EMLSAG00000000106, EMLSAG00000000106-682872 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000106
Unique NameEMLSAG00000000106-682872
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: female reproduction, egg string deformation
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort ascending
Z F204 106 female
  1. PreAdult2
  2. Adult
Slightly wavy ES-check hatching
female reproduction, egg string deformation
27.08.2015 - 13:44
01.10.2015 (All day)
Homology
BLAST of EMLSAG00000000106 vs. C. finmarchicus
Match: gi|592914988|gb|GAXK01043387.1| (TSA: Calanus finmarchicus comp50798_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 40.4318 bits (93), Expect = 4.377e-2
Identity = 42/171 (24.56%), Postives = 71/171 (41.52%), Query Frame = 0
Query: 1004 SQVPSLMLLCCGLLSPKKLIKNCKVPPLNPESKV----GALERDRFWERIRLSFYHGFGDFE------SFEKCLEKQKRILGFLITRIRSSSPTKIVWNH-----WLSKIKMFILAPLHDQFM--EEAGSFSDHEERSFKVIEYPFMSESNCKSIIQHLCLQCWDSVCVGC 1157
            S VPSL LLC G++      ++C  PPL  +  +      +  D   E +   +     +         +EK   +  ++  +L  +I S S  K+   H     W+ K  +++  PLHD F+   +AG         ++V+E+P   +      +  LCL C    C GC
Sbjct: 2135 SHVPSLKLLCRGVIP-----RSCSHPPLRVKEGLEYYHALVWPDNNKEEVVFKYMSRLANITMVTSVGEYEKLCREPLKVALYLEKKI-SKSREKVGHRHSQTKRWVEKYTLYLTFPLHDIFLVVSQAG---------YRVLEFPLKEDK-----VGLLCLVCPTMSCKGC 2587          
BLAST of EMLSAG00000000106 vs. C. finmarchicus
Match: gi|592914989|gb|GAXK01043386.1| (TSA: Calanus finmarchicus comp50798_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 40.4318 bits (93), Expect = 4.380e-2
Identity = 42/171 (24.56%), Postives = 71/171 (41.52%), Query Frame = 0
Query: 1004 SQVPSLMLLCCGLLSPKKLIKNCKVPPLNPESKV----GALERDRFWERIRLSFYHGFGDFE------SFEKCLEKQKRILGFLITRIRSSSPTKIVWNH-----WLSKIKMFILAPLHDQFM--EEAGSFSDHEERSFKVIEYPFMSESNCKSIIQHLCLQCWDSVCVGC 1157
            S VPSL LLC G++      ++C  PPL  +  +      +  D   E +   +     +         +EK   +  ++  +L  +I S S  K+   H     W+ K  +++  PLHD F+   +AG         ++V+E+P   +      +  LCL C    C GC
Sbjct: 2147 SHVPSLKLLCRGVIP-----RSCSHPPLRVKEGLEYYHALVWPDNNKEEVVFKYMSRLANITMVTSVGEYEKLCREPLKVALYLEKKI-SKSREKVGHRHSQTKRWVEKYTLYLTFPLHDIFLVVSQAG---------YRVLEFPLKEDK-----VGLLCLVCPTMSCKGC 2599          
BLAST of EMLSAG00000000106 vs. C. finmarchicus
