EMLSAG00000000332, EMLSAG00000000332-683098 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000332 vs. C. finmarchicus
Match: gi|592859905|gb|GAXK01097657.1| (TSA: Calanus finmarchicus comp38631_c0_seq1 transcribed RNA sequence) HSP 1 Score: 33.4982 bits (75), Expect = 4.114e-2 Identity = 16/35 (45.71%), Postives = 21/35 (60.00%), Query Frame = 0 Query: 34 EGCCLTTSNFSDRHSLSVDTLDGNRSKIAQRVWSQ 68 E CL T + RH L V LD + K++QRVW+Q Sbjct: 625 EAGCLPTLHLCHRHPLPVYGLDSDGCKVSQRVWAQ 729
BLAST of EMLSAG00000000332 vs. C. finmarchicus
Match: gi|592764983|gb|GAXK01189585.1| (TSA: Calanus finmarchicus comp2861496_c0_seq1 transcribed RNA sequence) HSP 1 Score: 32.7278 bits (73), Expect = 4.364e-2 Identity = 13/44 (29.55%), Postives = 21/44 (47.73%), Query Frame = 0 Query: 11 LVTSSETIHTHLCNGCLNKSMKCEGCCLTTSNFSDRHSLSVDTL 54 V S +I H N + G C +SNF + + +++DTL Sbjct: 227 FVIFSASIEIHFVNKFVPTIFILLGSCFISSNFVNMYDVAIDTL 358
BLAST of EMLSAG00000000332 vs. C. finmarchicus
Match: gi|592930227|gb|GAXK01028318.1| (TSA: Calanus finmarchicus comp5791931_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 3.159e+0 Identity = 16/51 (31.37%), Postives = 29/51 (56.86%), Query Frame = 0 Query: 10 CLVTSSE-TIHTHLCNGCLNKSMKCEGCCLTTSNFSDRHSLSVDTLDGNRS 59 +T +E + H+ + NK KCE C TTS+ +D +++ ++T+ G S Sbjct: 194 AFITGTEMELEHHILDVHWNKQYKCEKCDFTTSSVND-YNVHINTIHGTES 343
BLAST of EMLSAG00000000332 vs. C. finmarchicus
Match: gi|592898363|gb|GAXK01060012.1| (TSA: Calanus finmarchicus comp757876_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 5.004e+0 Identity = 12/39 (30.77%), Postives = 21/39 (53.85%), Query Frame = 0 Query: 3 DELKVNRCLVTSSETIHTHLCNGCLNKSMKCEGCCLTTS 41 D L+ L+ S ++ H GC+NK + C+ C++ S Sbjct: 1336 DRLQNQAPLICSGIVMNLHPMTGCINKLINCKQACISVS 1452
BLAST of EMLSAG00000000332 vs. C. finmarchicus
Match: gi|592948794|gb|GAXK01009759.1| (TSA: Calanus finmarchicus comp2834922_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 5.884e+0 Identity = 11/26 (42.31%), Postives = 16/26 (61.54%), Query Frame = 0 Query: 18 IHTHLCNGCLNKSMKCEGCCLTTSNF 43 +H LC GCL ++M C CL ++ F Sbjct: 458 LHCTLCCGCLCRTMYCSAPCLASAQF 535
BLAST of EMLSAG00000000332 vs. C. finmarchicus
Match: gi|592779848|gb|GAXK01174720.1| (TSA: Calanus finmarchicus comp4934667_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 7.645e+0 Identity = 17/58 (29.31%), Postives = 26/58 (44.83%), Query Frame = 0 Query: 5 LKVNRCLVTSSETIHTHLCNGCLNKSMKCEGCCLTTSNFSDRHSLSVDTLDGNRSKIA 62 L+ RC TSS T +H+ C + + C T+S+ + R V L G + A Sbjct: 166 LENPRCHSTSSSTQCSHIWTNCRGQGIAPSSPCFTSSSRTPRPLAPVSLLTGRWAGTA 339
BLAST of EMLSAG00000000332 vs. L. salmonis peptides
Match: EMLSAP00000000332 (pep:novel supercontig:LSalAtl2s:LSalAtl2s104:451279:451697:-1 gene:EMLSAG00000000332 transcript:EMLSAT00000000332 description:"maker-LSalAtl2s104-snap-gene-4.29") HSP 1 Score: 140.198 bits (352), Expect = 7.404e-45 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0 Query: 1 MFDELKVNRCLVTSSETIHTHLCNGCLNKSMKCEGCCLTTSNFSDRHSLSVDTLDGNRSKIAQRVWSQ 68 MFDELKVNRCLVTSSETIHTHLCNGCLNKSMKCEGCCLTTSNFSDRHSLSVDTLDGNRSKIAQRVWSQ Sbjct: 1 MFDELKVNRCLVTSSETIHTHLCNGCLNKSMKCEGCCLTTSNFSDRHSLSVDTLDGNRSKIAQRVWSQ 68 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000332 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000332 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 6
BLAST of EMLSAG00000000332 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000332 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000332 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000332 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000332 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s104:451279..451697- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000332-683098 ID=EMLSAG00000000332-683098|Name=EMLSAG00000000332|organism=Lepeophtheirus salmonis|type=gene|length=419bp|location=Sequence derived from alignment at LSalAtl2s104:451279..451697- (Lepeophtheirus salmonis)back to top Add to Basket
|