  + +C  + AC + +C  PC  A G  A C V NH   CTCP G+ GD   R     PP   +                    +PC  NPC   A C        CACP   +       K   R EC S+ +C   L C+  +C DPC S  CG  + C V  HVPVC C  +Y GDPY  C+                                             +  C  N+ECP   AC+N+KC DPCP   CG  A C+T  H P+C+C  G+ G+P+  C                                                 + EC++ S+C   LAC N++C DPC   C  NA+C V NH   CTC+ GF G+ +T      P   P V D                                  +C  + +C   + C    C++PC     CG +++C V + +P     C+C  GY  +    C  Q +  E                                          C    +CPP++ C N  C +PC     C   A+C V +H   C+C +G TGDP+ SC +                           V G                    C  + +C  ++AC N  C +PC+     C + A C   NH   C+CP ++ GNP  +C +               +D + ++PC  + CG  A+C+   ++  C C     GNP   C Q EC    DC  N+ C        C  IC  Q     A C   NH  TC CQP  VGD    C +   PI A               +E    +PC    PC  +  C+ +        VC C    FVG+  +C        C  +S+C  ++AC   KC  PC   CG GA C VINH P+C CP   +G+P                                   Q AC  L            EC  + DC  +Q C    C DPC+    CG NA+C  ++H   C C PGY GDPF  CS                                            EC  N +C   K C+   C+DPC+    CG NA+C V  H+  C C PGT GDP   C PQ      +  E R                + PC T  PC  +++C VV+       +C C+  +        +  P      CV   ECP   AC++  C+DPC   CG+  +C +  H P+C C EG  G+P   C  +        + P V  P   C P     SPCG NAEC   G  + C    + +   P  R                          CT + EC    AC+   C+DPC   CG NA CT+ NH  VC C DG+ G+P  VC+ +   +  +       I   C P       PCG +A+C+  N    C+C P   G+PY  C   EC  N +C+   AC+  +C+DPC     C   A+C   NH   C+C PGY G     C  + V                                              CV +S+C  + ACI++ C +PC+ +  CG+N +C V++  PI    C+C  GY GD   +C P    P      L   + CV  P       G+ A CR ++G     G   C     ++    G    C               PECRV+ +C     C   N  C DPC +  CG  +  T  +H   C C EGYTGDP + C P       P+    P +V  C+S   G     +D      P Y G  YV      P C L  D  QN
Sbjct:   15 LRREVFFLNLEDGYFGCQVNESTDILQLLELSKLCDNNVDCYQGTDEQRERLKCTDDCTKEDGTRCLNGVCLDSVCHCNDGFGGCNCQVPDENECKYRPCDIFAHCTNTLGSFQCSCFPGYQGDGFHCEDINECDNPVLAARCVENAECCNLPSHFLCKCKPGYIGDGEVHCEDVNECAISGACGDNTVCNNIPGNYTCACQPGFTGDPYETCIDINECDYAGACGRGALCVNLPGAHKCECPEGYNGDPEEEC--------VDVDECLRSPCGRSAQCTNVHGSFRCSCPEGMSGDPWVGCHDINECEEGT--PCGSDAECVNTEGSFECRCQAGYQMDETHGCIDVN---ECSRLDACAENARCINVPGSYKCICPQGFIGQGLTLCENVNECE--RNPCGENAECSDTIGSFVCSCKADYTGD-PFKGCSDIDECTALENPCGRYAICKNTEPGYNCVCPPGYSANPNPTVACEQTDVTTLCKSNFDCVNNAECIEGQCFCKDGFKAIGAECVDVDECL-----SNPCGPASICSNTRGSYHCECESGFVGTPPHIPCKAPCDEVTCGDHAYCKADGHEAYCICEDGWTFNPNDIAAGCVDINECDAINGPSGRCGKNAICTNTLGGFSCQCKPGFSGNAFKQCMDIDECGRPDACGHGATCTNTEGSYSCTCPEGTIPDPDPYIKCVGIVTCEVDGDCPGNAICDPQKRCLCPEPNVGNDCRHPCEDLSCGPNAHCMLSNDVATCLCRSGYTGKPGVKGGCRDIDECAINPCPQGAICNNEPGSFSCQCPSGTTGDPYSGGCQESKAPHVCGPSTPCPAGEQCIKDEFVGSSVCICQRGYTRDHESGKCRDINECMELRDKPACGVNAICKNLPGSYECQCPPGFNGNPFSLCEECNSIECQCQPPYKIVNGKCMLAGCSKGEKCPSGAECITIAGGVSYCACPKGYTTK-ADGSCEDINEC-IVGHQVCGYGAECVNLPGSHQCVCPHGYGGDPYNGLCSPAQKRCTSDNECKANEKCVQPGECVCPPPFYTDPLDGNLCKNPCDRFPCGINAKCTPSDPPRCMCEAGYEGDPQHGCVDVNECANNPCGHGAYCINTKGDHICECPKGTVGDPYGGGCTRVAVTKNECSSNDDCDNIFACVNGRCVNPCDNIPCGPNAYCEPDKHAAWCRCVIGFVEGKNNECVSQCDGFVCGSGAQCIVSYSGPTCKCIEGFMGNPFPGGQCQPDVCSPEVPCAEP-SVCISGRCKRRCEGIVCGVGASCDPATNKCVCNPYFIGNPDLLCMPPINPAVCDPACGSNAHCEYTLQESKCVCNPGTSGNPYHGCGVQQK-SDCSTALCGKDAHCNAGPNAVECLCPPGYAGNPYIQCHDINECNGNACGSNAVCINTIGSYDCRCKESYFGNPFIGCQQVQVGPCTDPSSCTCSDSVPCPFDYSCVSGKCINRCSDVKCGPRSVCQDGACVCPPGYSG-NPNDLTKGCYLHGHCSNDLDCEPQQICFQVGK-GVRKCVDACSKLQCGPNALCITQNHVSSCLCVDGYKGNPSNLVEGCEPFKSAVTPRCEHDSDCSEGSSCILLDGGVRECVNPCSKVVCGAHQKCEPDIIPGHATCKCQDGYEWNPILSSCEKPSVPDCISDDDCHTTEACRPDALGVLKCVSICKSFTCAINSQCMAERHRGRCECLPGFIGNPNDRQGCQTPRKDQCSTDSECPEDQTCRSTKEGLLTCQPVCNFVSCGPNALCVVHNHVANCECPPGLYAGDPNDVVKGCRAVPCVYNIDCPPTQLCNRLTHTCYDACDENACGVNAVCIADDHRAICQCPPGLKPNPVPDVECVPLEACHPNPCHETALCVPGPSSNPVCQCPPNFVGDPYVKGCQPEGYCSSVKDCPVHSICHNNRCANPCENACGLNSICDIINGQPTCKCIHKFIPSSKGPQDGCVRATNYCNVDADCVESICLEGQCIAVCRAITDCSAGEKCVDSKCMIPCVTHTQCQTDQACVNGMCILGCRSNKNCPSTESCIDNKCQDPCKGKDVCGPNAICSCTDHATTCTCPLGFHGNPTPQQGCVRVPNICEGPQDCPSQHLCVSGFCQCQCSEQDNCAEGERCKNGICMKVCYGDSNCLPGELCIDGVCEV--GCTSDVGCNENEVCINNKCKCSHGFIAGPEHCLDINECDDQPCHSSAECVNLHGSYRCVCPQGTAGDPVG--TGCVIPHQCTVHADCADSQACVQHNCTDPCSLVDCGLNTICSVLDHTAACQCQPGYIGDSSGCFKVECLSNNDCSIDKYCNQDTNKCSSPCNQVDCGYGNCIASDHSGVCKCYPGFELAGDICVDIDECLKNPCHSSAVCQNTEGSYACICPHGLVGDPFKSGCKQPGDCFTDLDCPNTAACIDNRCTNPCDVSPDSHSCGRNAECFVHDHVPLCRCPDQTTGNPTTECIHLECNYHSDCSPSDACYNHKCVDPCSLANVCGQGADCSSLNHSAVCTCQPGGTGDPNLGCTPVQYCKSDSQCATGSACNGGICTALCGSTRDCIGDQLCINGLCQPTCKSNSSCPEYQYCNNNICVQ--ELRCISDDDCSHDERCIKNNIGQAECQKACDL-LLCGRNAECKADNHVGVCSCKPGFFGNAKDDKIGCQSIECEVNDDCSGEKICDAHKCRIACLAHNPCGVNAICTAEKHVQICTCQPGYTGEPTHACQLIDYCSDQPCAPGAVCENSRGSYRCHCQQGMVGDPYNSGCQPPVECLQDGDCPLTAKCINVNNVPKCFDVCSRTQCGPNADCVATNHAGACQCRSDYEGDPNNLSIGCRPKPVVCTSAVDCSPNTYCYEGICRPSCQSDEECNLSDVCLNGQCLDPCNVKAACGINAECNVKSHIKQCSCPPGFTGNSEVECVRLPVSCRDTNDCNDGNTCRDNVCLPICTSDNECAFNEKCIQGNCLLTCRLDNDCFLGHICLHNMCAFGCRADEDCNANEACITNKCINPCEATPCGPNAKCTVFNQRATCSCPAGFMPNPTAKVACLRSPGPVCQANRDCATGTACIGGLCTPVCSTDLNCLSNERCDPSGICKSLCRRDEDCRSGEICEGLVCVIGCRADVECQENFACLNNQCQDPC-SLPDVCGVNAKCAVVNHQKHCSCPAPLVGDPLIGCKQAFLPC-SNEEECVTGQTCYGRSCYATCRSDANCLSDERCDGGICKAICNSDDHCVANQICQNRLCDIGCRSDNTCPNDESCVNNKCKNPCEGGKACGECAGCRVVNHVAQCSCPANYYGNALISCAKSMIPCDGTCECDEIGFCTKSCYSQDQCSCGEVCHSEKCRIKCDVNNYCPKGYVCDQGLCLIGCRTYSDCPSSLSCVSGQCEDPCSANGSPCGTNALCRVSNHRAVCLCPEGYQGEPSQECYQLECHHDDDCEANKRCSEDGVCTNPCLQHGVCGFNAQCRVVNRKAQCSCPPGHYGNPKINCKKGGDECLRRPCGVNAKCRETLNGFECTCDPGCHGDPHQACICDG-GELCK---------DMR--CGANAACRIYKNQPQCYCPSNYPSGDPTQACSAEKSLDCRTNGCGKGAECIRDGAIFVCRCPPGTSGSPDIECTTERECTSDLECPNEKACINLQCVDPCGLRGACGINALCRVVLHKPRCSCPQCYIGMPHTACHPDPKCETLNPRPTPNIGCSSDRDCPESLSCHSRTGECRDPCLSSQYTCEVNKRCQVRNHRPMCVCKYGFVVNEVGELTCAPDTLTCTRDFDCPSNAACVNGKCQNPCNVRKKKPCPADKTCDVLDHRPVCICTQNCNPS-LSICLRDSGCSPDLACRNYRCVDPCRNSTCPADAPCYVEEHKPICKFCPPGFVPD--TKYGCMKDTKCKTHDDCLSQLACINDQCLNPCTLHNPCDFVEVCHVQDHRPVCVKDVINDKTDCPYCPAGMECDPATYTCVKAGCTSNKDCPLTEACIEGTCQEPCLVWNPCTKNAIC-VNTNHQADCSCEDGYHGNGFSYCEPEEESRNICQYNEDCPSSKYCDRLNRKCIDPCLENDCGVNANCYPENHQAQCKCLPGFQGNPEVGCTLTTTNPCVPNPCGLDAMCENDNGNPICFCPKGLTGNPFEQCIPEG--DQCQENPCGVNSGCRVVSGQVRCFCLPGYEGKPPASPCTLPSNPCEPSPCGPNTQCTVLNNGLSKCTCLPGYIESPNTIR-GCVPKSD----------QCSP---NPCGLGAKCDSDRVPP-CYCPEHTVGNPYQSCAVTPS-DTYSPCLLVPCGKNAVCVEEDGIGKCKCVPPFIGNPYMDGCEAECIVNQDCDNHLACFNQHCRDPCPGVCGSNAKCEVVDHVPVCSCLPGYTGDPFGSCKLETSPLPSQNPCMPSPCGPHSICRVM-NDRAVCSCSPGYHGT-SPNCRPECLVSSECPAHLACIGQKCGDPCPGLCGQNALCQVVNHNPICSCPSDYLGDPFTQCVKEDIPLPRPKNPCLPSPCGPNAECRVQEDH-PVCTCISGMFGAPPLCRPECSIHQDCPHYLACVQKKCVDPCAGSCGFNTNCT----------------------------------------VQNHRPMCQCNEGYEGDPFS-GCSKVTFPVP---LPCDPSPCGANAICKERNGAGSCSCLPDYTGDPYQGCRPECVQNSDCVHTKACINNKCKDPCVG--ACGINAQCQV-INHQPSCSCLSDYTGDPLKSCHISP---VTPLPRDPCQPSPCGSYSNCRVIDNHAVCSCQPDYVGSPPQCRPECVVSTDCAQNMACIDQKCRDPC-PGTCGQNADCQVINHNPVCSCTSGYTGDPFFGCVKEVEPKQPGPKPSGNPCIPSPCGPNSQCRVIDGFPACSCLPNYVGRAPNCRPECVINEGCPGNLACQNEQCVDPCPGSCGVNTYCNVVKHNPVCICNTGYTGNPFTECVPIMKVPTTTEQPRTPCNPSPCGANAICNERNGVGS---CTCRPEYIGDPYTGCRPECVTNTDCDRSKACL-NNKCVNPCPGTCGQGATCRVINHAPSCSCLPGFTGDPFSACAVLEVTPTSPPLNPCEPSPCGPNSNCRVHNGHAVCLCQLGFVGVPPTCRPECTVSSECSQNKACIDNKCADPCP-GSCGLNTKCLTVNHNPICTCTNGYTGNPLVQCTKFNVSQPPFKDVGSPCTPNPCGPNSQCRVIGSQPACSCLSNFIGRPPNCRPECTDNSDCFHSAACINQRCKSPCPGACGELARCTVQNHVPICTCPEGYEGDATVRCILAPPPATDIS-----------------VTNPCSPNPCGPNAQCRERNGAGACACPPDLIGDPYDNVKGCHR-ECESNNDCAPQLTCVGFKCSDPCPS-TCGTLSICNVQEHVPVCTCPPEYTGDPYFACEVKEIPREPMDPCSPSPCGPNSKCREVNGQAVCTCLPEYRGIPPNCRPHCVVNAECPAHLACLNKKCTDPCP-NTCGLRALCTTKNHNPICTCPVGFTGDPFSLCSPAQEVQPFTERPPSCTPSPCGPNSLCQIISGNPACSCLPNYIGVPPECRPECILSSECKSHLACVNQKCQDPCPGSCGVNAQCHVLNHIPVCTCMNGFTGDPFTQCTVIPPTTVPSVSDPCSPSPCGPNAICKNGDCECLPEYIGNPYEACRPECILNSECARDKTCLKNKCRDPCPGT--CGQNAVCDVVNHIP----VCSCIPGYIGDPFVSCRVQPQIPEAKRDPCSPSPCGPNSQCRNIEDHAVCSCLQGYLGSPPSCRPECVVSTECPPTRACVNKKCTDPCLGS--CGLNARCEVINHSPICSCLSGQTGDPFKSCYDTPILPDVKDTGDPCNPSPCGPNAQCQNVNGYPSCSCLPTYIGTPPSCRPECLINPDCPSNKACVNSKCTDPCA---GSCAENARCLVVNHAVTCSCPADYTGNPFVQCVE---------------LDQEPINPCEPSPCGPNAICQQRDNVGACICIDDYHGNPYEGC-QPECILSSDCPTNKACVRNKCEDPCPGICGIQ-----AQCSVINHIPTCTCQPGYVGDPFSICNL---PINAD--------------TEPTVTDPC-SPTPCGPNSLCRAVKDQ----AVCTC-QESFVGSPPNCKPE-----CVVNSECPQNRACYKYKCNDPCPGTCGVGANCRVINHNPLCSCPQGTTGDPFSRCYPQTITPSPPVGDPCSPSPCGLYAECRAIGDQAACSCLKNYIGLPPNCRPECVVNTDCPSNQACISEKCRDPCI--GSCGQNADCRVQNHIPVCLCQPGYTGDPFTLCSQIIEQPKPEDLCNPSPCGPNADCREGICTCLPNYFGDPYSYCRPECTMNSDCSRVKACVNQFCVDPCIGT--CGTNAKCDVVNHIPMCSCFPGTTGDPFTLCRPQ------ISEEPR----------------KQPC-TPSPCGPNSICKVVND----HAVCSCQTDF--------IGSPPACRPECVVSAECPLTQACLSNKCQDPCPGTCGQNTKCQVVNHNPICSCSEGHTGDPFTRCYIMS-------KQPPV--PTNPCQP-----SPCGPNAECQVRGDSSACSCIENYIGVPPNCR------------------------PQCTINPECPPHLACMQQKCRDPCVGLCGLNAQCTVVNHHAVCACLDGYSGNPFSVCEAIPMDTPLD-------IRKPCEP------SPCGTNAVCRENNGVGSCSCLPDYIGDPYEGCRP-ECTQNPDCSKTMACMGLKCRDPCP--GTCGLQARCETINHVPACSCNPGYTGNPFTYCSPISVAPNPIESDPCSPSPCGPNSQCRNVNDHAVCTCLANFIGSPPTCRPECVVNSECSRELACINQKCASPCMNS--CGINTQCKVINHSPI----CICNIGYTGDPFTKCFPTPQSPQ-KDTDLAPKDPCVPSPC------GMYAECR-NIG-----GTASCSCLPRYI----GSPPTC--------------RPECRVNSDCPMNLACT--NEKCRDPC-QGSCGVTSLCTVYNHVPVCTCPEGYTGDPFSNCYPA------PIKPTEPTVVDPCVSSPCGPNARCNDGICTCLPEYQGDPYVGCR---PECVLNTDCPQN 6789          

HSP 2 Score: 2394 bits (6203), Expect = 0.000e+0
Identity = 2146/6725 (31.91%), Postives = 2911/6725 (43.29%), Query Frame = 0
Query:  163 TCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECLTN------QVCGINTLCINTHGNFSCECLPGFHGNPHDGC-----VDID----------ECRT---NPCGIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQG-----CNAQSCGQNALCQRSSNGLICTCREGFTGDPKI---------------SCVD---INECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEPVKVRTTCSSDFDCTNNAQCLPNGSCACRKGFQPNGVLCQDIDECQSTENPCGANSICLNVPGDYECQCIAPLVGTPP-------------------EQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKE-------ISSGCLDIDECDKSISPTGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFICGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFKLSPNGRSCIDIDE------CAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCV-----------------------CRRGYERNPAGDCV--------DLNECLLGNVCGVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSNCEAPAKCVQITGGISYCACPRGYEMNPRTKNCE------DIDECQAIGHTPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAECTPSN-PPQCLCKAGFTGNPLTGC----------EDLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCIN---------------------------------------------------PCSSVPCGSNANCVAENHAAWCRCKSGFA----------------EDSQGNCVSLCNQV---ICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMP--------PTQQA--------ECSSECGTNSHC-IYGNPNSCACNIGYFGNPYTGCEV---TTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIP---YERCQDVDECLFSVCGKNAQCINT-PG--GYD-----------CRCHSDFVGNPFEGCV-HLEAVTEDDDLCANQQCGPNAICNL----GQCLCASGFKGDDPNDLVEGCSSAATCQTNTDCGYNEICSTIAHSGHRFCSDPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLTGSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPACDLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNKCSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFI----------PSPTPEVLCEKNDRGDLCPFG---QCQTTCASSS-QCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFEN--LCQCPEGFAGVPTAAQGCVRIPPTCTTD--------CPASSLCFNGYC--MPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCE----PGCRTDSDCRLGEVCGAGGQCSCQPGYE-----MTQSGCSDL--NECKNNICGAGKTCANTPGSYICSCPTNQVPDESG---ACRS---------PDQCSSDQDCNDALACLADSLSGAK----------------------KCL----------DPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCY--------------QVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQ------------LIGSNCQDIDECASGNPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELL---------------------------------------------ECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDPR---------------------------ECEQNLDCPGDGKCDNFVCVKPH-EKSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRIPSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPT-LVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQC--QAGLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSCRTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECIEGVCISGCGSNRDCPYGEMCEGGQCRNPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYG---NALQECVVD--------------RNDCLLPNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGC--------QCPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLCKTQFGCKARPEVEAESTGRECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERL--------------LINSA-------------------------GELICPQQ--DVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICTKDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSCVKEESCGTTACGPNMACQELYGQPVCECIPGFVPKYPV-SLGCVEPAD-------------DPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPV---EETPKDACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQC----VVDRVPKP-PIRP--------------------------------LPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCIVR--------------------------GNREVCSCQPGYFGGPPNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPP---PKQPCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRC--SPNPPEPLETDPC--SACGINADCDVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAEC--------------------------SEPIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSPPNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAEC-IEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEIIDPCANRECGPYSQKVERNGICTCSCLPGYVGAPPD-CQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPCET--CGQHAICHIHNNIAACKCEDNYIDKPPN---CRRECVLHEDCPKHLACIQYKCASPCI-NQCGKNADCSVINHDPICRCLPQYFGDPLVKCEPPKVSQPIDPCLPNPCGENTE--HRKAGSNCICTCLPGFYGDPYTGCNYECLIHDDCPYNRACASNHRCSNPCIGNCGVQAICNVIEHNAICSCPEELEGDPFIRCI-------PAGCRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQYECKRHEECPSTLACRDFKCVDPCD---CAVGANCRVSN-HKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVNKHEIFCACPNGFL---FIGDFECKAPERPECVSDPECPLHLACISERCLDPCT-SQACGVNAKCTVTTHVP----VCACELDYVGDPYTVCQ------KAGCQSNSECPLSEACINRKCQDPCPFEECGRNADCSTNRHVPMCSCLTGYEGNPYEECRQ-----YECLVDSDCPYTLACPNRECIDPC---QCAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLR-PCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACI-NPCTTQNPCSSLAKCYVQDHMGKCACPAGMTGDPYVSC--LEIVTGCKSDDECQDHEACYNGNCQNPCSYPFDPCGQQAECDASN----HRAVCTCP---IEWVGNPMRECHQYECIQHNDCPNDKACIDNKCVDPCLETTCGQRALCKSEFHISHCFCPPGLQGNPIVRCFQV---------ECQQDGDCADNEKC--DLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKPNPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPC----NCGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGY-QGDPFVKCSTFECLTNDE--------CPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHM----ASCQCPPGTFGDPSIGCSPQPPVFEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPC----DCGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCR---------------------------------------------------STCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIV-VGCTSDDECGDARACINAICKDPCACGPNAVCTIENHRPVCTCKDGFYGDPEIVCKEV-GCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVNHQYVCTCPPGLEGNPYVSCSTVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSC--KKVVVGCVGDSDCPSQTACISKTCQNPCLLAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKTCPAGSGLILNEFEECVCPPGFVLDSQGICAPCRFDVGFII-ENGRCICDYTKGFVLDLSGKKCVCPENHS--INDNGICE--EEPECRVDPNCTPFEYCEGFNRTCGDPCLKWPCGPFAYGTPNDHRCQCRCIEGYTGDPNNVCTPIIVPKPPPVDIDRPEIVVNCLSDGVGVGLTISDPRYHGLIYVKGHSQDPNCRLRVD---EGQNGQRIDFHVKFGTCDLAYDEDGYAHFILVI-GHAKLMTYKSQAYRIRCIYSTGEQNISHGFNVSILTTAGTIANTGPPPTCIMRICNSNGEDISQAEIGDKLMLKVEVSPGEIYGGFARNCIARTVDETNEETVYTVTDDNGCATDPSIFKDWEYNRDKGYLSAVFDAFKFPNSNTIKFKCNIRVCFGQCQPQNCAGRNAFGRRRRESEHEIAGTV------YTGQLREEIKIESNAILAIERKAKRLQDNLQNRYIGN--EEVCVSKIGFIIALVITALLALVAVAIAVSCWLMAYRRRPRTEGPLPHPPEFPNPLFTTPEPLAEPTPDY 6128