Match: gi|592771592|gb|GAXK01182976.1| (TSA: Calanus finmarchicus comp289174_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 36.965 bits (84), Expect = 3.199e-1
Identity = 19/60 (31.67%), Postives = 29/60 (48.33%), Query Frame = 0
Query:  744 KSIGGSKHGEFFSHCTDCKFYFRREHIYLKHLETCCPGMNSLICSTCQRHFKSEVGMLKH 803
            K++   KHG+F   CT C   F++ +   KH +   PGM    C  C   F  E+ + +H
Sbjct:  132 KNMAHKKHGQF--KCTFCDQIFKKTNRLEKHAQMMHPGMKKFGCELCGEKFSYEISLTEH 305          
BLAST of EMLSAG00000000106 vs. C. finmarchicus
Match: gi|592783920|gb|GAXK01170648.1| (TSA: Calanus finmarchicus comp5473380_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 33.8834 bits (76), Expect = 9.189e-1
Identity = 14/32 (43.75%), Postives = 17/32 (53.12%), Query Frame = 0
Query:  948 DYQNVADLWECDGCDKVFSYETEYIKHIKTCE 979
            DY    + WEC GC   F  + E +KHI  CE
Sbjct:    9 DYSGKGEFWECTGCSTRFP-KNELLKHIPICE 101          
BLAST of EMLSAG00000000106 vs. C. finmarchicus
Match: gi|592770077|gb|GAXK01184491.1| (TSA: Calanus finmarchicus comp134554_c28_seq23 transcribed RNA sequence)

HSP 1 Score: 33.4982 bits (75), Expect = 1.037e+0
Identity = 14/30 (46.67%), Postives = 18/30 (60.00%), Query Frame = 0
Query:  142 EGDESQHKKITIGQIWVTLDNSFCLINSSV 171
            E  E Q  K+    +W+TL N+FC I SSV
Sbjct:  209 ELSEEQTMKLAFSMLWLTLINTFCFIYSSV 298          
BLAST of EMLSAG00000000106 vs. C. finmarchicus
Match: gi|592770081|gb|GAXK01184487.1| (TSA: Calanus finmarchicus comp134554_c28_seq19 transcribed RNA sequence)

HSP 1 Score: 33.4982 bits (75), Expect = 1.290e+0
Identity = 14/30 (46.67%), Postives = 18/30 (60.00%), Query Frame = 0
Query:  142 EGDESQHKKITIGQIWVTLDNSFCLINSSV 171
            E  E Q  K+    +W+TL N+FC I SSV
Sbjct:  252 ELSEEQTMKLAFSMLWLTLINTFCFIYSSV 341          
BLAST of EMLSAG00000000106 vs. C. finmarchicus
Match: gi|592807530|gb|GAXK01147038.1| (TSA: Calanus finmarchicus comp4537226_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 33.8834 bits (76), Expect = 2.730e+0
Identity = 19/59 (32.20%), Postives = 32/59 (54.24%), Query Frame = 0
Query:  925 CAGCHLDNFSTLSELDKHQVECQDYQNVADLWECDGCDKVFSYETEYIKHIKTCEVIEI 983
            CA C L NF T ++L+ H V+  D  ++    EC+ C K F+   E   H +T  ++++
