EMLSAG00000000013, EMLSAG00000000013-682779 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000013
Unique NameEMLSAG00000000013-682779
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000013 vs. L. salmonis peptides
Match: EMLSAP00000000013 (pep:novel supercontig:LSalAtl2s:LSalAtl2s10041:1:462:-1 gene:EMLSAG00000000013 transcript:EMLSAT00000000013 description:"maker-LSalAtl2s10041-augustus-gene-0.2")

HSP 1 Score: 248.825 bits (634), Expect = 1.768e-85
Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = 0
Query:    1 MKSFTALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYAAGYAAHHAAGYVAPHAAPYAAGYGYPATSQFHS 134
            MKSFTALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYAAGYAAHHAAGYVAPHAAPYAAGYGYPATSQFHS
Sbjct:    1 MKSFTALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYAAGYAAHHAAGYVAPHAAPYAAGYGYPATSQFHS 134          
BLAST of EMLSAG00000000013 vs. L. salmonis peptides
Match: EMLSAP00000011034 (pep:novel supercontig:LSalAtl2s:LSalAtl2s743:38931:72657:1 gene:EMLSAG00000011034 transcript:EMLSAT00000011034 description:"maker-LSalAtl2s743-augustus-gene-0.7")

HSP 1 Score: 170.629 bits (431), Expect = 4.198e-50
Identity = 114/135 (84.44%), Postives = 119/135 (88.15%), Query Frame = 0
Query:    4 FTALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYAAGYAAHH----AAGYVAPHAAPYAAGYGYPATSQFHS 134
            +TALAVLLVIGSSQASYL PY+GGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGL+YAY TPYAAPY+GGY AHHA PYV GYA    APYAAGY AHH    AAGYVA H APYAAGYGYPA+SQFHS
Sbjct:  275 YTALAVLLVIGSSQASYLSPYVGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLEYAYATPYAAPYIGGYAAHHATPYVGGYA----APYAAGYTAHHAAPYAAGYVAHHXAPYAAGYGYPASSQFHS 405          

HSP 2 Score: 168.318 bits (425), Expect = 2.303e-49
Identity = 113/140 (80.71%), Postives = 118/140 (84.29%), Query Frame = 0
Query:    7 LAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYA--------AHHVAPYAAGYAAHH----AAGYVAPHAAPYAAGYGYPATSQFHS 134
             +VLLVIGSS ASYL PY+GGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPK +DYAY TPYA PY+GGY AHHAAPYVAGYA        AHH APYAAGY AHH    AAGYVAPHAAPYAA YGYPA+SQFHS
Sbjct:  642 FSVLLVIGSSTASYLSPYVGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKAVDYAYATPYATPYIGGYAAHHAAPYVAGYAAPYVAGYTAHHAAPYAAGYVAHHAAPYAAGYVAPHAAPYAARYGYPASSQFHS 781          

HSP 3 Score: 157.147 bits (396), Expect = 2.917e-45
Identity = 109/131 (83.21%), Postives = 113/131 (86.26%), Query Frame = 0
Query:    1 MKSF---TALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYAAGYAAHH----AAGYVAPHAAPYAAGY 124
             K+F   TALAVLLVIGSSQASYL PY+GGHGYGYPGYAPYAVPAVKIPAPEKTELKVETI+APKGLDYAY TPYAAPY+GGY AHHA PYV GYA    APYAAGY AHH    AAGYVAPHAAPYAAGY
Sbjct:  504 QKTFDEATALAVLLVIGSSQASYLSPYVGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIDAPKGLDYAYATPYAAPYIGGYAAHHAXPYVGGYA----APYAAGYTAHHAAPYAAGYVAPHAAPYAAGY 630          

HSP 4 Score: 110.923 bits (276), Expect = 7.661e-29
Identity = 73/89 (82.02%), Postives = 78/89 (87.64%), Query Frame = 0
Query:    1 MKSFTALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYV 89
             +   ALAVLLVIGSS ASYL PY+GGHGYGYPGYAPYAVPAVKIP PEKT+LKVETIE PK +DYAY TPYAAPY+GGY AHHAAPYV
Sbjct:  164 TEPLAALAVLLVIGSSTASYLSPYVGGHGYGYPGYAPYAVPAVKIPIPEKTDLKVETIEVPKAVDYAYATPYAAPYIGGYAAHHAAPYV 252          

