EMLSAG00000000612, EMLSAG00000000612-683378 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000612 vs. C. finmarchicus
Match: gi|592871253|gb|GAXK01086309.1| (TSA: Calanus finmarchicus comp5218110_c0_seq1 transcribed RNA sequence) HSP 1 Score: 29.261 bits (64), Expect = 6.689e-1 Identity = 11/19 (57.89%), Postives = 13/19 (68.42%), Query Frame = 0 Query: 7 CLPPGLMCISNVDCCSDKC 25 C+PPGL C +V SDKC Sbjct: 166 CMPPGLECYKSVQKTSDKC 222
BLAST of EMLSAG00000000612 vs. C. finmarchicus
Match: gi|592928048|gb|GAXK01030439.1| (TSA: Calanus finmarchicus comp1889913_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 9.148e-1 Identity = 15/44 (34.09%), Postives = 23/44 (52.27%), Query Frame = 0 Query: 1 MDRQDDCLPPGLMCISNVDCCSDKCSNSG---TSRPLGLCCIPS 41 MD CL G C S+ +CC++ CS+ T+ G C +P+ Sbjct: 78 MDHSPSCLADGEFCFSDGECCAEFCSHHWPPTTTPVFGECGLPA 209
BLAST of EMLSAG00000000612 vs. C. finmarchicus
Match: gi|592852987|gb|GAXK01104557.1| (TSA: Calanus finmarchicus comp2360927_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 9.598e-1 Identity = 10/19 (52.63%), Postives = 13/19 (68.42%), Query Frame = 0 Query: 7 CLPPGLMCISNVDCCSDKC 25 C+PPGL C V+ S+KC Sbjct: 398 CMPPGLECYKTVEKYSEKC 454
BLAST of EMLSAG00000000612 vs. C. finmarchicus
Match: gi|592894022|gb|GAXK01064353.1| (TSA: Calanus finmarchicus comp6667602_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 1.652e+0 Identity = 10/19 (52.63%), Postives = 14/19 (73.68%), Query Frame = 0 Query: 7 CLPPGLMCISNVDCCSDKC 25 C+PPGL C +V+ S+KC Sbjct: 81 CMPPGLECYKSVETYSEKC 137
BLAST of EMLSAG00000000612 vs. C. finmarchicus
Match: gi|592837769|gb|GAXK01119775.1| (TSA: Calanus finmarchicus comp653375_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 4.533e+0 Identity = 16/43 (37.21%), Postives = 22/43 (51.16%), Query Frame = 0 Query: 3 RQDDCLPPGLMCISNVDCC----SDKCSNSGTSRPLGLCCIPS 41 R + PPGL V CC + S SG++RP +C +PS Sbjct: 195 RHTELTPPGLAATGPVPCCQVLRTPSPSYSGSARP--MCGVPS 317
BLAST of EMLSAG00000000612 vs. C. finmarchicus
Match: gi|592862869|gb|GAXK01094693.1| (TSA: Calanus finmarchicus comp49326_c0_seq6 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 8.727e+0 Identity = 16/34 (47.06%), Postives = 20/34 (58.82%), Query Frame = 0 Query: 3 RQDDCLPPGL--MCISNVDCCSDKCSNSGTSRPL 34 R D CL L C+S++ CC+ CS S SRPL Sbjct: 379 RLDVCLLVTLATYCVSSLFCCAAICS-SAVSRPL 477
BLAST of EMLSAG00000000612 vs. L. salmonis peptides
Match: EMLSAP00000000612 (pep:novel supercontig:LSalAtl2s:LSalAtl2s109:505658:505985:-1 gene:EMLSAG00000000612 transcript:EMLSAT00000000612 description:"maker-LSalAtl2s109-augustus-gene-5.12") HSP 1 Score: 126.716 bits (317), Expect = 1.372e-39 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0 Query: 1 MDRQDDCLPPGLMCISNVDCCSDKCSNSGTSRPLGLCCIPSGQKCLNSSNKKCCSKSCNASTKTCD 66 MDRQDDCLPPGLMCISNVDCCSDKCSNSGTSRPLGLCCIPSGQKCLNSSNKKCCSKSCNASTKTCD Sbjct: 1 MDRQDDCLPPGLMCISNVDCCSDKCSNSGTSRPLGLCCIPSGQKCLNSSNKKCCSKSCNASTKTCD 66 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000612 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000612 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 6
BLAST of EMLSAG00000000612 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000612 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000612 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000612 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000612 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s109:505658..505985- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000612-683378 ID=EMLSAG00000000612-683378|Name=EMLSAG00000000612|organism=Lepeophtheirus salmonis|type=gene|length=328bp|location=Sequence derived from alignment at LSalAtl2s109:505658..505985- (Lepeophtheirus salmonis)back to top Add to Basket
|