Sbjct:   32 CAECSL-NFQTRADLNSHVVQNHDTADI----ECEQCGKFFASRKELKDHRRTHNIVDL 193          
BLAST of EMLSAG00000000106 vs. C. finmarchicus
Match: gi|592903508|gb|GAXK01054867.1| (TSA: Calanus finmarchicus comp1766100_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 34.2686 bits (77), Expect = 3.231e+0
Identity = 17/53 (32.08%), Postives = 31/53 (58.49%), Query Frame = 0
Query:  924 KCAGCHLDNFSTLSELDKHQVECQDYQNVADLWECDGCDKVFSYETEYIKHIK 976
            +C GCH  +F+ +  L +HQV  +    +   ++C  CD  F+++T Y +H+K
Sbjct: 1684 QCDGCH-KSFARMDNLKRHQVNHKISDYMKHDFKCSLCDFTFAWKTNYQRHMK 1839          
BLAST of EMLSAG00000000106 vs. C. finmarchicus
Match: gi|592887048|gb|GAXK01071327.1| (TSA: Calanus finmarchicus comp1565656_c0_seq4 transcribed RNA sequence)

HSP 1 Score: 33.4982 bits (75), Expect = 4.000e+0
Identity = 16/51 (31.37%), Postives = 25/51 (49.02%), Query Frame = 0
Query:  758 CTDCKFYFRREHIYLKHLETCCPGMNSLICSTCQRHFKSEVGMLKHNCEGI 808
            C DC   F R+    +H +T       + CSTC + FK+E  + +H C  +
Sbjct:  247 CKDCPKAFFRKSDLTQHTKTHNKAKLQMACSTCAQMFKTEKKLKEHTCSAL 399          
BLAST of EMLSAG00000000106 vs. C. finmarchicus
Match: gi|592812930|gb|GAXK01141638.1| (TSA: Calanus finmarchicus comp190539_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 33.113 bits (74), Expect = 4.497e+0
Identity = 19/47 (40.43%), Postives = 24/47 (51.06%), Query Frame = 0
Query:  758 CTDCKFYFRREHIYLKHLETCCPGMNSLICSTCQRHFKSEVGMLKHN 804
            C DC   F+R+H    H+ET   G  S  C TC R FK+   +  HN
Sbjct:  143 CKDCGKVFKRKHKLDLHIETHLEGF-SHPCQTCSREFKTRKSLSCHN 280          
BLAST of EMLSAG00000000106 vs. L. salmonis peptides
Match: EMLSAP00000000106 (pep:novel supercontig:LSalAtl2s:LSalAtl2s101:146626:151738:-1 gene:EMLSAG00000000106 transcript:EMLSAT00000000106 description:"maker-LSalAtl2s101-snap-gene-1.38")

HSP 1 Score: 2665.18 bits (6907), Expect = 0.000e+0
Identity = 1286/1286 (100.00%), Postives = 1286/1286 (100.00%), Query Frame = 0
Query:    1 