EMLSAG00000000367, EMLSAG00000000367-683133 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000367
Unique NameEMLSAG00000000367-683133
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
Z F205 367 female
  1. PreAdult2
  2. Adult
-Missing-
no visible phenotype
27.08.2015 - 13:44
01.10.2015 (All day)
Homology
BLAST of EMLSAG00000000367 vs. GO
Match: - (symbol:CAGL0I10098g "Similarities with uniprot|P08640 Saccharomyces cerevisiae YIR019c STA1" species:284593 "Candida glabrata CBS 138" [GO:0003674 "molecular_function" evidence=ND] [GO:0005575 "cellular_component" evidence=ND] [GO:0044406 "adhesion to host" evidence=IMP] GO:GO:0044406 EMBL:CR380955 Gene3D:3.90.182.10 InterPro:IPR011658 Pfam:PF07691 SMART:SM00758 OrthoDB:EOG7H4F6F RefSeq:XP_447684.1 ProteinModelPortal:Q6FQ10 GeneID:2889285 KEGG:cgr:CAGL0I10098g OMA:DNGTGNE Uniprot:Q6FQ10)

HSP 1 Score: 51.2174 bits (121), Expect = 1.992e-6
Identity = 31/66 (46.97%), Postives = 42/66 (63.64%), Query Frame = 0
Query:  133 AAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYATAPVAAAYSAV 198
            A+PAA  G+  A+PAA  G+  A+PAA  G+  A+PAA  G+  A+PAA  G+   +P A A SAV
Sbjct: 1492 ASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSAV 1557          

HSP 2 Score: 50.8322 bits (120), Expect = 2.926e-6
Identity = 37/93 (39.78%), Postives = 51/93 (54.84%), Query Frame = 0
Query:  115 EPYIHQEPVYAPAYYSGY--AAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYATAPVAAAYSAVHAAPAAY 205
             P    +P   P   +G   A+PAA  G+  A+PAA  G+  A+PAA  G+  A+PAA  G+  A+PAA  G+   +P A A S   A+PAA 
Sbjct: 1450 NPSGTNKPQTKPTANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSN-GASPAAN 1541          

HSP 3 Score: 49.6766 bits (117), Expect = 8.375e-6
Identity = 33/73 (45.21%), Postives = 45/73 (61.64%), Query Frame = 0
Query:  133 AAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYATAPVAAAYSAVHAAPAAY 205
            A+PAA  G+  A+PAA  G+  A+PAA  G+  A+PAA  G+  A+PAA  G+   +P A A S   A+PAA 
Sbjct: 1481 ASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSN-GASPAAN 1552          

HSP 4 Score: 46.595 bits (109), Expect = 8.918e-5
Identity = 30/65 (46.15%), Postives = 43/65 (66.15%), Query Frame = 0
Query:  133 AAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYATAPVAAAYSA 197
            A+PAA  G+  A+PAA  G+  A+PAA  G+  A+PAA  G+  A+PAA  G+ A AP A+A ++
Sbjct: 1503 ASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGS-AVAPKASASNS 1566          
BLAST of EMLSAG00000000367 vs. GO
Match: - (symbol:PWP7 species:5478 "Candida glabrata" [GO:0044406 "adhesion to host" evidence=IMP] [GO:0003674 "molecular_function" evidence=ND] [GO:0005575 "cellular_component" evidence=ND] [GO:0031589 "cell-substrate adhesion" evidence=IEA] [GO:0000501 "flocculation via cell wall protein-carbohydrate interaction" evidence=IEA] GO:GO:0044406 EMBL:CR380955 Gene3D:3.90.182.10 InterPro:IPR011658 Pfam:PF07691 SMART:SM00758 OrthoDB:EOG7H4F6F RefSeq:XP_447684.1 ProteinModelPortal:Q6FQ10 GeneID:2889285 KEGG:cgr:CAGL0I10098g OMA:DNGTGNE Uniprot:Q6FQ10)