HSP 5 Score: 63.929 bits (154), Expect = 1.349e-12
Identity = 50/134 (37.31%), Postives = 62/134 (46.27%), Query Frame = 0
Query:    1 MKSFTALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYAAGYAAHHAAGYVAPHAAPYAAGYGYPATSQFHS 134
            MKSF  LAVL    S+    + PY G HGY     APY VP ++  AP++ ELKVETIE PK +                      P +A    H+  P+ A +A H            YAAG G PA SQFH+
Sbjct:    1 MKSFITLAVLATFASANGGLISPYFGHHGY-----APY-VPIIRTLAPKEAELKVETIEPPKEVQ---------------------PIIAPLVPHYPVPHVAPHALH------------YAAGXGXPAXSQFHA 95          
BLAST of EMLSAG00000000013 vs. L. salmonis peptides
Match: EMLSAP00000011036 (pep:novel supercontig:LSalAtl2s:LSalAtl2s743:94413:95794:1 gene:EMLSAG00000011036 transcript:EMLSAT00000011036 description:"maker-LSalAtl2s743-augustus-gene-1.11")

HSP 1 Score: 70.0922 bits (170), Expect = 1.837e-15
Identity = 68/208 (32.69%), Postives = 87/208 (41.83%), Query Frame = 0
Query:    1 MKSFTALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYA--VPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGY-----------------AAHHVAPYAAGY-----------------------AAHHAAGYVAPH---------------------------AAP-----YAAGYGYPATSQFHS 134
            M + TA A LLVIG +Q  ++ PY   + YG+P YAPYA    AV +P+P  TE KV  IEAPK +   Y +PY A +   + A +AAP    Y                  +  V+PY A +                       A  H + Y APH                           AAP     YAAG+GYPA+SQFHS
Sbjct:    1 MNTLTAFATLLVIGFTQGGFVSPY---YRYGFPVYAPYANYAHAVNVPSPHITEHKVHNIEAPKNVANEYVSPYMAYFPSPHVASYAAPLAKSYVPVVKNEEHKVXEESKDVSTFVSPYNAYFLXPSYAPSVKTLKKVVKKVTPFKAVTHVSSYAAPHVPAIAPTVKNTPVNFAPHHALNYVSPYAAPVAGQFYAAGFGYPASSQFHS 205          
BLAST of EMLSAG00000000013 vs. L. salmonis peptides
Match: EMLSAP00000011035 (pep:novel supercontig:LSalAtl2s:LSalAtl2s743:76924:89115:-1 gene:EMLSAG00000011035 transcript:EMLSAT00000011035 description:"maker-LSalAtl2s743-snap-gene-1.15")

HSP 1 Score: 61.2326 bits (147), Expect = 6.288e-12
Identity = 47/50 (94.00%), Postives = 49/50 (98.00%), Query Frame = 0
Query:    5 TALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELK 54
            TALAVLL+IGSSQASYL PY+GGHGYGYPGYAPYAVPAVKIPAPEKTELK
Sbjct:  398 TALAVLLLIGSSQASYLSPYVGGHGYGYPGYAPYAVPAVKIPAPEKTELK 447          
BLAST of EMLSAG00000000013 vs. nr
Match: gi|155966338|gb|ABU41121.1| (hypothetical protein, partial [Lepeophtheirus salmonis])

HSP 1 Score: 252.677 bits (644), Expect = 2.308e-83
Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = 0
Query:    1 MKSFTALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYAAGYAAHHAAGYVAPHAAPYAAGYGYPATSQFHS 134
            MKSFTALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYAAGYAAHHAAGYVAPHAAPYAAGYGYPATSQFHS
Sbjct:    1 MKSFTALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYAAGYAAHHAAGYVAPHAAPYAAGYGYPATSQFHS 134          
BLAST of EMLSAG00000000013 vs. nr
Match: gi|155966218|gb|ABU41063.1| (putative cuticle protein [Lepeophtheirus salmonis])

HSP 1 Score: 241.506 bits (615), Expect = 1.012e-78
Identity = 130/138 (94.20%), Postives = 132/138 (95.65%), Query Frame = 0
Query:    1 MKSFTALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYAAGYAAHH----AAGYVAPHAAPYAAGYGYPATSQFHS 134
            MKSFTALAVLLVIGSSQASYL PY+GGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPY AGYAAHH    AAGYVAPHAAPYAAGYGYPA+SQFHS
Sbjct:    1 MKSFTALAVLLVIGSSQASYLSPYVGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYTAGYAAHHAAPYAAGYVAPHAAPYAAGYGYPASSQFHS 138          
BLAST of EMLSAG00000000013 vs. nr
Match: gi|155966346|gb|ABU41125.1| (putative cuticle protein [Lepeophtheirus salmonis])