MNTTPSCSCDIVSSHINKQGTSAIIPTLSCSNERFKISDLSRRNTREYSSSPQCDQGLILLKRLRIADKELKAHEWMSVCGNHKKYLLQDFPLKNHQCGICFNSDQIRLRRVSTKSQDLYKGEVVVGEFVCSECDDLILDGEGDESQHKKITIGQIWVTLDNSFCLINSSVPSLRLLCRGLTNKEPLLNPPELLIKDAIEIRRSLDNANQANKEFITDRMIALGIIPHFSEFRSTADACIRMLHNLLSDGDRKLNKAFWFLKLKLSAFAFLPDENKSGSSKMDQYAFLRKDRICKVLCLACDENECTGCQRPAYPSPISLGDSKGRHLHYLQTTCRCCKKRTSTFHSHPRGNTLRCSSNNCKLNYTDGFKRLCDVDIVFEDDYDVHPQAVCGGCRTYLTSATSPFMSGFPNFYPHNELFCDCDLNFFYANASVQESGSCLSVVMNFSRIPSLTFLAGSILASPAKNNWINTNYLTVKMALEIYQTFMYVHNKKSPDTYEYFKTLALAGVLRYPIKVAFHNKANAFQTVLTILCDSMSHSSRENRTKFRRKLETILNADFYGTEPSLRLTKKTVKFRRNFCVIVMCVICSNLLCEGICGRIPSDPSGSTHKRAKKSSNNSNHKLFRSYDKKLGLRGDLTYKEFQNYRLSGTFVANDEINHYCVNCLNLKCKGCQNSSSDSQKENLKLKLKLEELPTKKELSNYNTTGRFVFEDDLPLINKSKKQSKSNGNFSSSSPKTNDNYSTKSIGGSKHGEFFSHCTDCKFYFRREHIYLKHLETCCPGMNSLICSTCQRHFKSEVGMLKHNCEGIYNLENHQFKNIALDLGSIEYDHFIYILLNHSLPHHWRASSGPKEETLVMEKESVRFRFVISRYKKISNKARLKGEGVKAFKEEIWPIVAKLAIPGEEEEDGDDDDLEEEEDEYELKCAGCHLDNFSTLSELDKHQVECQDYQNVADLWECDGCDKVFSYETEYIKHIKTCEVIEIPEDIRSFYPDDKGRIFCPGCSQVPSLMLLCCGLLSPKKLIKNCKVPPLNPESKVGALERDRFWERIRLSFYHGFGDFESFEKCLEKQKRILGFLITRIRSSSPTKIVWNHWLSKIKMFILAPLHDQFMEEAGSFSDHEERSFKVIEYPFMSESNCKSIIQHLCLQCWDSVCVGCSGEIHQEDYYEKELCTISQTLFFKEFGVICTSEKLFNECTQLGMSLDLKRRASIHELIQYKKGHKIINGTQFEKGGIKKLQATTTTLPLQNNHFNLEKIKKENHRISVLSKAAVSSMPWLIDEECILPD 1286
            MNTTPSCSCDIVSSHINKQGTSAIIPTLSCSNERFKISDLSRRNTREYSSSPQCDQGLILLKRLRIADKELKAHEWMSVCGNHKKYLLQDFPLKNHQCGICFNSDQIRLRRVSTKSQDLYKGEVVVGEFVCSECDDLILDGEGDESQHKKITIGQIWVTLDNSFCLINSSVPSLRLLCRGLTNKEPLLNPPELLIKDAIEIRRSLDNANQANKEFITDRMIALGIIPHFSEFRSTADACIRMLHNLLSDGDRKLNKAFWFLKLKLSAFAFLPDENKSGSSKMDQYAFLRKDRICKVLCLACDENECTGCQRPAYPSPISLGDSKGRHLHYLQTTCRCCKKRTSTFHSHPRGNTLRCSSNNCKLNYTDGFKRLCDVDIVFEDDYDVHPQAVCGGCRTYLTSATSPFMSGFPNFYPHNELFCDCDLNFFYANASVQESGSCLSVVMNFSRIPSLTFLAGSILASPAKNNWINTNYLTVKMALEIYQTFMYVHNKKSPDTYEYFKTLALAGVLRYPIKVAFHNKANAFQTVLTILCDSMSHSSRENRTKFRRKLETILNADFYGTEPSLRLTKKTVKFRRNFCVIVMCVICSNLLCEGICGRIPSDPSGSTHKRAKKSSNNSNHKLFRSYDKKLGLRGDLTYKEFQNYRLSGTFVANDEINHYCVNCLNLKCKGCQNSSSDSQKENLKLKLKLEELPTKKELSNYNTTGRFVFEDDLPLINKSKKQSKSNGNFSSSSPKTNDNYSTKSIGGSKHGEFFSHCTDCKFYFRREHIYLKHLETCCPGMNSLICSTCQRHFKSEVGMLKHNCEGIYNLENHQFKNIALDLGSIEYDHFIYILLNHSLPHHWRASSGPKEETLVMEKESVRFRFVISRYKKISNKARLKGEGVKAFKEEIWPIVAKLAIPGEEEEDGDDDDLEEEEDEYELKCAGCHLDNFSTLSELDKHQVECQDYQNVADLWECDGCDKVFSYETEYIKHIKTCEVIEIPEDIRSFYPDDKGRIFCPGCSQVPSLMLLCCGLLSPKKLIKNCKVPPLNPESKVGALERDRFWERIRLSFYHGFGDFESFEKCLEKQKRILGFLITRIRSSSPTKIVWNHWLSKIKMFILAPLHDQFMEEAGSFSDHEERSFKVIEYPFMSESNCKSIIQHLCLQCWDSVCVGCSGEIHQEDYYEKELCTISQTLFFKEFGVICTSEKLFNECTQLGMSLDLKRRASIHELIQYKKGHKIINGTQFEKGGIKKLQATTTTLPLQNNHFNLEKIKKENHRISVLSKAAVSSMPWLIDEECILPD
