EMLSAG00000000556, EMLSAG00000000556-683322 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000556 vs. C. finmarchicus
Match: gi|592919879|gb|GAXK01038496.1| (TSA: Calanus finmarchicus comp664657_c0_seq6 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 5.810e+0 Identity = 11/30 (36.67%), Postives = 19/30 (63.33%), Query Frame = 0 Query: 1 MNESNTFERSSQIQITYADIAHTYESLFSN 30 +NES+ +E Q Q +++AH YE + +N Sbjct: 87 LNESDLYENIDQDQEPISEVAHYYEEILNN 176
BLAST of EMLSAG00000000556 vs. C. finmarchicus
Match: gi|592754889|gb|GAXK01199524.1| (TSA: Calanus finmarchicus comp121084_c1_seq7 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 7.796e+0 Identity = 11/40 (27.50%), Postives = 20/40 (50.00%), Query Frame = 0 Query: 11 SQIQITYADIAHTYESLFSNYMDNRFIKVGIKNALFKNFI 50 S ++I+ I H Y S ++ N+F+ N +K F+ Sbjct: 288 STLKISLTCIPHIYPSHDCYFLHNKFVSTSFLNTCWKEFV 407
BLAST of EMLSAG00000000556 vs. C. finmarchicus
Match: gi|592754905|gb|GAXK01199508.1| (TSA: Calanus finmarchicus comp121084_c0_seq5 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 8.829e+0 Identity = 11/40 (27.50%), Postives = 20/40 (50.00%), Query Frame = 0 Query: 11 SQIQITYADIAHTYESLFSNYMDNRFIKVGIKNALFKNFI 50 S ++I+ I H Y S ++ N+F+ N +K F+ Sbjct: 572 STLKISLTCIPHIYPSHDCYFLHNKFVSTSFLNTCWKEFV 691
BLAST of EMLSAG00000000556 vs. L. salmonis peptides
Match: EMLSAP00000000556 (pep:novel supercontig:LSalAtl2s:LSalAtl2s108:655411:655728:1 gene:EMLSAG00000000556 transcript:EMLSAT00000000556 description:"maker-LSalAtl2s108-snap-gene-6.11") HSP 1 Score: 151.369 bits (381), Expect = 4.915e-49 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0 Query: 1 MNESNTFERSSQIQITYADIAHTYESLFSNYMDNRFIKVGIKNALFKNFIGCIFVRFCEFLVKTCSNLQKKLH 73 MNESNTFERSSQIQITYADIAHTYESLFSNYMDNRFIKVGIKNALFKNFIGCIFVRFCEFLVKTCSNLQKKLH Sbjct: 1 MNESNTFERSSQIQITYADIAHTYESLFSNYMDNRFIKVGIKNALFKNFIGCIFVRFCEFLVKTCSNLQKKLH 73
BLAST of EMLSAG00000000556 vs. L. salmonis peptides
Match: EMLSAP00000000555 (pep:novel supercontig:LSalAtl2s:LSalAtl2s108:639898:640819:-1 gene:EMLSAG00000000555 transcript:EMLSAT00000000555 description:"snap_masked-LSalAtl2s108-processed-gene-6.5") HSP 1 Score: 77.0258 bits (188), Expect = 7.214e-19 Identity = 37/71 (52.11%), Postives = 51/71 (71.83%), Query Frame = 0 Query: 1 MNESNTFERSSQIQITYADIAHTYESLFSNYMDNRFIKVGIKNALFKNFIGC-IFVRFCEFLVKTCSNLQK 70 ++ S +F + S+++IT +I HTYE+LFS YMDNR KV I +A + F +F+RFCEFLVKTC NL+K Sbjct: 118 IDSSRSFNKCSRMKITEGEIGHTYENLFSKYMDNRVTKVDINDAFIQKFHQIRLFLRFCEFLVKTCPNLEK 188
BLAST of EMLSAG00000000556 vs. L. salmonis peptides
Match: EMLSAP00000007914 (pep:novel supercontig:LSalAtl2s:LSalAtl2s467:69795:70696:-1 gene:EMLSAG00000007914 transcript:EMLSAT00000007914 description:"maker-LSalAtl2s467-augustus-gene-0.16") HSP 1 Score: 75.0998 bits (183), Expect = 3.279e-18 Identity = 40/71 (56.34%), Postives = 49/71 (69.01%), Query Frame = 0 Query: 1 MNESNTFERSSQIQITYADIAHTYESLFSNYMDNRFIKVGIKNALFKNFIGC-IFVRFCEFLVKTCSNLQK 70 ++ S+T RSSQIQI + HTYESLFSNYMDN +V I +A + F +F+ FCEFLVKTC NLQK Sbjct: 95 IDSSSTQNRSSQIQIRDGETGHTYESLFSNYMDNFITEVYINDAYIQKFHQIRLFLGFCEFLVKTCPNLQK 165
BLAST of EMLSAG00000000556 vs. nr
Match: gi|225713338|gb|ACO12515.1| (MIT domain-containing protein 1 [Lepeophtheirus salmonis] >gi|290462311|gb|ADD24203.1| MIT domain-containing protein 1 [Lepeophtheirus salmonis]) HSP 1 Score: 79.7221 bits (195), Expect = 1.878e-16 Identity = 38/71 (53.52%), Postives = 52/71 (73.24%), Query Frame = 0 Query: 1 MNESNTFERSSQIQITYADIAHTYESLFSNYMDNRFIKVGIKNALFKNFIGC-IFVRFCEFLVKTCSNLQK 70 ++ S +F + S+++IT +I HTYE+LFSNYMDNR KV I +A + F +F+RFCEFLVKTC NL+K Sbjct: 97 IDSSRSFNKCSRMKITEGEIGHTYENLFSNYMDNRVTKVDINDAFIQKFHQIRLFLRFCEFLVKTCPNLEK 167
BLAST of EMLSAG00000000556 vs. nr
Match: gi|290561595|gb|ADD38197.1| (MIT domain-containing protein 1 [Lepeophtheirus salmonis]) HSP 1 Score: 73.9442 bits (180), Expect = 2.131e-14 Identity = 40/70 (57.14%), Postives = 47/70 (67.14%), Query Frame = 0 Query: 2 NESNTFERSSQIQITYADIAHTYESLFSNYMDNRFIKVGIKNALFKNFIGC-IFVRFCEFLVKTCSNLQK 70 + S+T RSSQIQI + HTYESLFSNYMDN V I +A + F +F+ FCEFLVKTC NLQK Sbjct: 79 DSSSTQNRSSQIQIRDGETGHTYESLFSNYMDNFITGVYINDAYIQKFHQIRLFLGFCEFLVKTCPNLQK 148 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000556 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000556 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 3
BLAST of EMLSAG00000000556 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 3
BLAST of EMLSAG00000000556 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000556 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000556 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 2
BLAST of EMLSAG00000000556 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s108:655411..655728+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000556-683322 ID=EMLSAG00000000556-683322|Name=EMLSAG00000000556|organism=Lepeophtheirus salmonis|type=gene|length=318bp|location=Sequence derived from alignment at LSalAtl2s108:655411..655728+ (Lepeophtheirus salmonis)back to top Add to Basket
|