EMLSAG00000000213, EMLSAG00000000213-682979 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000213 vs. GO
Match: - (symbol:rpl27 "ribosomal protein L27" species:7955 "Danio rerio" [GO:0005622 "intracellular" evidence=IEA] [GO:0005840 "ribosome" evidence=IEA] [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] [GO:0030529 "ribonucleoprotein complex" evidence=IEA] InterPro:IPR001141 InterPro:IPR018262 Pfam:PF01777 ProDom:PD009396 PROSITE:PS01107 Pfam:PF00467 ZFIN:ZDB-GENE-030131-4343 GO:GO:0006412 GO:GO:0005840 GO:GO:0003735 Gene3D:2.30.30.30 InterPro:IPR014722 InterPro:IPR008991 SUPFAM:SSF50104 InterPro:IPR005824 SMART:SM00739 eggNOG:COG2163 HOGENOM:HOG000210138 KO:K02901 PANTHER:PTHR10497 OMA:KIYKPGK GeneTree:ENSGT00390000010721 CTD:6155 HOVERGEN:HBG050005 OrthoDB:EOG7J181Z TreeFam:TF314648 EMBL:BC045965 RefSeq:NP_956018.1 RefSeq:XP_005163985.1 UniGene:Dr.75716 ProteinModelPortal:Q7ZV82 STRING:7955.ENSDARP00000018737 PRIDE:Q7ZV82 Ensembl:ENSDART00000020311 Ensembl:ENSDART00000140518 GeneID:325618 KEGG:dre:325618 InParanoid:Q7ZV82 NextBio:20809388 PRO:PR:Q7ZV82 Bgee:Q7ZV82 Uniprot:Q7ZV82) HSP 1 Score: 47.7506 bits (112), Expect = 4.168e-7 Identity = 27/57 (47.37%), Postives = 32/57 (56.14%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV T RSK +F KV NYN+LM T Y+VDI DK + K Sbjct: 42 LVAGIDRYPRKVTATMGKKKIAKRSKIKAFVKVFNYNHLMPTRYSVDIPLDKTVVNK 98
BLAST of EMLSAG00000000213 vs. GO
Match: - (symbol:RPL27 "60S ribosomal protein L27" species:9606 "Homo sapiens" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0005840 "ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] InterPro:IPR001141 InterPro:IPR018262 Pfam:PF01777 ProDom:PD009396 PROSITE:PS01107 GO:GO:0006412 EMBL:AC055866 GO:GO:0005840 GO:GO:0003735 Gene3D:2.30.30.30 InterPro:IPR014722 InterPro:IPR008991 SUPFAM:SSF50104 PANTHER:PTHR10497 HGNC:HGNC:10328 ProteinModelPortal:K7ELC7 Ensembl:ENST00000586277 Uniprot:K7ELC7) HSP 1 Score: 46.2098 bits (108), Expect = 1.455e-6 Identity = 27/57 (47.37%), Postives = 31/57 (54.39%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV RSK SF KV NYN+LM T Y+VDI DK + K Sbjct: 50 LVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNK 106
BLAST of EMLSAG00000000213 vs. GO
Match: - (symbol:Rpl27 "60S ribosomal protein L27" species:10116 "Rattus norvegicus" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0005840 "ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] InterPro:IPR001141 InterPro:IPR018262 Pfam:PF01777 ProDom:PD009396 PROSITE:PS01107 RGD:621192 Pfam:PF00467 GO:GO:0006412 GO:GO:0005840 GO:GO:0003735 Gene3D:2.30.30.30 InterPro:IPR014722 InterPro:IPR008991 SUPFAM:SSF50104 InterPro:IPR005824 SMART:SM00739 eggNOG:COG2163 HOGENOM:HOG000210138 KO:K02901 PANTHER:PTHR10497 OMA:KIYKPGK GeneTree:ENSGT00390000010721 CTD:6155 HOVERGEN:HBG050005 OrthoDB:EOG7J181Z TreeFam:TF314648 EMBL:X07424 EMBL:BC058474 EMBL:BC091566 PIR:S00401 RefSeq:NP_071959.1 UniGene:Rn.1254 ProteinModelPortal:P61354 SMR:P61354 BioGrid:249021 IntAct:P61354 MINT:MINT-4578026 STRING:10116.ENSRNOP00000028060 PaxDb:P61354 PRIDE:P61354 Ensembl:ENSRNOT00000028060 GeneID:64306 KEGG:rno:64306 UCSC:RGD:621192 InParanoid:P61354 NextBio:612950 PRO:PR:P61354 Genevestigator:P61354 Uniprot:P61354) HSP 1 Score: 45.8246 bits (107), Expect = 1.659e-6 Identity = 27/57 (47.37%), Postives = 31/57 (54.39%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV RSK SF KV NYN+LM T Y+VDI DK + K Sbjct: 42 LVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNK 98
