BLAST Search

Query Comment (optional, will be added to output for your use):

NOTE: If the input sequence is less than 30/50 letters you should change the default paramter 'Task' to 'blastn-short' or 'blastp-short' or you can miss matches.

Upload Local TEXT File: FASTA, GCG, and RAW sequence formats are okay
WORD Documents do not work unless saved as TEXT.

Type or Paste a Query Sequence : (No Comments, Numbers Okay)
MFEKCFGIDLPKYPVPAISSNLESVVTTPIGRNHDKKIGFDKNKSIGSLMWQGREAEAIRQLQRYIEHKANISSFEKLNVTSQSLISSSTGLSCYLRFGYHSPRLLYHSMRTFSEQMRSLLYLYFVTYCGDNFSMWLRFITTGAMRECGCGYHIILSFNNFYMFIILSKLVVKLILMGTIFAPEDIRRQVGCVIGVDYPVPILPSLLKKAF

Choose the Appropriate Search Program:

Choose a Sequence Database:

or

Options: For descriptions of BLAST options and parameters, refer to the BLAST documentation at NCBI.

Output format :
Task :
Cutoff Score (S value) :
Word Length (W value) :		Default = 11 for BLASTN, 3 for all others
% Identity :
Expect threshold (E threshold) :
Other options :		-option=value, Advanced options, see BLAST documentation for details.