Sbjct:    1 MNTTPSCSCDIVSSHINKQGTSAIIPTLSCSNERFKISDLSRRNTREYSSSPQCDQGLILLKRLRIADKELKAHEWMSVCGNHKKYLLQDFPLKNHQCGICFNSDQIRLRRVSTKSQDLYKGEVVVGEFVCSECDDLILDGEGDESQHKKITIGQIWVTLDNSFCLINSSVPSLRLLCRGLTNKEPLLNPPELLIKDAIEIRRSLDNANQANKEFITDRMIALGIIPHFSEFRSTADACIRMLHNLLSDGDRKLNKAFWFLKLKLSAFAFLPDENKSGSSKMDQYAFLRKDRICKVLCLACDENECTGCQRPAYPSPISLGDSKGRHLHYLQTTCRCCKKRTSTFHSHPRGNTLRCSSNNCKLNYTDGFKRLCDVDIVFEDDYDVHPQAVCGGCRTYLTSATSPFMSGFPNFYPHNELFCDCDLNFFYANASVQESGSCLSVVMNFSRIPSLTFLAGSILASPAKNNWINTNYLTVKMALEIYQTFMYVHNKKSPDTYEYFKTLALAGVLRYPIKVAFHNKANAFQTVLTILCDSMSHSSRENRTKFRRKLETILNADFYGTEPSLRLTKKTVKFRRNFCVIVMCVICSNLLCEGICGRIPSDPSGSTHKRAKKSSNNSNHKLFRSYDKKLGLRGDLTYKEFQNYRLSGTFVANDEINHYCVNCLNLKCKGCQNSSSDSQKENLKLKLKLEELPTKKELSNYNTTGRFVFEDDLPLINKSKKQSKSNGNFSSSSPKTNDNYSTKSIGGSKHGEFFSHCTDCKFYFRREHIYLKHLETCCPGMNSLICSTCQRHFKSEVGMLKHNCEGIYNLENHQFKNIALDLGSIEYDHFIYILLNHSLPHHWRASSGPKEETLVMEKESVRFRFVISRYKKISNKARLKGEGVKAFKEEIWPIVAKLAIPGEEEEDGDDDDLEEEEDEYELKCAGCHLDNFSTLSELDKHQVECQDYQNVADLWECDGCDKVFSYETEYIKHIKTCEVIEIPEDIRSFYPDDKGRIFCPGCSQVPSLMLLCCGLLSPKKLIKNCKVPPLNPESKVGALERDRFWERIRLSFYHGFGDFESFEKCLEKQKRILGFLITRIRSSSPTKIVWNHWLSKIKMFILAPLHDQFMEEAGSFSDHEERSFKVIEYPFMSESNCKSIIQHLCLQCWDSVCVGCSGEIHQEDYYEKELCTISQTLFFKEFGVICTSEKLFNECTQLGMSLDLKRRASIHELIQYKKGHKIINGTQFEKGGIKKLQATTTTLPLQNNHFNLEKIKKENHRISVLSKAAVSSMPWLIDEECILPD 1286          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000106 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000106 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592914988|gb|GAXK01043387.1|4.377e-224.56TSA: Calanus finmarchicus comp50798_c0_seq2 transc... [more]
gi|592914989|gb|GAXK01043386.1|4.380e-224.56TSA: Calanus finmarchicus comp50798_c0_seq1 transc... [more]
gi|592771592|gb|GAXK01182976.1|3.199e-131.67TSA: Calanus finmarchicus comp289174_c0_seq1 trans... [more]
gi|592783920|gb|GAXK01170648.1|9.189e-143.75TSA: Calanus finmarchicus comp5473380_c0_seq1 tran... [more]
gi|592770077|gb|GAXK01184491.1|1.037e+046.67TSA: Calanus finmarchicus comp134554_c28_seq23 tra... [more]
gi|592770081|gb|GAXK01184487.1|1.290e+046.67TSA: Calanus finmarchicus comp134554_c28_seq19 tra... [more]
gi|592807530|gb|GAXK01147038.1|2.730e+032.20TSA: Calanus finmarchicus comp4537226_c0_seq1 tran... [more]