BLAST of EMLSAG00000000213 vs. GO
Match: - (symbol:Rpl27 "ribosomal protein L27" species:10116 "Rattus norvegicus" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0005840 "ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] [GO:0022625 "cytosolic large ribosomal subunit" evidence=ISO] [GO:0030529 "ribonucleoprotein complex" evidence=ISO] [GO:0044822 "poly(A) RNA binding" evidence=ISO] [GO:0070062 "extracellular vesicular exosome" evidence=ISO] InterPro:IPR001141 InterPro:IPR018262 Pfam:PF01777 ProDom:PD009396 PROSITE:PS01107 RGD:621192 Pfam:PF00467 GO:GO:0006412 GO:GO:0005840 GO:GO:0003735 Gene3D:2.30.30.30 InterPro:IPR014722 InterPro:IPR008991 SUPFAM:SSF50104 InterPro:IPR005824 SMART:SM00739 eggNOG:COG2163 HOGENOM:HOG000210138 KO:K02901 PANTHER:PTHR10497 OMA:KIYKPGK GeneTree:ENSGT00390000010721 CTD:6155 HOVERGEN:HBG050005 OrthoDB:EOG7J181Z TreeFam:TF314648 EMBL:X07424 EMBL:BC058474 EMBL:BC091566 PIR:S00401 RefSeq:NP_071959.1 UniGene:Rn.1254 ProteinModelPortal:P61354 SMR:P61354 BioGrid:249021 IntAct:P61354 MINT:MINT-4578026 STRING:10116.ENSRNOP00000028060 PaxDb:P61354 PRIDE:P61354 Ensembl:ENSRNOT00000028060 GeneID:64306 KEGG:rno:64306 UCSC:RGD:621192 InParanoid:P61354 NextBio:612950 PRO:PR:P61354 Genevestigator:P61354 Uniprot:P61354) HSP 1 Score: 45.8246 bits (107), Expect = 1.659e-6 Identity = 27/57 (47.37%), Postives = 31/57 (54.39%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV RSK SF KV NYN+LM T Y+VDI DK + K Sbjct: 42 LVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNK 98
BLAST of EMLSAG00000000213 vs. GO
Match: - (symbol:RPL27 "60S ribosomal protein L27" species:9823 "Sus scrofa" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] [GO:0022625 "cytosolic large ribosomal subunit" evidence=IEA] InterPro:IPR001141 InterPro:IPR018262 Pfam:PF01777 ProDom:PD009396 PROSITE:PS01107 Pfam:PF00467 GO:GO:0006412 GO:GO:0003735 Gene3D:2.30.30.30 InterPro:IPR014722 InterPro:IPR008991 SUPFAM:SSF50104 GO:GO:0022625 InterPro:IPR005824 SMART:SM00739 KO:K02901 PANTHER:PTHR10497 CTD:6155 HOVERGEN:HBG050005 EMBL:DQ629167 RefSeq:NP_001090948.1 UniGene:Ssc.13574 ProteinModelPortal:A1XQU5 SMR:A1XQU5 PRIDE:A1XQU5 GeneID:100037995 KEGG:ssc:100037995 ArrayExpress:A1XQU5 Uniprot:A1XQU5) HSP 1 Score: 45.8246 bits (107), Expect = 1.659e-6 Identity = 27/57 (47.37%), Postives = 31/57 (54.39%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV RSK SF KV NYN+LM T Y+VDI DK + K Sbjct: 42 LVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNK 98
BLAST of EMLSAG00000000213 vs. GO