HSP 1 Score: 241.121 bits (614), Expect = 1.451e-78
Identity = 130/138 (94.20%), Postives = 133/138 (96.38%), Query Frame = 0
Query:    1 MKSFTALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYAAGYAAHH----AAGYVAPHAAPYAAGYGYPATSQFHS 134
            MKSFTALAVLL+IGSSQASYL PY+GGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYAAGYAAHH    AAGYVAPHAAPYAAGYGYPA+SQFHS
Sbjct:    1 MKSFTALAVLLLIGSSQASYLSPYVGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYAAGYAAHHPAPYAAGYVAPHAAPYAAGYGYPASSQFHS 138          
BLAST of EMLSAG00000000013 vs. nr
Match: gi|225712386|gb|ACO12039.1| (Cuticle protein 6 [Lepeophtheirus salmonis])

HSP 1 Score: 185.267 bits (469), Expect = 2.252e-56
Identity = 121/146 (82.88%), Postives = 125/146 (85.62%), Query Frame = 0
Query:    1 MKSFTALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYA--------AHHVAPYAAGYAAHH----AAGYVAPHAAPYAAGYGYPATSQFHS 134
            MKSFTALAVLLVIGSS ASYL PY+GGHGYGYPGYAPYAVPAVKIPAPEKTELKVE IEAPK +DYAY TPYA PY+GGY AHHAAPYVAGYA        AHH APYAAGY AHH    AAGYVAPHAAPYAAGYGYPA+SQFHS
Sbjct:    1 MKSFTALAVLLVIGSSTASYLSPYVGGHGYGYPGYAPYAVPAVKIPAPEKTELKVEAIEAPKAVDYAYATPYATPYIGGYAAHHAAPYVAGYAAPYVAGYTAHHAAPYAAGYVAHHAAPYAAGYVAPHAAPYAAGYGYPASSQFHS 146          
BLAST of EMLSAG00000000013 vs. nr
Match: gi|290561509|gb|ADD38155.1| (Cuticle protein 6 [Lepeophtheirus salmonis])

HSP 1 Score: 184.496 bits (467), Expect = 3.031e-56
Identity = 124/138 (89.86%), Postives = 129/138 (93.48%), Query Frame = 0
Query:    1 MKSFTALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAP----YAAGYAAHHAAGYVAPHAAPYAAGYGYPATSQFHS 134
            MKSFTALAVLLVIGSSQASYL PY+GGHGYGYPGYAPYAVPAV IPAPEKTELKVETIEAP+GLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAP    YAA +AA +AAGYVAPHAAPYAAGY YPA+SQFHS
Sbjct:    1 MKSFTALAVLLVIGSSQASYLSPYVGGHGYGYPGYAPYAVPAVNIPAPEKTELKVETIEAPEGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYAAGYAAHHAAPYAAGYVAPHAAPYAAGYSYPASSQFHS 138          
BLAST of EMLSAG00000000013 vs. nr
Match: gi|225712016|gb|ACO11854.1| (Cuticle protein 6 [Lepeophtheirus salmonis])

HSP 1 Score: 139.428 bits (350), Expect = 1.104e-38
Identity = 115/134 (85.82%), Postives = 120/134 (89.55%), Query Frame = 0
Query:    1 MKSFTALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYAAGYAAHHAAGYVAPHAAPYAAGYGYPATSQFHS 134
            MKSFTALAVLLVIGSSQASYL PY+GGHGYGYPGYAPYAVPAV+IPAPEKTELKVETIEAPKGLDYAY TPYAAPY GGY AHHA PYV GYAA + A YAA  AA +AAGY A HAAPYAAGYGYPA+SQFHS
Sbjct:    1 MKSFTALAVLLVIGSSQASYLSPYVGGHGYGYPGYAPYAVPAVEIPAPEKTELKVETIEAPKGLDYAYATPYAAPYNGGYAAHHATPYVGGYAAPYAAGYAAYNAAPYAAGYAAHHAAPYAAGYGYPASSQFHS 134          
BLAST of EMLSAG00000000013 vs. nr
Match: gi|290561232|gb|ADD38018.1| (Cuticle protein 6 [Lepeophtheirus salmonis])