gi|592903508|gb|GAXK01054867.1|3.231e+032.08TSA: Calanus finmarchicus comp1766100_c0_seq1 tran... [more]
gi|592887048|gb|GAXK01071327.1|4.000e+031.37TSA: Calanus finmarchicus comp1565656_c0_seq4 tran... [more]
gi|592812930|gb|GAXK01141638.1|4.497e+040.43TSA: Calanus finmarchicus comp190539_c1_seq1 trans... [more]

Pages

back to top
BLAST of EMLSAG00000000106 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 1
Match NameE-valueIdentityDescription
EMLSAP000000001060.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s101:14662... [more]
back to top
BLAST of EMLSAG00000000106 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000106 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000106 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000106 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s101supercontigLSalAtl2s101:146626..151738 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s101-snap-gene-1.38
Biotypeprotein_coding
EvidenceIEA
NoteHypothetical protein
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000106 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000106EMLSAT00000000106-695953Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s101:146626..151738-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000106-682872 ID=EMLSAG00000000106-682872|Name=EMLSAG00000000106|organism=Lepeophtheirus salmonis|type=gene|length=5113bp|location=Sequence derived from alignment at LSalAtl2s101:146626..151738- (Lepeophtheirus salmonis)
ATGAATACGACTCCCAGCTGCAGCTGTGATATAGTTTCTTCTCATATTAA TAAACAAGGAACTAGTGCTATCATCCCTACTTTATCCTGTAGCAATGAAC GCTTTAAAATATCGGATCTCTCTCGCAGAAATACTAGAGAGTACTCTTCT TCTCCTCAATGTGATCAAGGACTCATTCTTTTAAAACGTCTTCGAATAGC AGATAAAGAGCTCAAAGCCCATGAATGGATGAGTGTGTGTGGGAATCATA AAAAATATTTGCTTCAGGATTTTCCTCTCAAAAACCACCAATGCGGTATT TGTTTTAACAGTGATCAAATACGGCTTAGAAGAGTTTCTACAAAGTCGCA GGATTTGTACAAAGGAGAAGTCGTGGTTGGGGAATTCGTATGTTCGGAGT GTGATGATTTGATATTAGATGGAGAAGGGGATGAGAGTCAGCATAAAAAA ATAACCATTGGGCAGATTTGGGTTACATTGGATAATTCATTTTGTCTTAT TAATAGCTCTGTACCTTCGCTCAGGTCAGTACTTATATACATTTAATTAT AGGCTATAATATTGGGAGGAGGAAGAAACTCCTGTTAAAAAATATGTGAA AGATTTTTCCACTTTTAATTATATATATGTGTGGGCTATTTTCTCTCTCC AGATCTGAAAGGGACACTTAATTATCAATTATCGTCATCAAAATAACTAA TAAAAATATCAAATAATATTATGTAGTTAGTTTTTCTTTTCATCTGATTC