Match: - (symbol:RPL27 "60S ribosomal protein L27" species:9606 "Homo sapiens" [GO:0000184 "nuclear-transcribed mRNA catabolic process, nonsense-mediated decay" evidence=TAS] [GO:0003735 "structural constituent of ribosome" evidence=NAS;TAS] [GO:0005829 "cytosol" evidence=TAS] [GO:0005840 "ribosome" evidence=TAS] [GO:0006412 "translation" evidence=NAS;TAS] [GO:0006413 "translational initiation" evidence=TAS] [GO:0006414 "translational elongation" evidence=TAS] [GO:0006415 "translational termination" evidence=TAS] [GO:0006614 "SRP-dependent cotranslational protein targeting to membrane" evidence=TAS] [GO:0010467 "gene expression" evidence=TAS] [GO:0016032 "viral process" evidence=TAS] [GO:0016070 "RNA metabolic process" evidence=TAS] [GO:0016071 "mRNA metabolic process" evidence=TAS] [GO:0019058 "viral life cycle" evidence=TAS] [GO:0019083 "viral transcription" evidence=TAS] [GO:0022625 "cytosolic large ribosomal subunit" evidence=IDA] [GO:0030529 "ribonucleoprotein complex" evidence=IDA] [GO:0044267 "cellular protein metabolic process" evidence=TAS] [GO:0044822 "poly(A) RNA binding" evidence=IDA] [GO:0070062 "extracellular vesicular exosome" evidence=IDA] Reactome:REACT_71 Reactome:REACT_21257 Reactome:REACT_17015 InterPro:IPR001141 InterPro:IPR018262 Pfam:PF01777 ProDom:PD009396 PROSITE:PS01107 Pfam:PF00467 GO:GO:0070062 Reactome:REACT_116125 GO:GO:0000184 GO:GO:0006413 GO:GO:0003735 Gene3D:2.30.30.30 InterPro:IPR014722 GO:GO:0006415 GO:GO:0006414 InterPro:IPR008991 SUPFAM:SSF50104 Reactome:REACT_1762 GO:GO:0006614 GO:GO:0022625 InterPro:IPR005824 SMART:SM00739 GO:GO:0019083 PDB:3J3B PDBsum:3J3B eggNOG:COG2163 HOGENOM:HOG000210138 KO:K02901 PANTHER:PTHR10497 OMA:KIYKPGK CTD:6155 HOVERGEN:HBG050005 OrthoDB:EOG7J181Z EMBL:L19527 EMBL:AB061851 EMBL:L05094 EMBL:BC001700 EMBL:BC002588 EMBL:BC007273 EMBL:BC010026 EMBL:BC098560 PIR:S43505 RefSeq:NP_000979.1 UniGene:Hs.514196 UniGene:Hs.660076 ProteinModelPortal:P61353 SMR:P61353 BioGrid:112074 IntAct:P61353 MINT:MINT-1145695 STRING:9606.ENSP00000253788 PhosphoSite:P61353 DMDM:47117772 SWISS-2DPAGE:P61353 PaxDb:P61353 PRIDE:P61353 DNASU:6155 Ensembl:ENST00000253788 Ensembl:ENST00000589037 Ensembl:ENST00000589913 GeneID:6155 KEGG:hsa:6155 UCSC:uc002icj.3 GeneCards:GC17P041150 HGNC:HGNC:10328 HPA:HPA002649 MIM:607526 neXtProt:NX_P61353 PharmGKB:PA34707 InParanoid:P61353 PhylomeDB:P61353 ChiTaRS:RPL27 GeneWiki:RPL27 GenomeRNAi:6155 NextBio:23903 PRO:PR:P61353 ArrayExpress:P61353 Bgee:P61353 CleanEx:HS_RPL27 Genevestigator:P61353 Uniprot:P61353) HSP 1 Score: 45.8246 bits (107), Expect = 1.659e-6 Identity = 27/57 (47.37%), Postives = 31/57 (54.39%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV RSK SF KV NYN+LM T Y+VDI DK + K Sbjct: 42 LVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNK 98
BLAST of EMLSAG00000000213 vs. GO
Match: - (symbol:RPL27 "60S ribosomal protein L27" species:9615 "Canis lupus familiaris" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0005840 "ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] InterPro:IPR001141 InterPro:IPR018262 Pfam:PF01777 ProDom:PD009396 PROSITE:PS01107 Pfam:PF00467 GO:GO:0006412 GO:GO:0005840 GO:GO:0003735 Gene3D:2.30.30.30 InterPro:IPR014722 InterPro:IPR008991 SUPFAM:SSF50104 InterPro:IPR005824 SMART:SM00739 KO:K02901 PANTHER:PTHR10497 OMA:KIYKPGK GeneTree:ENSGT00390000010721 CTD:6155 OrthoDB:EOG7J181Z TreeFam:TF314648 RefSeq:NP_001003102.2 UniGene:Cfa.28035 GeneID:403688 KEGG:cfa:403688 NextBio:20817192 EMBL:AAEX03006440 ProteinModelPortal:F2Z4N3 SMR:F2Z4N3 PRIDE:F2Z4N3 Ensembl:ENSCAFT00000023219 Uniprot:F2Z4N3) HSP 1 Score: 45.8246 bits (107), Expect = 1.659e-6 Identity = 27/57 (47.37%), Postives = 31/57 (54.39%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV RSK SF KV NYN+LM T Y+VDI DK + K Sbjct: 42 LVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNK 98