HSP 1 Score: 74.3294 bits (181), Expect = 8.894e-14
Identity = 54/134 (40.30%), Postives = 64/134 (47.76%), Query Frame = 0
Query:    1 MKSFTALAVLLVIGSSQASYLRPYIGGHGYGYPGYAPYAVPAVKIPAPEKTELKVETIEAPKGLDYAYTTPYAAPYVGGYTAHHAAPYVAGYAAHHVAPYAAGYAAHHAAGYVAPHAAPYAAGYGYPATSQFHS 134
            MKSF  LAVL    S+    + PY G H     GYAPY VP ++  AP++ ELKVETIE PK                                  V P  A    H+   +VAPHA  YAAGYGYPA+SQFH+
Sbjct:    1 MKSFITLAVLATFASANGGIISPYFGHH-----GYAPY-VPIIRTLAPKEAELKVETIEPPK---------------------------------EVQPIIAPLVPHYPVPHVAPHALHYAAGYGYPASSQFHA 95          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000013 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000013 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000013 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 4
Match NameE-valueIdentityDescription
EMLSAP000000000131.768e-85100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s10041:1:4... [more]
EMLSAP000000110344.198e-5084.44pep:novel supercontig:LSalAtl2s:LSalAtl2s743:38931... [more]
EMLSAP000000110361.837e-1532.69pep:novel supercontig:LSalAtl2s:LSalAtl2s743:94413... [more]
EMLSAP000000110356.288e-1294.00pep:novel supercontig:LSalAtl2s:LSalAtl2s743:76924... [more]
back to top
BLAST of EMLSAG00000000013 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000013 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000013 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 7
Match NameE-valueIdentityDescription
gi|155966338|gb|ABU41121.1|2.308e-83100.00hypothetical protein, partial [Lepeophtheirus salm... [more]
gi|155966218|gb|ABU41063.1|1.012e-7894.20putative cuticle protein [Lepeophtheirus salmonis][more]
gi|155966346|gb|ABU41125.1|1.451e-7894.20putative cuticle protein [Lepeophtheirus salmonis][more]
gi|225712386|gb|ACO12039.1|2.252e-5682.88Cuticle protein 6 [Lepeophtheirus salmonis][more]
gi|290561509|gb|ADD38155.1|3.031e-5689.86Cuticle protein 6 [Lepeophtheirus salmonis][more]
gi|225712016|gb|ACO11854.1|1.104e-3885.82Cuticle protein 6 [Lepeophtheirus salmonis][more]
gi|290561232|gb|ADD38018.1|8.894e-1440.30Cuticle protein 6 [Lepeophtheirus salmonis][more]
back to top
BLAST of EMLSAG00000000013 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s10041supercontigLSalAtl2s10041:1..462 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
EvidenceManual
Noteputative cuticle protein [Lepeophtheirus salmonis]
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s10041-augustus-gene-0.2
Biotypeprotein_coding
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000013 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000013EMLSAT00000000013-695860Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s10041:1..462-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000013-682779 ID=EMLSAG00000000013-682779|Name=EMLSAG00000000013|organism=Lepeophtheirus salmonis|type=gene|length=462bp|location=Sequence derived from alignment at LSalAtl2s10041:1..462- (Lepeophtheirus salmonis)
ATGAAATCTTTTGTAAGCAATAGAATATAAATGTTTTTAACAAACGATTA TATATAATTTTTTATTTTCTAGACGGCTTTAGCAGTCCTCTTGGTCATTG GATCATCCCAAGCCTCATACCTTAGACCCTACATTGGTGGTCATGGATAT GGTTATCCCGGATATGCTCCATATGCTGTCCCTGCTGTCAAGATCCCCGC CCCAGAAAAGACCGAACTTAAAGTAGAAACAATCGAAGCACCAAAAGGTT TAGACTACGCTTACACTACTCCTTATGCYGCACCTTATGTCGGTGGATAT ACTGCCCATCATGCTGCTCCCTACGTTGCAGGATACGCTGCTCACCATGT TGCTCCCTATGCCGCTGGATACGCTGCCCACCATGCTGCAGGATACGTTG CCCCCCATGCTGCTCCTTATGCTGCCGGATACGGTTACCCTGCCACCTCT CAATTCCACTCT
back to top
Add to Basket