EMLSAG00000000577, EMLSAG00000000577-683343 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000577 vs. C. finmarchicus
Match: gi|592810284|gb|GAXK01144284.1| (TSA: Calanus finmarchicus comp1490550_c0_seq2 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 8.870e+0 Identity = 13/29 (44.83%), Postives = 18/29 (62.07%), Query Frame = 0 Query: 10 LHGTCRFTDYGELSFIVVILLNTSLKWTS 38 L+ C+ D E + +ILL TSL+WTS Sbjct: 5415 LNWDCQLKDRFESTLERIILLTTSLEWTS 5501
BLAST of EMLSAG00000000577 vs. C. finmarchicus
Match: gi|592943090|gb|GAXK01015463.1| (TSA: Calanus finmarchicus comp3849973_c0_seq1 transcribed RNA sequence) HSP 1 Score: 25.7942 bits (55), Expect = 8.993e+0 Identity = 10/41 (24.39%), Postives = 27/41 (65.85%), Query Frame = 0 Query: 23 SFIVVILLNTSLKWTSQHTSLPRKNSNFS--RNLVEDALQL 61 +++V+++L+ +++WT Q K NF+ +N++E+ + + Sbjct: 138 AWLVLVVLSCTVQWTYQSACAMLKKLNFAG*KNVIEEGVPI 260
BLAST of EMLSAG00000000577 vs. L. salmonis peptides
Match: EMLSAP00000000577 (pep:novel supercontig:LSalAtl2s:LSalAtl2s10981:195:432:-1 gene:EMLSAG00000000577 transcript:EMLSAT00000000577 description:"maker-LSalAtl2s10981-snap-gene-0.2") HSP 1 Score: 127.487 bits (319), Expect = 4.773e-40 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0 Query: 1 MFYLFEIGTLHGTCRFTDYGELSFIVVILLNTSLKWTSQHTSLPRKNSNFSRNLVEDALQL 61 MFYLFEIGTLHGTCRFTDYGELSFIVVILLNTSLKWTSQHTSLPRKNSNFSRNLVEDALQL Sbjct: 1 MFYLFEIGTLHGTCRFTDYGELSFIVVILLNTSLKWTSQHTSLPRKNSNFSRNLVEDALQL 61 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000577 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000577 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 2
BLAST of EMLSAG00000000577 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000577 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000577 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000577 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000577 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s10981:195..432- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000577-683343 ID=EMLSAG00000000577-683343|Name=EMLSAG00000000577|organism=Lepeophtheirus salmonis|type=gene|length=238bp|location=Sequence derived from alignment at LSalAtl2s10981:195..432- (Lepeophtheirus salmonis)back to top Add to Basket
|