BLAST of EMLSAG00000000213 vs. GO
Match: - (symbol:RPL27 "60S ribosomal protein L27" species:9913 "Bos taurus" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0005840 "ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] InterPro:IPR001141 InterPro:IPR018262 Pfam:PF01777 ProDom:PD009396 PROSITE:PS01107 Pfam:PF00467 GO:GO:0006412 GO:GO:0003735 Gene3D:2.30.30.30 InterPro:IPR014722 InterPro:IPR008991 SUPFAM:SSF50104 GO:GO:0022625 InterPro:IPR005824 SMART:SM00739 eggNOG:COG2163 HOGENOM:HOG000210138 KO:K02901 PANTHER:PTHR10497 OMA:KIYKPGK GeneTree:ENSGT00390000010721 EMBL:AB098983 EMBL:BC102313 RefSeq:NP_001029223.1 RefSeq:XP_005220738.1 UniGene:Bt.4721 ProteinModelPortal:P61356 SMR:P61356 STRING:9913.ENSBTAP00000023183 PaxDb:P61356 PRIDE:P61356 Ensembl:ENSBTAT00000023183 GeneID:404137 KEGG:bta:404137 CTD:6155 HOVERGEN:HBG050005 InParanoid:P61356 OrthoDB:EOG7J181Z TreeFam:TF314648 NextBio:20817574 Uniprot:P61356) HSP 1 Score: 45.8246 bits (107), Expect = 1.659e-6 Identity = 27/57 (47.37%), Postives = 31/57 (54.39%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV RSK SF KV NYN+LM T Y+VDI DK + K Sbjct: 42 LVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNK 98
BLAST of EMLSAG00000000213 vs. GO
Match: - (symbol:RPL27 "60S ribosomal protein L27" species:9031 "Gallus gallus" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] [GO:0022625 "cytosolic large ribosomal subunit" evidence=IEA] InterPro:IPR001141 InterPro:IPR018262 Pfam:PF01777 ProDom:PD009396 PROSITE:PS01107 Pfam:PF00467 GO:GO:0006412 GO:GO:0003735 Gene3D:2.30.30.30 InterPro:IPR014722 InterPro:IPR008991 SUPFAM:SSF50104 GO:GO:0022625 InterPro:IPR005824 SMART:SM00739 eggNOG:COG2163 HOGENOM:HOG000210138 KO:K02901 PANTHER:PTHR10497 OMA:KIYKPGK GeneTree:ENSGT00390000010721 CTD:6155 HOVERGEN:HBG050005 OrthoDB:EOG7J181Z TreeFam:TF314648 EMBL:X56852 PIR:S22288 RefSeq:NP_990668.1 UniGene:Gga.743 ProteinModelPortal:P61355 SMR:P61355 BioGrid:676539 PaxDb:P61355 PRIDE:P61355 Ensembl:ENSGALT00000039748 GeneID:396280 KEGG:gga:396280 InParanoid:P61355 NextBio:20816331 PRO:PR:P61355 Uniprot:P61355) HSP 1 Score: 45.8246 bits (107), Expect = 1.659e-6 Identity = 27/57 (47.37%), Postives = 31/57 (54.39%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV RSK SF KV NYN+LM T Y+VDI DK + K Sbjct: 42 LVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNK 98
BLAST of EMLSAG00000000213 vs. GO
Match: - (symbol:RPL27 "60S ribosomal protein L27" species:9615 "Canis lupus familiaris" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0005840 "ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] InterPro:IPR001141 InterPro:IPR018262 Pfam:PF01777 ProDom:PD009396 PROSITE:PS01107 Pfam:PF00467 GO:GO:0006412 GO:GO:0005840 GO:GO:0003735 Gene3D:2.30.30.30 InterPro:IPR014722 InterPro:IPR008991 SUPFAM:SSF50104 InterPro:IPR005824 SMART:SM00739 eggNOG:COG2163 HOGENOM:HOG000210138 