HSP 1 Score: 51.2174 bits (121), Expect = 1.992e-6
Identity = 31/66 (46.97%), Postives = 42/66 (63.64%), Query Frame = 0
Query:  133 AAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYATAPVAAAYSAV 198
            A+PAA  G+  A+PAA  G+  A+PAA  G+  A+PAA  G+  A+PAA  G+   +P A A SAV
Sbjct: 1492 ASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSAV 1557          

HSP 2 Score: 50.8322 bits (120), Expect = 2.926e-6
Identity = 37/93 (39.78%), Postives = 51/93 (54.84%), Query Frame = 0
Query:  115 EPYIHQEPVYAPAYYSGY--AAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYATAPVAAAYSAVHAAPAAY 205
             P    +P   P   +G   A+PAA  G+  A+PAA  G+  A+PAA  G+  A+PAA  G+  A+PAA  G+   +P A A S   A+PAA 
Sbjct: 1450 NPSGTNKPQTKPTANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSN-GASPAAN 1541          

HSP 3 Score: 49.6766 bits (117), Expect = 8.375e-6
Identity = 33/73 (45.21%), Postives = 45/73 (61.64%), Query Frame = 0
Query:  133 AAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYATAPVAAAYSAVHAAPAAY 205
            A+PAA  G+  A+PAA  G+  A+PAA  G+  A+PAA  G+  A+PAA  G+   +P A A S   A+PAA 
Sbjct: 1481 ASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSN-GASPAAN 1552          

HSP 4 Score: 46.595 bits (109), Expect = 8.918e-5
Identity = 30/65 (46.15%), Postives = 43/65 (66.15%), Query Frame = 0
Query:  133 AAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYATAPVAAAYSA 197
            A+PAA  G+  A+PAA  G+  A+PAA  G+  A+PAA  G+  A+PAA  G+ A AP A+A ++
Sbjct: 1503 ASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGS-AVAPKASASNS 1566          
BLAST of EMLSAG00000000367 vs. L. salmonis peptides
Match: EMLSAP00000000367 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1054:125091:125841:-1 gene:EMLSAG00000000367 transcript:EMLSAT00000000367 description:"maker-LSalAtl2s1054-augustus-gene-0.4")

HSP 1 Score: 349.747 bits (896), Expect = 8.010e-123
Identity = 208/208 (100.00%), Postives = 208/208 (100.00%), Query Frame = 0
Query:    1 MKAFVAVLSTLIAVASSTVLPGAYAHGHGLYGYAGYGAPIAHHGVYAXAPAAYPYAYADAYPVAEPYIHEEVAAEEYVHEEVPAEEYVHQEIAAEEYSHEEVPAEEYVHEEVAAEPYIHQEPVYAPAYYSGYAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYATAPVAAAYSAVHAAPAAYHQY 208
            MKAFVAVLSTLIAVASSTVLPGAYAHGHGLYGYAGYGAPIAHHGVYAXAPAAYPYAYADAYPVAEPYIHEEVAAEEYVHEEVPAEEYVHQEIAAEEYSHEEVPAEEYVHEEVAAEPYIHQEPVYAPAYYSGYAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYATAPVAAAYSAVHAAPAAYHQY
Sbjct:    1 MKAFVAVLSTLIAVASSTVLPGAYAHGHGLYGYAGYGAPIAHHGVYAXAPAAYPYAYADAYPVAEPYIHEEVAAEEYVHEEVPAEEYVHQEIAAEEYSHEEVPAEEYVHEEVAAEPYIHQEPVYAPAYYSGYAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYATAPVAAAYSAVHAAPAAYHQY 208          
BLAST of EMLSAG00000000367 vs. nr
Match: gi|155966131|gb|ABU41020.1| (hypothetical protein [Lepeophtheirus salmonis])