            +C  NAEC  +    +C C   + GD   +C        N        CG N +C   +G  SC C   + GNP++GC     VD D          +C+    + CG  A+C  +     C C  G +G+P+Q      +AP++  +      C+   CG N+ C+  +   +C+C   FTG P +               +CV    +N C +S    CG  A C+ ++    C C   Y GD    C PV      S       +  CLP+                           PCG NS C  V G   CQC    VG+PP                    + C DPC   +CG  A C ++     C C EG+  +P         + +G   +D C  ++SP   CG NA C++      C C   + GDPY+GC                                              R  C  + +C  N  C               C D C   TC  N+QC   N +P C C P   +      C  + E      C+ +PCG +++C  +    VC C  G  G P + CR E    CT  S C   E+C + +CV                       C      NP   CV          N C   + CG NS CK +  +  C C   F G P  +C+    S+  C      I  +C+     +C A A+C ++      C CP  Y  +P T+         +I  C     +PCG  A C    G  SCSC     G+P++G     R  C  ++ C     C++ KC                ++PC   +CG N EC   N  P C C  G+TGNP   C          ++ D C  +PC   S C+       C C    TG P           EC  + EC    ACI  +C+N                                                   PC   PCG N+ C   N    C+C   +                   SQ      C       CGSNAQC+V    P C CFEG  G+P+   +C         P             +  C    CG NA CD     CTC   + GDP + C P        P  +A         C   CG N+ C +Y +   C+C  G  GN +  C +   T     C    CG N+VC   +G+P C+C  GY G P      C    +C  +    N +C+N  PG  G+            C C  +  G+PF  CV          + C    CGPNA C +      C C S F G  PN   E       C +N++C     C       ++ C DPC    CG N+ C   +H   C+C   +TGD            +CS N   P  ++             PC    C  N  C   + +  C C + +  N   G       C+ D+DC    SC  +    ++  P      C + AEC    HR  C C+ GYSGNP      +                E+   +  +  C P+     CG  + C V N    C C    + G P +  CR   CV N +CP +  C  ++  CMDPC N  CG  A C V  H   C C  S+           P   P    E        P G   +C+      S QC P  I     C   C+ N+ C   + C+  KC+DPC  +CG NA C+  F +  +C C  G+ G P +    +  PP   T         C  +++C +G C  MP+   +G    G       C   C  + +C + + CV   CE      C  D+ C   +V      CSC PG+E       +   ++L  N C  + CG+   C    G  +CSC    VP   G    CR          P++  S+Q C +   C+     GA+                      +CL          + C  S C P A C +  +   CSC P+F G P   K  C               +   PC G    +  C    H P C C  G+             +     + +  C   +PC ++A C  + G+  C C    +G+PY +GC+P  +C  NS+CS+D  C   +C +PC GFCG  A C V NH P C+C   + G+P ++C  +                                             EC  +++C  +++C N KCVD C   GICG+N+RC   NH P+CSCN G+TGDP                                N D P     D+++   P+    C +D  C  ++ C R +C DPC  P +CG  A C   NH  VC+CP GFTG+S V C        L+S  P S    +  C     + + C  N  C +G C        D + G       C+  C    DCP  ++C  ++C DPC    CG NA C VI     C C  G   N        ++P   Q          C+ S C P          N  C     + VC     C    I    +C   C  + DC  ++AC N +C                     DPC  S CG +A C+  NH  +CSCP    G+P   C P    P    S C  S                 C  N VC      Q+ N++  C  +   +     C   C SN++C S   C+E KC+DPC   +  CG  A C   NH   C C +  +GDP+  C                       + ++ C+ S  C     C E   L  C    +        EG C   C  + DCP    C   +C+NPC G  C  N+ CQV    P+C C   Y       C     T +    RD          +C  S  CG N++C+  N +A C C   + G   N   ECVV+              R+ C  P  CG NAQC        C C SG TGDPF  C        + P PKD C               CG  A+CK V    +C C   Y G P            RP+         C  +++C+ ++ CIR  C DPC    C  N RC    H P CTC E                +I+ A                         G L  P      +C+    C    +C+   C+NPC GT C     C V+NH  +C C                R + GNA   C      +P+      + C  + CG N  C+   GQ VC C+ GF    P     C+   D             DPC  + CG  A C V+ +   C C     GDPF+QC P     +TP + CQPSPCG  A C + + N   CSC   + G P   C PEC ++ +C + Q+C N KC DPCPG CG    C    H P C C   + G+P+ QC    + DR  K  P +P                                 P+C  N DCPS + C    C DPCP  CG NADC+V NH   C C  G+ GDP+  C +                             +  CSC P + G PP CRPECV+  +C  +  C+  +CVDPC   CG  A+C+V  H P+CSC    TG+P+ +C  +  P    P  PC PSPCG  + C+ +     C CLP ++G  P CRPEC  + +C S K C +EKC DPC   CG NA C+  NH  +C CP++  GDPF  C  +P P  P+  DPC  S CG NA C        +CSC  +Y GDPY  CRPEC+ N+DC   +AC  NKCVDPC G CG NAEC                           + + PC+P+PCG NSVC       A C C + Y G+PP+CRPEC  +S C     CV E+C +PC  +CG+ A C                                        +V  HNP+C+C   + GDP+      KP+  E    PC+P+PCG N++C +  +   SC C+ ++VG P  +CRPEC+VNS+CP   AC+  KC DPC     CG +A+C V   H+ RC C   Y G+P   C    + +       PC+   CG  +   ER+    C CLP + G P + CQP C+VN+DCP   ACI   C DPC    CG    C V +H   C C     G+    C+  P      +ERDPC    CG + IC    + A CKC       P +   C  ECV+  DCP   ACI  KC +PC  N CG  A C  INH P+C C     G+P  +C         DPC P+PC  N E   R   + CI                 EC+I+ DCP ++AC +  +C +PCIG CG+ ++C  + H  +CSCP    G+  I+C         A C  +SECP+ + C +++C DPC   +CG N+ C  + H + C+C EGF GNP + C +  C+   +CP T +C + +C+D C    C V A CR    H+  C C  G+ G+PY   + P        C  +++CP S AC +S+CV+PC    C   A C V  H   C CP G++   +          +P+C  D +CP  L C +  C DPC  ++ C   AKCTV   +P    VC C  ++ GD    C       +A C+S+++C  + AC+N +C +PC    C  NA+CS   H   C C  G  G+P+  C +      EC  ++DC    AC ++ C  PC   QC  NAEC   NH  +C C   + G+       P         +CK D DCP  + C   +C  PCL     CG  + C            C C  G   +    CI  V      C  ++DC   + C+    +  P   ++ C+  A C  ++H  KC CP G TG+PYV C  + I   CK D EC  + AC N  CQ+PC    + C  + EC   N       +CTCP   I  V    +E    +C Q  DC +   C+   C++ CL T CG  A C +      C C PG  GNP + C ++         EC  + +C+D+++C   L    C +      C   A+C A NH   C C    +GD    C   P  I A C  + DC    AC++   C NPC     C  +  C V+D  P+    C CP G        C      + CES S+C +   C N +CV+PC     C   A C   NH  IC C P Y GNP++ CE++EC  D DC  +  C    CV PCL D+ C  NA C  + H +TC CP     G+P+  C+    +T DE        C     C+ N+C+DPC V +PC +NA+C V   +     +C CP G   D    C P   +   +   C  + +C+ + +CI++ C+NPC     C  +A C V +  P    IC C  G+  +   +C  +       C +D EC  D +C+N  C +PC    +CG  AECF   H+  CRC  G  GNPL  C  IGC S+ +C     C  N  C+  C+  +PC S AEC    H  +CR                                                   S C V+ TSPVR +VC CP GY ++ +  C    PI+ + CTSD +C   ++C+NA+CK+PCACGPNA C++ NH+P+C+C  G+ G+P++ C +V GC+++S+C  +H C+  +C PVC P    CG DA C G+NH+ +C CPPG  GNP VSC  + C+ NS+C  ++ACIN++C++PC I + C     C V NH V+C CPPGY G     C  +K+   C  D++CPSQTAC +  C NPC+  EPCG+NA C VLDT P+RTM C C+PGY G+A ++C     CP   G IL+E+  CVCPPG   D   +C PCR   G II + G C+C    G ++D  G+ CVCP +H   ++ NG C+  +  EC+ D +C    +C+  ++TC DPC    CG +A      H+  C CI GY G+    C      +    D  RPE+VV+CLSDGV V + + D  + G++YVKGHS+D  CR  V    E  +   I F V FG C L +  +G A F+LVI  H KLMTYK+QAY I+CIY TGEQN++ GFNVS+LTTAGTIANTGPPP C+M+I   +G +I+ AEIGD LML+VEV P  IYGGFARNC+A+T+ E N E  Y VTD+NGCATDP+IF +WE + +   L A F+AFKFP+S+ I+F+CNIRVCFG+CQP NC G NAFGRRRR+   E   T       + GQLREEI I+SN I  +ER+ +R   +          E++CVS +GF+IALVITALLALVAVAIAVSCWLMAYRR+P+T GPLPHPPEFPNPLFTT E +AEP+PDY
Sbjct: 7645 SCGANAECRVVSHTPMCACSNDYTGDPFTQCTPTPPVPVNLSPCSPSPCGFNAMCKELNGVGSCSCAADYIGNPYEGCRPECVVDTDCPSTLSCIRSKCQDPCPSTCGTNAQCRVINHRPACTCIPGYTGNPFQ---YCSIAPAIEDETEYKDPCSPSPCGPNSQCRVVNGQGVCSCLPEFTGAPPMCRPECTLNSECPQDRACVKQKCVNPCPAS----CGTFASCVIRNHSPICACRPLYTGDPFTRCFPVPQS---SPPTAVETSQPCLPS---------------------------PCGPNSECRVVSGSPSCQCRPNYVGSPPNCRPECTVNSDCSPSQACVREKCTDPC-PGSCGSNAQCMVLSHVPICSCFEGYTGDPFNGCNLTPVMPTGPTVVDPC--ALSP---CGANARCNDG----ICTCLPEYQGDPYVGC----------------------------------------------RPECVLNGDCPQNKACLRN-----------KCVDPC-PGTCGVNAQCQTYNHVPMCSC-PSGMVGNAFVQCNVVQEAEKENPCSPSPCGPNSVCREINEQAVCSCVAGYLGSPPT-CRPE----CTVSSDCPLTEACNNQKCVNPCPGTCGFRATCNVVNHNPVCSCPADLTGNPFVQCVLRPPVPVVPQNPCEP-SPCGPNSECKVVNDAPSCSCSLEFIGTP-PNCRPECASNSECPSQMACINQKCRDPCPGSCGANAEC-RVVSHTPMCVCPGDYTGDPFTQCAPRPPVPINISPCTP---SPCGFNAICKEQNGVGSCSCLINYMGNPYEG----CRPECVVDTDCPSTLSCIRSKC----------------QNPCPG-TCGTNTECRVINHRPACTCIQGYTGNPFQYCTPIPQIEDETQNKDPCNPSPCGPNSQCVIVNGQGVCSCLAEFTGTPPM------CRPECTLNSECPQDRACINQKCVNPCPASCGTFATCVVRNHSPICACRESYTGDPFTICFPAPQATPPTAVQVTQPCLPSPCGPNSECRVVNGGPSCQCLPTYIGSPPSCRPECTVNSDCSPSQACMRERCRDPCPGSCGSNAQCMVLNHIPICSCFEGYTGDPF--SNCYPAPIKPTEP-----------NVVDSCASSPCGPNARCD--NGVCTCLPEYQGDPYVGCRPECVLNTDCPLNRACIRNKCVDPCPGTCGLNAECRVYNHVPMCSCPSGMVGNAFVQCNILQDTVKGNPCSPSPCGPNSVCREINGQPVCSCVTGYLGAPPSCRPECTVSSDCPLTEACNNQKCVNPCPGSCGFRATCNVVNHNPICSCPPELSGDPFVQCVPRPPEPAVPQNPCEPSPCGPNAECRVVNDAPSCSCLSEFIGSPPNCRPE-------CASNSECPSQLACV------NQKCRDPCP-GSCGTNAECRVVSHTPLCVCPSDYTGDP---------FTQCSPNPPVPVNKS-------------PCTPSPCGFNAICKEQNNVGSCTCLADYVGNPYEG---CRPECVVDTDCPSTQSC--IRSRCQDPCPG----TCGTNAECKVINHRPACTCIQGYSGNPFQHCALI---------------REIEDETKYKDPCNPS----SCGPNSQCRVVNGQAVCFC-LPEYTGTPPM--CRP-ECVLNSECPQDRAC--VNQKCMDPCPNS-CGTFATCVVKSHSPICACRESYTGDPFIRCFPAPQALPPTAVEATQPCSPSPCGPNSECRVVNGGPSCQCLPTYIGSPPNCRPECTVNSDCSPSKACMGEKCRDPCPGSCGFNAQCT-VFNHVPMCSCIAGYTGDPFSQCNQLVTPPAEPTQTDLCNPSPCGPNAICNDGICSCMPD--YYGDSTIG-------CRPECVLNNDCPRNKACVRNKCENPCVGACAPDAIC---DVVNHVPMCSCSPGFEGNAFAFCRPAIAELPSNPCNPSPCGSNSQCRVKNGQAVCSC----VPGYLGNPPICRPECVVSSDCPPNESCSNQKCINP--CVGSCGLGARCTVANRNPICHCPEGFTGDPFIRCLPLPPIQPEPINVCQPSPCGPNAQCQISGNSPSCSCLPEFIGSPPYCKPECISNSECPTSLACINQKCRDPCPGSCGANAECRIISHTPMCVCSSGFVGDPFVQCTPKPVIQDQEIEKLTPCVP-SPCGSNAVCNEQNGAASCKCITDYIGNPY-EGCRP--ECIVNSDCSADQACVRSKCQNPCPGFCGYNAMCQVVNHVPLCTCQSGYTGDPFVQCNFIQAPPEPADPCNPSPCGLNSLCRVFNGQAICSCSPTFLGSPPMCRPECTVSSECTTNRACKNLKCVDPC--PGICGINARCEAINHSPICSCNVGYTGDPFVRCFKVPTVPEPVNPCVPSPCGPFSVCRVVGNADLPSCTCMDDYIGTPPNCRPQCTIDSECASNRACLRQKCTDPC--PGSCGTGAECLVVNHMAVCTCPQGFTGDSFVNC-------FLES--PPSPTAPQDAC-----NPSPCGSNALCRDGTCTCLPEYHGDPYYG-------CRPECVQNPDCPLDRACNRNKCFDPCTGV-CGQNAECVVINHTPMCSCPDGMSGNAFTACFPVKDPEIVQP---------CNPSPCGP----------NSRCQDISGQAVC----SCAPGYIGNPPACRPECIVNSDCPLNEACVNLKC--------------------RDPCPGS-CGVSARCQVVNHNPICSCPSIFTGDPFVRCLPKPEEPVQPTSPCQPSP----------------CGPNAVC------QVVNNSPSCSCKPEFIGAPPNCKPECISNSECGSHLACIERKCRDPC---SGSCGSNAECHVVNHVPSCICSKDFTGDPFVQCIARQPE---------------TTVASRPCQPSP-CGANAICREQNDLSSCTCLPEYIGNP--YEG-CRPECTRSSDCPSHLACIRFKCQNPCPG-SCGSNTNCQVVNNLPVCTCIPQYTGDPYVNCIYKAPTIDED-ERD----------VCQPS-PCGPNSQCQKVNGQAVCSCQPQYVGTPPNCRPECVVNSECNSNLACINQKCRDPC--PGTCGRNAQCKVVHHSPICSCGSGLTGDPFVYCFPAPMPKPEEPYPKDPCTPS-----------PCGSNAMCKAVGETPVCTCINNYIGVPP---------NCRPQ---------CSINSDCTADRACIREKCRDPCP-GSCGVNARCTVVNHTPACTCPEGYTGDPFTSCSPTPPPIISEAPTDPCNPSPCGPNAQCNSGVCTCLPGYLGDPYTICRPECVINTDCSRNEACLLHKCRNPCVGT-CGINAECNVINHLPMCSCP---------------RNMTGNAFVSC------NPIQETTAIDLCNPSPCGSNSHCRPSNGQAVCSCVTGFKGSPPYCRAECIVSTDCPRNRACSNQKCIDPCLGA-CGLSAQCSVINHNPVCSCFEQYTGDPFVQCVPQIKEPDTPINPCQPSPCGPNAQCQVTN-NAPSCSCLPEFVGVPPY-CKPECLSNTECSAQQACINQKCADPCPGSCGRNTECRTISHTPMCTCASNFTGNPFVQCTPQPIEDRPQKLNPCQPSPCGPNAICRESYGTARCTCLPDFYGNPYENCRPECIINADCPSNRACIRNKCQDPCPGTCGFNADCQVVNHIPICSCSSGYTGDPFTACSILKQPPATSLTNPCEPSPCGPNSKCANVNGQATCSCLPDFKGTPPGCRPECVVSTECASNRACVNQKCVDPCPGVCGINARCEVFHHSPICSCDPRQTGDPFVKCFDVTTPSLPVPVNPCVPSPCGPFSQCQDIGGIPSCSCLPNYVGSAPNCRPECSINSDCTSDKACIREKCRDPCPGSCGTNAYCNVINHTPVCTCPTDYTGDPFTSCRLTPTPVLPVSVDPCNPSPCGPNALCR-----NGVCSCISEYRGDPYQGCRPECVQNSDCTFDRACSNNKCVDPCTGICGQNAECVVVNHIPTCSCVENHEGDPFTLCRPIRKRVKPCEPSPCGPNSVCRE-FGEQASCSCLSGYFGTPPSCRPECLVNSDCEQSRACVNERCQNPCENVCGQGALC----------------------------------------NVRNHNPICSCPAQYSGDPFVSCFPMKPQYEEPSQDPCKPSPCGPNSQCTVSSDNKASCACMPEFVGSP-PNCRPECLVNSECPSNQACVRQKCTDPC--TGLCGTDALCQVTL-HYIRCVCPEGYTGNPFAICSVASTPVEPPTPSRPCSPSPCGTNAYCRERHNTAYCECLPDFRGNPYEGCQPECLVNTDCPKSQACIRTKCQDPC-PGTCGVGAICTVSNHIPICSCPLPTIGDAFTICHAVPQ---VPKERDPCSPSPCGPNTICQKIGDSAVCKCLPGLQGVPSSVTGCHPECVISSDCPGDKACIGNKCINPCTQNVCGIKATCQAINHSPLCSCTSPLIGNPFEEC---YTKIETDPCNPSPCSYNGECQVRNGVAACI---------------YPECVINSDCPRDKACFA-QKCRDPCIGACGINSLCQTVNHKPVCSCPSGFTGNARIQCTVLTVEEPTAECTQNSECPNDKTCYNQKCVDPCTLDSCGFNSRCHVQMHRAVCVCNEGFTGNPQQYCGEIGCRGDSDCPLTQSCINNECIDACSVTQCGVNAFCRSDGYHRPRCYCSDGYLGNPYQACERPE-------CVSDNDCPSSLACRDSKCVNPCD---CPPSAQCFVINHRPICRCPPGYVGNPYTSCLMEPIEPQPQCQVDGDCPSKLGCFNGVCKDPCVETKPCIAGAKCTVVDTLPMRTMVCECLQNFAGDATVACIPVDKQIEAICKSDTQCSSNMACLNERCINPCIINPCASNAECSVQNHYRQCHCSRGTAGDPFVNCYRDTDSFPECTTNADCATNEACISQLCQSPCVSTQCGLNAECITVNHHPTCRCQQNYAGDPQVQCFKP---------ECKSDSDCPYDKTCLRDNCVTPCLVGDIACGRGAEC----IAVSHRAQCVCPRGTQGDPRIACISTV------CHYNEDCADHEACDRLNRVCRPVCEEDTCADNANCVARNHQPKCTCPLGTTGNPYVECSGVPIEAECKEDSECPAYFACINSKCQDPC-LSSNMCSGEQECKVLNTVPLRTMICTCPANTITDVNGLCKEIGVLQCHQDQDCNDSDKCVGGTCIEACLTTQCGVNAQCVAN---GICHCAPGFTGNPYIECGRLPIPLPPVRPECYANSECSDDKRCINSLCVNPCVV---EDPCGRNALCHANNHNPVCRCPANYIGDPRSNCV--PPEIVAECTSNSDCAGNAACVNN-LCINPCN----CGPNAKCNVVDHYPS----CVCPPGYSGNPQLGCFK----LDCESDSECNSAATCYNGQCVNPCILENKCAINAECYGQNHRAICRCGPGYLGNPEVHCERVECSADHDCPRNLACDSGRCVSPCLEDSPCAQNAICYVQDHVATCRCPENIPAGNPYSYCTHHPTITFDEPECRIDIDCADKLVCIKNKCIDPCPVIKPCLQNARCNVLDTVPVRTMTCTCPEGWTTDVDGVCRP---IQIAIIGTCTTNDECSDTESCINRQCRNPCN----CGTNAACIVRNHKP----ICSCEEGYQGNPDIACYSV------ECTRDSECALDKSCVNNNCVNPCLISDNCGVNAECFPNNHKADCRCRNGYHGNPLDRCRVIGCYSNGDCPGDHSCI-NMQCINPCVHSNPCSSRAECRVFNHLPICRCPPHHTGNPYIACKPEERPECKEDSDCPNLLACFDNKCQNPCTVVQPCSDPSECKVLPTSPVRTMVCVCPSGYVSSGSGTCRPTKPILEIECTSDSDCPSEKSCVNAVCKNPCACGPNAKCSVANHKPICSCVLGYDGNPDLACTKVAGCRTDSDCSGSHACVQHNCVPVCSPLITTCGKDAQCNGINHKAICECPPGYGGNPRVSCVLLGCKSNSDCPTNKACINERCENPCGI-NPCSGNMDCNVYNHVVECACPPGYIGDTKVGCTKRKMTEKCKADNECPSQTACFNGECINPCVKIEPCGINADCKVLDTSPVRTMICECIPGYRGNAVVRCDKTNVCPVEKGQILDEYGNCVCPPGSAKDETEVCIPCRKQSGMIINDEGYCVCALENGMIIDEYGR-CVCPIHHGYRLDGNGYCKLVDIIECKHDDDCADNRFCDKTSQTCEDPCSTQLCGLYALCNATRHQAICICINGYIGNAYTQCYDKNRWR---TDFPRPEMVVSCLSDGVQVEIHLHDQEFDGVLYVKGHSKDEQCRRVVSIPAETMHKTEI-FKVAFGNCGLIH-VNGQASFVLVIQKHPKLMTYKTQAYHIKCIYQTGEQNVTLGFNVSMLTTAGTIANTGPPPVCLMKIVTQSGNEINSAEIGDNLMLQVEVQPSTIYGGFARNCVAKTM-EDNLENEYIVTDENGCATDPTIFGEWEQDPETQTLMASFNAFKFPSSDNIRFQCNIRVCFGRCQPVNCRGYNAFGRRRRDVSSETNDTSLSITDGFEGQLREEITIQSNLIFTLERREERFTADPAEITSAQRVEDICVSTVGFVIALVITALLALVAVAIAVSCWLMAYRRQPKTAGPLPHPPEFPNPLFTT-ESVAEPSPDY 13781          

HSP 3 Score: 1915.2 bits (4960), Expect = 0.000e+0
Identity = 1994/6692 (29.80%), Postives = 2748/6692 (41.06%), Query Frame = 0
Query:  163 TCVQNAECCNLPAHYVCKCKPGFEGDGKVECRDIDECL-----TNQVCGINTLCINTHGNFSCECLPGFHGNP---HDGCVDIDECR----------TNPC----GIGAKCTNLLGNYQCQCPAGLSGDPYQGACQAQVAPSVSQQGCNAQSCGQNALCQRSSNGLICTCREGFTGDP---------------KISCVDINECQSSSLYQCGVGAICINQSPGYRCECPAGYNGDGRFACEP---VKVRTTCSSDFDCTNNAQCLP---NGSCAC--------RKGFQPNGVLCQDI------------DECQSTENPCGANSICLNVPGDYECQCIAPLVGTP-----------PEQPCRDPCLEVNCGQRASCQIVKSEAFCICEEGWAYNPKEISSGCLDIDEC--------DKSISP-TGKCGVNAICSNSPGSFNCVCAKGFNGDPYIGCFDIDECAENRFI----------CGREALCTNQVGSYSCQCYNGGQYDPSSLSCQEKRRSCQSDQECIGNAVCFNGACNCQEPYVGPNCEDACRDATCFPNSQCLVQNGLPFCQCLPGFK-----------LSPNGRSCIDIDECAGNPCGQDAICENLLGSFVCKCPKGTNGDPLSGCRGESTFECTQDSQCDQGESCLSSRCV-----------------------CRRGYERNPAGDCVDLNECLLGNVC-----GVNSVCKNLPGSYDCECPSGFQGNPFTSCQSCSGSSCSCLPPYQDIEGRCQLADCSN-----CEAPAKCVQITGGISYCACPRGYEMNPRTKNCEDIDECQAIGH----TPCGSGADCLNNPGSFSCSCPPGQGGDPFQGSCLPLRSACSSNSQCRENEECLQGKCICSPPFFVDTLDGNHCKSPCHRFSCGFNAEC-TPSNPPQCLCKAGFTGNPLTGCE-------DLDECALNPCKQGSICINKLATYQCECPPGTTGDPYTNGCSGSKSVECGADDECHGQLACIGSQCINPCSSVPCGSNANCVAENHAAWCRCKSGFAEDSQGNCVSL------------CNQVICGSNAQCIVSPSGPTCQCFEGMVGNPYPGGHCSLLSCSSASPCLEQGQTCQGGRCITQCGQEQCGVNAFCDPNRLSCTCQSGFLGDPTLVCMPPTQQAECSSECGTNSHCIYGNPNS-CACNIGYFGNPYTGC---------EVTTSVEDCDSLKCGDNAVCSFASGKPECTCKRGYDGIP--------------------YERCQDVDECLFSVCGKNAQCINTPGGYDCRCHSDFVGNPFEGCVHLEAVTEDD---DLCANQQCGPNAICNLGQCLCASGFKGDDPNDLVEGCSSAATCQTNT-------------DCGYNEICSTIAHS----------GHRFCS----------DPCQQAQCGPNSFCITDNHQKSCICQDGFTGDANDPQRGCQREEKCSTNEDCPAGRTCHINFNGEQTCLDPCQIMSCPTNEKCMVSDGMPICLCNSGFEKNKLT------------------GSCDVYQGCLADSDCAQGHSCNEVSFGMKNCVPAC-DLVNCPSGAECVSEGHRGYCRCLPGYSGNPDDRSGCMIFSQNK---CSSNAECAESEVCKRSNGQRSCQPACSYLECGVGAVCVVRNHVGKCICPQGLFVGNPQIEGCRKVSCVENEDCPDNEFCDRLSYTCMDPCQNEICGENALCTVAGHQHKCQCPPSFIPSPTPE--VLCEKNDR---GDLC------PFGQCQTTCASSS-QCPPGQICKSGICAAGCSSNTHCEEGRVCITGKCQDPCTETCGPNALCSPEFEN-LCQCPEGFAGVP-----TAAQGCVRIPPTCTTDCPASSLCFNGYCMPECTSHGQCARGEQCSNGMCLKLCHTDKNCLQGEICVDKFCEPGCRTDSDCRLGEVCGAGGQCSCQPGYEMTQSGCSDLNECKNNICGAGKTCANTPGSYICSCPTNQVPDESGACRSPDQCSSDQDCNDALACLADSLSGAKKCLDPCDISYCTPLATCNVIQHKAFCSCPPKFRGDPTNPKIGCY------------------QVEYPCEGFTCGHGSCHPEDHAPKCHCQDGYQ--LIGSNCQDIDECASG----NPCHNSAKCTNEQGSYQCTCHDGMVGDPYTQGCKPKAQCYSNSECSSDTRCQNGRCVDPCDGFCGIGAKCVVKNHSPKCSCLPRWRGNPKIKCELL----------------------------------------------ECVENADCDASKSCLNNKCVDACQLSGICGLNSRCRMSNHGPVCSCNSGHTGDP------------RECEQNLDCPGDGKCDNFVCVK----------------PHE---KSCLVDINCNDDQVCSRSECKDPCQQPNACGVNALCASKNHQQVCSCPPGFTGNSKVECVRI-----------PSTCILDSNCPGSMQCHKSICMHQCQSHNDCAINERCDEGKCLLTCGVDNDCFLGHVCLDKMCKVGCSAPKDCPNSQSCINHQCQDPCKAAQCGPNALCQVIERQAFCVCQRGFIPNPSPVVACTREPITCQGNKQCPENFLCDASFCKPVCFADSDCEANELCHGKICKEVCRSDSQCQSKEICQGISCSQGCRSDPDCTADKACHNNQCIGRSSKRKVTNRTGSIIAHLADPCSVSYCGANAECRTKNHQALCSCPEGMEGNPIEHCQPTLVPCSSASDCPQSKTCSQGTCVAQCQLQGDCLQNEVCNEGLCVQICNSNTQCQAGLVCIDRQCVGGCSSNTQCPSESVCVEGKCQDPCQNEASVCGECATCTTQNHQLQCQCPRGTSGDPYQSC---RTNYLRCGSTKNQCGSGLNCHRGLCAKSCEASAECNCGESCHEGFCLQQCQIASDCQNGAECI----EGVCISGCGSNRDCP---YGEMC-------------------EGGQCRNPCNGFECEPNSFCQVNGRNPLCLCDRGYQRLASGGCAKTECTTNGQCSRDKSCEGGRCINLCSESNSCGKNAECRMNNHRAQCVCPSGFYGNALQECVVDRNDCLL------PNQCGENAQCLNQLGGFDCVCRSGCTGDPFQGCQ--------CPTPKDSCRTKGACLNPCNLRGSCGKQAICKVVNHQALCECPECYGGNPDVLC-----------------------------KTQFGCKARPEVEAESTG--RECGRSAECSLNQECIRGACVDPCATHKCEDNERCIAQRHKPKCTCKERLLINSAGE-LICPQQDVQCLYEDQCPSTLSCIDGACQNPCQGTSCPDGKSCQVLNHQALCICT-------------------------------KDPCSISPCGDEAICRAVEGNAICECPEGTRGDPLDSC----------VKEESCGTTACGPNMACQELYGQPVCECIPGFV--------PKYPVSLGC-------VEPADDPCTPSPCGAFANCLVVLNQLKCVCPPGLFGDPFIQCQPVEETPK-DACQPSPCGSKANCNINDENQAICSCWEGYFGNPLTGCLPECQTDQDCPSDQSCNNLKCQDPCPGFCGIGASCEVEQHKPTCRCREGYKGDPYRQCVVD-RVPKPPIRP----------------------------------LPQCQRNQDCPSFKVCDDGNCVDPCPERCGLNADCRVQNHQVQCFCQPGFKGDPYYQCIVRGNREV--------------------------CSCQPGYFGGP-PNCRPECVIQEDCPYDHHCLRGQCVDPCVNNCGEGAQCQVVKHKPMCSCPDGSTGNPYKRCQIIVRPPPKQ---PCFPSPCGANAVCKIVRAQEKCHCLPGFLGDPPYCRPECLADHECPSHKICHQEKCIDPCENVCGINALCHTKNHKVICVCPSNMQGDPFDRC--SPNPPEPLETDPC--SACGINADC-DVRPNDQVICSCPKDYLGDPYIECRPECLTNADCPSHQACLRNKCVDPCIGTCGVNAECSE-------------------------------PIDPCQPNPCGLNSVCESNVNGLALCRCQNDYIGSP-PNCRPECTEDSACPNHLKCVREKCVDPCPGICGRNAECKHTNMSSAQCAHFQGQKLASFSSLRRANNPLIVDLLNILGHVMRHNPMCTCLEGFIGDPYNEGCIRKPEAIENEVTPCEPNPCGSNAECIEQNQSGSCRCIEDYVGDPFVSCRPECVVNSDCPYGLACLSHKCKDPCEHNQACGINAVCNVNNNHHARCSCLNDYVGDPQVECHKPPSGIVTEEIIDPCANRECGPYSQ-KVERNGICTCSCLPGYVGAPPDCQPICVVNSDCPAHLACINNDCVDPCFQNVCGSNTHCYVKSHQAKCECFPGYDGNPLIGCNKGPTGTITAEERDPCET--CGQHAICHIHNNIAACKCEDNYIDKP-PNCRRECVLHEDCPKHLACIQYKCASPCINQCGKNADCSVINHDPICRCLPQYFGDPLVKCEP-PKVSQPIDPCLPNPCGENTEHRKAGSNCICTCLPGFYGDP--YTGCNYECLIHDDCPYNRACASNHRCSNPCIGN-CGVQAICNVIEHNAICSCPEELEGDPF-----------------------------IRCIPAGCRSDSECPSTEACIDRECRDPCPFQTCGVNAECETRSHLSTCICLEGFEGNPYEGCTQY-------ECKRHEECPSTLACRDFKCVDPC---DCAVGANCRVSNHKTTCTCPPGFTGDPYSRDDPPRPPILTVGCEGNHECPDSHACINSRCVDPCISNPCKNGATCTVN-KHEIFCACPNGFLFIGDFECKAPERPECVSDPECPLHLACISERCLDPCTSQACGVNAKCTVTTHVPVCACELDYVGDPYTVCQ------KAGCQSNSECPLSEACINRKCQDPC-PFEECGRNADCSTNRHVPM----CSCLTGYEGNPYEEC----RQYE--CLVDSDCPYTLACPNRECIDPC---QCAANAECSVQNHKASCTCLPGFQGNAYTGGCSPILEPVVEDNKCKQDGDCPSRQACFDGDCKNPCLFLRPCGAHSICQVHDTVPKRTVACNCESGYTSNGNKECIRQVEPIEFGCQTHQDCPPSQVCNNAACINPCTTQN-PCSSLAKCYVQDHMGKCACPAGMTGDPYVSCLEIVTGCKSDDECQDHEAC--YNGNCQNPCSYPFDPCGQQAECDASNHRAVCTCPIEWVGNPMRECH----QYECIQHNDCPNDKACIDNKCVDPCLET-TCGQRALCKS----EFHISHCFCPPGLQGNPIVRCFQV---ECQQDGDCADNEKCDLRAQTCQLICNAQSCVSGAICEAKNHRKTCFCQPPLVGDGNVYCTIKP---NPIEAGCRIDRDCPSQHACISEGRCQNPCLVRNPCNSDQTCQVIDTDPTRTVVCQCPIGMFVGNGGSCIAAPSLVGCESSSKCKADQACLNAKCVSPCNCGTGALCDVINHTPICYCPPKYSGNPQIACEKLECRNDDDCGDHQRCYDNLCVDPCLIDNECGINAECIPRSHQSTCECPPGYQGDPFVKCSTFECLTNDECPPTKFCMVNQCLDPCVVNEPCGRNAQCRVSQHMASCQCPPGT-FGDPSIGCSPQPPV-FEPVEAECRIDSDCASSLACIDQSCQNPCYTIDPCDKSAVCSVVDTVPFRTMICKCRVGWVPDSSRSCVFLPTDTILGCVKDDECPKDSACINRMCKDPCDCGRGAECFLTGHRPVCRCPEGTKGNPLIECTPIGCQSDNECQDPDVCAPNGNCVPACLLQSPCGSNAECYGLGHRALCRSTCHVVDTSPVRRIVCECPKGYFTNENNQCLTLTPIVVGCTSDDECGDARACINAICKDPCA----CGPNAVCTIENHRPVCTCKDGFYGDPEIVCK---EVGCQSNSECETTHECINGDCTPVCGPDHVPCGGDAICQGVN----HQYVCTCPPGLEGNPYVSCS------TVECRDNSECTPDRACINKQCQDPCAISDQCVDVAQCVVENHQVDCTCPPGYEGTRGNSCKKVVVGCVGDSDCPSQTACISKTCQNPCL-LAEPCGVNAKCTVLDTLPIRTMTCVCLPGYEGDASIQCTPVKTCPAGSGLILNEF---EECVCPPGFVLDSQGICAPCRFDVGFIIENGRCICDYTKGFVLDLSGKKCVCPENHSINDNGICEEEPECRVDPNCTPFEYCEGFNRTCGDPCLKW-PCGPFA----YGTPNDHRCQCRCIEGYTG------DPNNVCTPI----IVPK------PPPVDIDRPEIVVNCLSDGVGVGLTISDPRYHGLIYVKGHSQDPNCRLRVDEGQNGQRIDFHVKFGTC------DLAYDEDGYAHFILVI--------GHAKLMTYKSQAYRIRC------IYSTGEQNISHGFNVSILTTAGTI---------ANTGPPPTCIMRICNSNGEDISQAEIGDKLMLKVEVSPGEIYGGFARNCIARTVDETNEETVYTVTDDNGCATDPSIFKDWEYNRDKGYLSAVFDAFKFPNSNTIKFKCNIRVCFGQCQPQNC-----------AGRNA--------FGRRRRESEHEIAGTVYTGQLREEIKIESNAI---LAIERKAKRLQDNLQNRYIGNEE 6060