CTTCGCTCGTTCGGCCTCTACTTCTTCTCAAATTACACTTTTTGGAAATT TCTTTAATTCATAACAAGAAAGTTAAATTGAATGTAAAATGCACATATTC TATACGTATATAGAATATCAAATGTGATGTAAATCCAGTTTTATTTGTCT CTACATTTTTCTGCTCCCTTTTATACTAACAATACCACAGATWTTTATTC ATTAAACGATGATTTTTTTAGTMCTGCCGTAACCACAAACCAACTACTAC TAGAGTACCTTAATATTATAGCCAGATACTCTACACATAATTTTACTATG TATGTATTACTATTTCAGATTATTATGTAGAGGCTTAACCAACAAAGAGC CCCTTCTCAATCCACCTGAATTGCTCATAAAAGATGCTATTGAAATCCGA CGTTCCTTAGATAATGCAAATCAAGCCAATAAGGAATTTATAACTGATAG AATGATAGCCCTCGGTATTATTCCCCACTTTTCTGAATTTCGCTCAACTG CAGACGCTTGCATTCGAATGCTACACAACCTACTGTCCGATGGGGATCGC AAATTAAACAAAGCATTTTGGTTTTTGAAACTTAAACTCAGTGCTTTTGC TTTCCTCCCCGATGAAAACAAAAGTGGATCCTCTAAAATGGATCAGTATG CTTTTCTACGAAAGGATAGGATTTGTAAAGTACTCTGTCTTGCCTGCGAT GAAAATGAGTGCACRGGGTGTCAGAGGCCTGCCTATCCATCACCAATCTC TTTGGGGGACTCCAAGGGAAGACATTTACATTACTTACAAACGACGTGTC GATGTTGTAAAAAACGGACAAGTACTTTTCATAGTCACCCTCGGGGTAAT ACCTTACGTTGCTCCTCTAACAATTGTAAACTCAACTATACTGATGGGTT TAAGCGACTATGTGATGTGGATATAGTCTTTGAAGATGACTATGATGTTC ATCCTCAAGCTGTATGTGGAGGATGTCGAACGTATCTAACCTCTGCCACG TCTCCTTTCATGAGTGGTTTTCCAAACTTTTACCCTCACAATGAATTATT TTGTGATTGCGATTTAAATTTCTTTTACGCGAATGCCAGTGTTCAAGAAT CGGGTTCATGTTTAAGTGTAGTGATGAACTTTTCTAGAATTCCAAGTTTG ACTTTTTTGGCTGGAAGTATTCTTGCTTCCCCTGCAAAAAATAATTGGAT AAACACCAATTATCTTACTGTTAAAATGGCACTAGAGATTTATCAAACTT TTATGTATGTTCACAATAAGAAAAGTCCCGACACCTATGAATATTTCAAG ACACTTGCACTGGCAGGGGTTCTTCGCTACCCCATTAAAGTAGCCTTCCA TAACAAGGCAAATGCATTTCAAACTGTGCTAACTATCTTATGTGATTCCA TGTCACATTCATCCAGGGAAAATCGTACAAAATTTCGTCGTAAACTAGAA ACAATTCTCAATGCGGATTTCTACGGAACAGAGCCATCATTGAGACTTAC GAAAAAAACTGTTAAATTTAGAAGAAATTTCTGTGTTATTGTTATGTGTG TGATATGCTCAAATCTACTATGTGAGGGAATTTGTGGACGGATTCCATCC GATCCCTCTGGCTCAACTCATAAACGTGCCAAAAAAAGTTCCAATAATTC AAATCATAAGTTATTCCGTTCCTATGATAAAAAGTTAGGTCTTCGTGGGG ATTTGACCTATAAGGAATTCCAAAATTATCGACTCTCAGGAACCTTTGTT GCAAATGATGAAATTAATCATTATTGTGTAAACTGTTTAAACTTGAAATG TAAAGGTTGTCAAAATTCTTCAAGTGACTCACAAAAAGAAAATCTCAAAT TGAAGCTTAAACTTGAGGAGCTACCCACGAAGAAAGAGCTATCCAACTAT AATACCACCGGTAGGTTTGTTTTTGAAGATGATCTGCCCCTTATAAATAA ATCAAAAAAGCAATCTAAGAGCAATGGGAACTTTTCATCTTCCTCACCAA AAACAAATGATAATTATTCTACTAAATCCATCGGAGGCTCAAAACACGGT GAATTTTTTAGTCACTGCACGGACTGTAAATTTTATTTCCGCCGCGAACA CATTTATCTTAAGCACTTGGAAACATGCTGCCCAGGAATGAATTCGCTTA TTTGTTCAACATGTCAACGACATTTTAAGTCCGAAGTCGGAATGCTCAAA