HSP 1 Score: 348.977 bits (894), Expect = 1.438e-120
Identity = 207/208 (99.52%), Postives = 207/208 (99.52%), Query Frame = 0
Query:    1 MKAFVAVLSTLIAVASSTVLPGAYAHGHGLYGYAGYGAPIAHHGVYAXAPAAYPYAYADAYPVAEPYIHEEVAAEEYVHEEVPAEEYVHQEIAAEEYSHEEVPAEEYVHEEVAAEPYIHQEPVYAPAYYSGYAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYATAPVAAAYSAVHAAPAAYHQY 208
            MKAFVAVLSTLIAVASSTVLPGAYAHGHGLYGYAGYGAPIAHHGVYA APAAYPYAYADAYPVAEPYIHEEVAAEEYVHEEVPAEEYVHQEIAAEEYSHEEVPAEEYVHEEVAAEPYIHQEPVYAPAYYSGYAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYATAPVAAAYSAVHAAPAAYHQY
Sbjct:    1 MKAFVAVLSTLIAVASSTVLPGAYAHGHGLYGYAGYGAPIAHHGVYAHAPAAYPYAYADAYPVAEPYIHEEVAAEEYVHEEVPAEEYVHQEIAAEEYSHEEVPAEEYVHEEVAAEPYIHQEPVYAPAYYSGYAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYAAAPAAYHGAYATAPVAAAYSAVHAAPAAYHQY 208          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000367 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 2
Match NameE-valueIdentityDescription
-1.992e-646.97symbol:CAGL0I10098g "Similarities with uniprot|P08... [more]
-1.992e-646.97symbol:PWP7 species:5478 "Candida glabrata" [GO:00... [more]
back to top
BLAST of EMLSAG00000000367 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000367 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 1
Match NameE-valueIdentityDescription
EMLSAP000000003678.010e-123100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1054:1250... [more]
back to top
BLAST of EMLSAG00000000367 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000367 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000367 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 1
Match NameE-valueIdentityDescription
gi|155966131|gb|ABU41020.1|1.438e-12099.52hypothetical protein [Lepeophtheirus salmonis][more]
back to top
BLAST of EMLSAG00000000367 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1054supercontigLSalAtl2s1054:125091..125841 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s1054-augustus-gene-0.4
Biotypeprotein_coding
EvidenceIEA
Notehypothetical protein [Lepeophtheirus salmonis]
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000367 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000367EMLSAT00000000367-696214Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1054:125091..125841-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000367-683133 ID=EMLSAG00000000367-683133|Name=EMLSAG00000000367|organism=Lepeophtheirus salmonis|type=gene|length=751bp|location=Sequence derived from alignment at LSalAtl2s1054:125091..125841- (Lepeophtheirus salmonis)
ATGAAGGCTTTCGTAAGTGTTATACAGCATCTTTTCTTTCATTTCACAAT ACAAACAACAAAAACAAATCGATAAACCAATAAAAAGACAACAGCAGTTC TTTATAAATCATAATAATTACTCACTTCTTTTTCAGGTCGCTGTTCTTTC TACCCTCATCGCTGTTGCTTCAAGCACAGTCCTCCCCGGTGCCTATGCCC ATGGACATGGATTGTACGGTTATGCCGGATATGGTGCCCCCATAGCTCAC CATGGTGTTTATGCTCMCGCTCCTGCCGCCTACCCTTATGCCTACGCTGA TGCCTACCCCGTTGCCGAACCCTACATCCACGAAGAAGTTGCAGCTGAGG AATACGTTCACGAAGAGGTCCCTGCTGAGGAATACGTTCATCAAGAGATC GCTGCTGAGGAATACTCCCACGAGGAGGTCCCTGCTGAGGAATATGTTCA TGAGGAGGTCGCCGCTGAGCCCTACATTCACCAAGAACCCGTCTATGCTC CTGCTTATTACTCCGGATATGCTGCCCCAGCAGCTTACCATGGTGCTTAT GCCGCCGCCCCTGCTGCTTATCACGGTGCCTACGCCGCTGCCCCAGCTGC TTACCACGGTGCCTACGCCGCTGCCCCAGCTGCTTACCATGGTGCCTACG CCGCTGCCCCAGCTGCTTACCACGGTGCTTATGCCACTGCTCCCGTTGCT GCTGCATACTCAGCTGTTCACGCCGCTCCCGCTGCCTACCATCAATACTA A
back to top
Add to Basket