KO:K02901 PANTHER:PTHR10497 CTD:6155 HOVERGEN:HBG050005 EMBL:AJ388516 RefSeq:NP_001003102.2 UniGene:Cfa.28035 ProteinModelPortal:Q9XSU7 STRING:9615.ENSCAFP00000021561 PaxDb:Q9XSU7 GeneID:403688 KEGG:cfa:403688 InParanoid:Q9XSU7 NextBio:20817192 Uniprot:Q9XSU7) HSP 1 Score: 45.8246 bits (107), Expect = 1.742e-6 Identity = 27/57 (47.37%), Postives = 31/57 (54.39%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV RSK SF KV NYN+LM T Y+VDI DK + K Sbjct: 42 LVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNK 98
BLAST of EMLSAG00000000213 vs. C. finmarchicus
Match: gi|592788505|gb|GAXK01166063.1| (TSA: Calanus finmarchicus comp166_c0_seq2 transcribed RNA sequence) HSP 1 Score: 43.1282 bits (100), Expect = 6.470e-6 Identity = 27/57 (47.37%), Postives = 34/57 (59.65%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV + RSK F KV+NYN++M T Y+VDI FDK +I K Sbjct: 152 LVAGIDRYPRKVTKKMSKKKIQKRSKVKPFLKVVNYNHVMPTRYSVDISFDKTNINK 322
BLAST of EMLSAG00000000213 vs. C. finmarchicus
Match: gi|592788506|gb|GAXK01166062.1| (TSA: Calanus finmarchicus comp166_c0_seq1 transcribed RNA sequence) HSP 1 Score: 43.1282 bits (100), Expect = 7.521e-6 Identity = 27/57 (47.37%), Postives = 34/57 (59.65%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV + RSK F KV+NYN++M T Y+VDI FDK +I K Sbjct: 152 LVAGIDRYPRKVTKKMSKKKIQKRSKVKPFLKVVNYNHVMPTRYSVDISFDKTNINK 322
BLAST of EMLSAG00000000213 vs. C. finmarchicus
Match: gi|592781273|gb|GAXK01173295.1| (TSA: Calanus finmarchicus comp2383511_c0_seq1 transcribed RNA sequence) HSP 1 Score: 38.891 bits (89), Expect = 3.228e-4 Identity = 26/74 (35.14%), Postives = 32/74 (43.24%), Query Frame = 0 Query: 3 KHPQHMSHGGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGKGPQKPNIETESQ 68 K + G D YPRKV RSK F K +NYN++M T Y VDI+ K P ES+ Sbjct: 137 KFSHAIVAGIDRYPRKVTRAMGKNTIKKRSKVKPFVKFVNYNHIMPTRYVVDIDLKKVLDDDAMNNPETRVESR 358
BLAST of EMLSAG00000000213 vs. C. finmarchicus
Match: gi|592946265|gb|GAXK01012288.1| (TSA: Calanus finmarchicus comp3876908_c0_seq1 transcribed RNA sequence) HSP 1 Score: 36.5798 bits (83), Expect = 2.163e-3 Identity = 22/54 (40.74%), Postives = 31/54 (57.41%), Query Frame = 0 Query: 1 MVKHPQHMSHGGDFYPRKVGETRSKCMSFHKVLNYNNLMHTCYNVDIEFDKESI 54 + K P + G +KV E RS+ F KVLN+N+LM T Y+V+I+F I Sbjct: 164 VAKAPLKVKKG--MSAKKV-EKRSRIKPFLKVLNFNHLMPTRYSVEIDFKPAGI 316
BLAST of EMLSAG00000000213 vs. C. finmarchicus
Match: gi|592769344|gb|GAXK01185224.1| (TSA: Calanus finmarchicus comp3942177_c0_seq1 transcribed RNA sequence) HSP 1 Score: 33.4982 bits (75), Expect = 2.169e-2 Identity = 19/46 (41.30%), Postives = 25/46 (54.35%), Query Frame = 0 Query: 17 RKVGETRSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGKGPQKPN 62 RK E RS+ F K +NYN++M T Y+VDI+ K PN Sbjct: 199 RKKIEKRSRIKPFIKFVNYNHIMPTRYSVDIDVKSVVNSKVMANPN 336
BLAST of EMLSAG00000000213 vs. C. finmarchicus
Match: gi|592818579|gb|GAXK01135989.1| (TSA: Calanus finmarchicus comp2851050_c0_seq1 transcribed RNA sequence) HSP 1 Score: 33.4982 bits (75), Expect = 3.449e-2 Identity = 20/45 (44.44%), Postives = 23/45 (51.11%), Query Frame = 0 Query: 11 GGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDI 47 G D YPRKV + RSK F K N+ +LM T Y VDI Sbjct: 253 GIDRYPRKVTRSMGKKKTAKRSKIKPFVKAFNFTHLMPTRYQVDI 387