CATAATTGTGAGGGGATATATAATTTGGAGAACCATCAATTCAAAAATAT CGCATTGGATTTAGGGTCCATAGAATACGATCATTTTATATATATATTGC TAAATCATTCTCTCCCTCATCATTGGAGAGCCTCGTCCGGTCCTAAAGAG GAAACACTCGTGATGGAAAAGGAATCTGTTCGCTTCCGCTTTGTTATATC TAGATATAAAAAAATTAGCAATAAAGCTCGTCTCAAGGGCGAAGGGGTCA AGGCATTTAAGGAAGAAATATGGCCAATTGTAGCTAAACTTGCGATTCCT GGAGAAGAAGAAGAAGACGGAGATGATGATGATTTAGAAGAAGAGGAAGA TGAGTATGAGCTCAAATGTGCTGGTTGTCATTTGGATAACTTTTCCACGT TGTCAGAACTAGATAAACATCAGGTTGAATGCCAGGACTATCAAAATGTG GCAGATCTATGGGAGTGTGATGGCTGTGACAAGGTATTTTCCTATGAAAC AGAGTACATTAAGCACATCAAGACTTGTGAAGTGATAGAGATTCCAGAAG ATATCCGTTCTTTTTATCCAGATGATAAAGGAAGAATTTTTTGTCCAGGA TGTTCTCAAGTATTTATTGATGACGAATTGGAGTACTTTAGACATTTAAA AATGTGTAGATTTGTGGAGTTTGAAAATTACCCCTGCAAAAAATGCAAAT TAAAGTTTTCTACTCAAAAAACACTTTTGGCACACGATTGTTCGAACTCA TATCATATCAATAGCTCTCCCCCTGCAGTAGCAACCATCACTTCCAACTC AAAGAGACATTCAACATCACCAATCCCTCAAAATTTTGGAATTAAAAAAT CCAGGATAGAGGAGCTAAATTTGTTCAATGATAATAATACATCAACAACT CCATATCAGCCAATCTGTAAAATGGGGGATTATAAGTGCCCCATTTGCGG ACTAAAATTTACATTGAACCAACCTTACGGTAATCATGTGAAAAATACAA TGTGTGTTTCCCTCAATTCCTCCGTTGTTCCCTATGAGTATAAACATATC AAGACCCTTAGATTAAAATTCGCATCCATCAGCTTCAATTCAAATTATGA TAATGATGGTTCCTCCATTATCATGAAGATAACGTATAGTCGGGKAAGTA TTGGACGTAAAAAATTTTCTAGAGACATATATCTAAATATCTTGATAAAT ATATACCTAACTATTTTTTATATATAATCAAAAGCAATGTTTTTTATTTA CATTTTTCTTATATAGGTTCCTAGTCTAATGTTGCTTTGCTGTGGACTAC TGTCTCCTAAGAAACTAATTAAGAACTGTAAAGTACCTCCTTTAAGTATC AAAGATGCTCTCGAACTTTATCAAAGCCTCAACAAGTCATTTTTAGATCC AGAAAGTAAGGTAGGAGCACTGGAAAGAGATCGTTTTTGGGAGCGAATAC GTCTTTCATTCTATCATGGTTTTGGAGATTTTGAGTCCTTTGAAAAATGT TTGGAAAAGCAGAAAAGGATTCTAGGGTTTCTAATTACTCGAATAAGATC ATCTTCTCCCACAAAGATTGTTTGGAATCACTGGCTATCAAAAATCAAAA TGTTCATTCTTGCACCTCTTCACGACCAATTTATGGAGGAAGCAGGAAGT TTTTCTGATCATGAGGAACGTTCATTCAAAGTGATTGAGTACCCATTCAT GAGTGAGTCAAATTGTAAGTCAATTATTCAACATTTATGTCTACAATGCT GGGATAGTGTTTGTGTGGGCTGTTCAGGAGAAATTCATCAAGAGGACTAT TATGAAAAAGAGCTCTGTACTATTTCTCAGACACTTTTCTTCAAGGAATT CGGAGTGATTTGTACGAGTGAGAAGTTGTTCAATGAATGCACGCAATTGG GGATGAGCCTAGACTTAAAACGAAGGGCTTCTATTCATGAGCTGATTCAG TATAAAAAGGGACATAAAATAATTAATGGAACGCAATTTGAGAAAGGAGG GATTAAGAAATTGCAAGCTACTACTACTACTCTGCCCCTTCAAAATAACC ATTTCAATTTAGAGAAAATTAAAAAGGAGAATCACCGCATATCTGTATTG TCCAAGGCCGCTGTTTCTTCAATGCCTTGGCTAATTGATGAAGAATGTAT ACTTCCAGATTGA
back to top
Add to Basket