            TC +NAEC       +C C  G  G+  V C    + +     +   CG N++C   +G   C C+ GF G P      C    +C            NPC    G  A C  +  N  C CP  L+GDP+         P+V Q  C    CG NA C+  ++   C+C   + G P                ++C++  +C+      CG  A C   S    C C   Y GD    C P   V V  +  S   C  NA C      GSC+C         +G +P  V+  D             D C ST   CG N+ C  +     C CI    G P            E   +DPC    CG  + C++V  +  C C   +   P      C    EC         K ++P    CG  A C     S  C C   + GDP+  CF + + +    +          CG  + C    GS SCQC     Y  S  +C   R  C  + +C  +  C           V   C D C   +C  N+QC+V + +P C C  G+            + P G + +D   CA +PCG +A C +     +C C     GDP  GCR E    C  +  C Q ++CL ++CV                       C  G   N    C  + E    N C     G NSVC+ +     C C +G+ G+P T    C+ SS         +   C    C N     C   A C  +      C+CP     NP  +            +    +PCG  ++C     + SCSC        F G+    R  C+SNS+C     C+  KC                + PC   SCG NAEC   S+ P C+C   +TG+P T C        ++  C  +PC   +IC  +     C C     G+PY  GC      EC  D +C   L+CI S+C NPC    CG+N  C   NH   C C  G+  +    C  +            CN   CG N+QC++      C C     G P                                C + +C +N+ C P   +C  Q          C+ P     C + CGT + C+  N +  CAC   Y G+P+T C               + C    CG N+ C   +G P C C   Y G P                     ERC+D   C  S CG NAQC+       C C   + G+PF  C        +    D CA+  CGPNA C+ G C C   ++GD        C     C  N               CG N  C    H           G+ F            +PC  + CGPNS C   N Q  C C  G+ G        C+ E  C+ + DCP    C+      Q C++PC   SC     C V +  PIC C      +                       C     C   +D       +E      NC P C     CPS   CV++  R  C   PG  G     + C + S      C S+        C  +      +  C+   CG  A+C  +N+VG C C    +VGNP  EGCR   CV + DCP  + C R    C DPC    CG NA C V  H+  C C   +  +P     ++ E  D     D C      P  QC+     +   C P       +C   C  N+ C + R C+  KC DPC  +CG  A C  +  + +C C E + G P      A Q    +PPT      A+  C    C P   S  +   G                 CL   I     C P C  +SDC   + C  G +C                + C  + CG    C       +CSC      D                CN  +   A+         D C+ S C P A CN       CSC P + GD T   IGC                   + E PC G       C   +H P C C  G++          I E  S     +PC ++++C  + G   C+C  G +G+P    C+P  +C  +S+C  +  C N +C++PC G CG+GA+C V N +P C C   + G+P I+C  L                                              EC+ N++C  S +C+N KC D C   G CG N+ CR+ +H P+C C+SG  GDP            +E E+   C       N VC +                P+E     C+V+ +C+ DQ C RS+C++PC  P  CG NA+C   NH  +C+C  G+TG+  V+C  I           PS C L+S C                         R   G+ + +C      FLG      MC+  C+   +C  +++C N +C DPC    CG NA C+ I     C C  G+  +P   V C + P   +    C  +     S C+ V  AD                       C    I    +C   C  D +C +++AC   +C                     DPC  S CG  AEC   NH A+C+CP+G  G+   +C           + P S T  Q  C         C  N +C +G C  +   +     G       C   C  N  CP +  C   KC DPC     VCG+ A C   NH   C CP G SG+ + +C   +   +      + CG    C       S +A   C  G   +   C  +C + SDC     C+       C   CG +  C    +  +C                   E  Q  +PC    C PN+ CQV   +P C C   +  + +    K EC +N +C    +C   +C + CS   SCG NAEC + NH   C+C   F G+   +C+  + +  +      P+ CG NA C  Q     C C     G+P++GC+        CP+     R K  C NPC   GSCG    C+VVN+  +C C   Y G+P V C                               Q  C  +P+          EC  ++EC+ N  CI   C DPC    C  N +C    H P C+C   L  +        P    +  Y               ++PC  + C     C+ +    +C C                                +DPC  S CG  A C  V     C CPEG  GDP  SC             + C  + CGPN  C       VC C+PG++        P+  ++  C       +    +PC  + CG  A C V+ +   C CP  + G+ F+ C P++ET   D C PSPCGS ++C  ++  QA+CSC  G+ G+P   C  EC    DCP +++C+N KC DPC G CG+ A C V  H P C C E Y GDP+ QCV   + P  PI P                                   P+C  N +C + + C +  C DPCP  CG N +CR  +H   C C   F G+P+ QC  +   +                           C+C P ++G P  NCRPEC+I  DCP +  C+R +C DPC   CG  A CQVV H P+CSC  G TG+P+  C I+ +PP      PC PSPCG N+ C  V  Q  C CLP F G PP CRPEC+   EC S++ C  +KC+DPC  VCGINA C   +H  IC C     GDPF +C     P  P+  +PC  S CG  + C D+       CSC  +Y+G     CRPEC  N+DC S +AC+R KC DPC G+CG NA C+                                 +DPC P+PCG N++C + V     C C ++Y G P   CRPEC ++S C     C   KCVDPC GICG+NAEC                                         V+ H P C+C+E   GDP+    + +P  I   V PCEP+PCG N+ C E  +  SC C+  Y G P  SCRPEC+VNSDC    AC++ +C++PCE+   CG  A+CNV N H+  CSC   Y GDP V C  P      E   DPC    CGP SQ  V  +   +C+C+P +VG+PP+C+P C+VNS+CP++ AC+   C DPC   +CG++  C V  H  +C C  GY GNP   C+   T         PC    CG +A C   +N A C+C  ++   P   C+ EC+++ DCPK  ACI+ KC  PC   CG  A C+V NH PIC C     GD    C   P+V +  DPC P+PCG NT  +K G + +C CLPG  G P   TGC+ EC+I  DCP ++AC  N +C NPC  N CG++A C  I H+ +CSC   L G+PF                               CI   C  +S+CP  +AC  ++CRDPC    CG+N+ C+T +H   C C  GF GN    CT         EC ++ ECP+   C + KCVDPC    C   + C V  H+  C C  GFTG+P             +GC G+ +CP + +CIN+ C+D C    C   A C  +  H   C C +G+L      C   ERPECVSD +CP  LAC   +C++PC    C  +A+C V  H P+C C   YVG+PYT C       +  CQ + +CP    C N  C+DPC   + C   A C+    +PM    C CL  + G+    C    +Q E  C  D+ C   +AC N  CI+PC    CA+NAECSVQNH   C C  G  G+ +               +C  + DC + +AC    C++PC+  + CG ++ C   +  P     C C+  Y  +   +C +        C++  DCP  + C    C+ PC   +  C   A+C    H  +C CP G  GDP ++C+  V  C  +++C DHEAC   N  C+  C    D C   A C A NH+  CTCP+   GNP  EC     + EC + ++CP   ACI++KC DPCL +  C     CK           C CP     +    C ++   +C QD DC D++KC     TC   C    C   A C A      C C P   G+  + C   P    P+   C  + +C     CI+   C NPC+V +PC  +