BLAST of EMLSAG00000000213 vs. C. finmarchicus
Match: gi|592815948|gb|GAXK01138620.1| (TSA: Calanus finmarchicus comp7628178_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.664e+0 Identity = 18/55 (32.73%), Postives = 25/55 (45.45%), Query Frame = 0 Query: 5 PQHMSHGGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDIEFDK 51 P + G D P KV ++ RSK F K N+N++M T Y D + K Sbjct: 149 PHCLVAGIDKAPLKVTKSMSKKKILKRSKIKPFLKYFNFNHIMPTRYAADFDLKK 313
BLAST of EMLSAG00000000213 vs. C. finmarchicus
Match: gi|592815947|gb|GAXK01138621.1| (TSA: Calanus finmarchicus comp7628178_c0_seq2 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 7.450e+0 Identity = 12/29 (41.38%), Postives = 16/29 (55.17%), Query Frame = 0 Query: 23 RSKCMSFHKVLNYNNLMHTCYNVDIEFDK 51 RSK F K N+N++M T Y D + K Sbjct: 191 RSKIKPFLKYFNFNHIMPTRYAADFDLKK 277
BLAST of EMLSAG00000000213 vs. L. salmonis peptides
Match: EMLSAP00000000213 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1030:53525:53767:-1 gene:EMLSAG00000000213 transcript:EMLSAT00000000213 description:"maker-LSalAtl2s1030-snap-gene-0.1") HSP 1 Score: 160.614 bits (405), Expect = 1.219e-52 Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 0 Query: 1 MVKHPQHMSHGGDFYPRKVGETRSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGKGPQKPNIETESQTIRHYRL 75 MVKHPQHMSHGGDFYPRKVGETRSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGKGPQKPNIETESQTIRHYRL Sbjct: 1 MVKHPQHMSHGGDFYPRKVGETRSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGKGPQKPNIETESQTIRHYRL 75
BLAST of EMLSAG00000000213 vs. L. salmonis peptides
Match: EMLSAP00000005005 (pep:novel supercontig:LSalAtl2s:LSalAtl2s260:403367:403765:1 gene:EMLSAG00000005005 transcript:EMLSAT00000005005 description:"augustus_masked-LSalAtl2s260-processed-gene-4.5") HSP 1 Score: 56.6102 bits (135), Expect = 7.580e-12 Identity = 32/57 (56.14%), Postives = 36/57 (63.16%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGE--------TRSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV + RSK F KVLNYN+LM T YNVDI+FDKESI K Sbjct: 38 LVAGVDRYPRKVTKRMSKKKVKQRSKIKPFLKVLNYNHLMPTRYNVDIKFDKESINK 94
BLAST of EMLSAG00000000213 vs. SwissProt
Match: gi|47117189|sp|Q7ZV82.3|RL27_DANRE (RecName: Full=60S ribosomal protein L27) HSP 1 Score: 47.7506 bits (112), Expect = 2.313e-7 Identity = 27/57 (47.37%), Postives = 32/57 (56.14%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV T RSK +F KV NYN+LM T Y+VDI DK + K Sbjct: 42 LVAGIDRYPRKVTATMGKKKIAKRSKIKAFVKVFNYNHLMPTRYSVDIPLDKTVVNK 98
BLAST of EMLSAG00000000213 vs. SwissProt
Match: gi|47117269|sp|Q90YU1.3|RL27_ICTPU (RecName: Full=60S ribosomal protein L27) HSP 1 Score: 47.3654 bits (111), Expect = 3.048e-7 Identity = 27/57 (47.37%), Postives = 32/57 (56.14%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGET--------RSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV T RSK +F KV NYN+LM T Y+VDI DK + K Sbjct: 42 LVSGIDRYPRKVTATMGKKKVAKRSKIKAFVKVFNYNHLMPTRYSVDIPLDKTIVNK 98
BLAST of EMLSAG00000000213 vs. Select Arthropod Genomes
Match: gb|KFM83405.1| (60S ribosomal protein L27, partial [Stegodyphus mimosarum]) HSP 1 Score: 47.7506 bits (112), Expect = 9.356e-8 Identity = 28/57 (49.12%), Postives = 32/57 (56.14%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGE--------TRSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV RSK F KVLNYN+LM T Y VDI+FDK + K Sbjct: 42 LIAGIDRYPRKVTRRMGKKKIAKRSKIKPFVKVLNYNHLMPTRYMVDIQFDKSIVNK 98
BLAST of EMLSAG00000000213 vs. Select Arthropod Genomes
Match: EFX78542.1 (hypothetical protein DAPPUDRAFT_231081 [Daphnia pulex]) HSP 1 Score: 45.0542 bits (105), Expect = 9.551e-7 Identity = 24/57 (42.11%), Postives = 33/57 (57.89%), Query Frame = 0 Query: 8 MSHGGDFYPRKVG--------ETRSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV RSK +F K++NYN++M T Y+VD+ FDK + K Sbjct: 42 LVAGVDRYPRKVTNKMSKKKVAKRSKIKAFVKIVNYNHMMPTRYSVDLSFDKNLVNK 98
BLAST of EMLSAG00000000213 vs. nr
Match: gi|225714122|gb|ACO12907.1| (60S ribosomal protein L27 [Lepeophtheirus salmonis] >gi|290561357|gb|ADD38079.1| 60S ribosomal protein L27 [Lepeophtheirus salmonis]) HSP 1 Score: 56.6102 bits (135), Expect = 2.103e-8 Identity = 32/57 (56.14%), Postives = 36/57 (63.16%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGE--------TRSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV + RSK F KVLNYN+LM T YNVDI+FDKESI K Sbjct: 42 LVAGVDRYPRKVTKRMSKKKVKQRSKIKPFLKVLNYNHLMPTRYNVDIKFDKESINK 98
BLAST of EMLSAG00000000213 vs. nr
Match: gi|290462955|gb|ADD24525.1| (60S ribosomal protein L27 [Lepeophtheirus salmonis]) HSP 1 Score: 56.225 bits (134), Expect = 2.213e-8 Identity = 32/57 (56.14%), Postives = 36/57 (63.16%), Query Frame = 0 Query: 8 MSHGGDFYPRKVGE--------TRSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 + G D YPRKV + RSK F KVLNYN+LM T YNVDI+FDKESI K Sbjct: 38 LVAGVDRYPRKVTKRMSKKKVKQRSKIKPFLKVLNYNHLMPTRYNVDIKFDKESINK 94
BLAST of EMLSAG00000000213 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1323_size47899-snap-gene-0.17 (protein:Tk03421 transcript:maker-scaffold1323_size47899-snap-gene-0.17-mRNA-1 annotation:"60s ribosomal protein l27") HSP 1 Score: 43.5134 bits (101), Expect = 3.398e-7 Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 0 Query: 11 GGDFYPRKVGE--------TRSKCMSFHKVLNYNNLMHTCYNVDIEFDKESIGK 56 G D YPR V + RSK F KV+NYN++M T Y+VDI FDK ++ K Sbjct: 45 GIDRYPRIVTKRMSKKKIKMRSKIKPFLKVVNYNHMMPTRYSVDIGFDKANLNK 98 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000213 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 20
Pagesback to top
BLAST of EMLSAG00000000213 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 8
BLAST of EMLSAG00000000213 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 2
BLAST of EMLSAG00000000213 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 2
BLAST of EMLSAG00000000213 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 2
BLAST of EMLSAG00000000213 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 2
BLAST of EMLSAG00000000213 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1030:53525..53767- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000213-682979 ID=EMLSAG00000000213-682979|Name=EMLSAG00000000213|organism=Lepeophtheirus salmonis|type=gene|length=243bp|location=Sequence derived from alignment at LSalAtl2s1030:53525..53767- (Lepeophtheirus salmonis)back to top Add to Basket
|