EMLSAG00000000672, EMLSAG00000000672-683438 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Match: gi|592943160|gb|GAXK01015393.1| (TSA: Calanus finmarchicus comp1915277_c0_seq1 transcribed RNA sequence) HSP 1 Score: 41.9726 bits (97), Expect = 1.781e-5 Identity = 20/42 (47.62%), Postives = 25/42 (59.52%), Query Frame = 0 Query: 18 YSISDKAYHPDYDSTTHENDIVILTTVFNMGPNINSIPVCLP 59 + + K HPDYDSTT +ND+ ILT +M PVCLP Sbjct: 29 FKVCSKIEHPDYDSTTSDNDLSILTLCSSMTYRKEVKPVCLP 154
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Match: gi|592922301|gb|GAXK01036088.1| (TSA: Calanus finmarchicus comp108889_c0_seq1 transcribed RNA sequence) HSP 1 Score: 43.1282 bits (100), Expect = 3.467e-5 Identity = 21/56 (37.50%), Postives = 31/56 (55.36%), Query Frame = 0 Query: 17 LYSISDKAYHPDYDSTTHENDIVILTTVFNMGPNINSIPVCLPQVSTHDFTDMPAT 72 ++ + KA HPDYDS T+E+D ILT + P+CLP S + D+ +T Sbjct: 645 VFDVCSKAEHPDYDSNTNEHDFAILTLCKPITFRKTVSPICLPTQSGASYDDVLST 812
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Match: gi|592908982|gb|GAXK01049393.1| (TSA: Calanus finmarchicus comp1471540_c0_seq1 transcribed RNA sequence) HSP 1 Score: 41.2022 bits (95), Expect = 9.575e-5 Identity = 25/73 (34.25%), Postives = 37/73 (50.68%), Query Frame = 0 Query: 1 IKTGSVDSEAFSPRYILYSISDK-----AYHPDYDSTTHENDIVI--LTTVFNMGPNINSIPVCLPQVSTHDF 66 ++ G D+E P Y D+ A HPDYDS + ND+V+ LT PNI +P+C+P+ D+ Sbjct: 466 LRVGEYDTENNFPE--PYKFQDRYVEIVAVHPDYDSFSFANDLVLLRLTEPVRFQPNI--VPICIPEDDDDDY 672
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Match: gi|592931437|gb|GAXK01027116.1| (TSA: Calanus finmarchicus comp18562_c1_seq1 transcribed RNA sequence) HSP 1 Score: 41.5874 bits (96), Expect = 1.165e-4 Identity = 20/45 (44.44%), Postives = 26/45 (57.78%), Query Frame = 0 Query: 27 PDYDSTTHENDIVILTTVFNMGPNINSIPVCLPQVSTHDFTDMPA 71 PDYD+T+ NDI +L ++ N N IP CLP T +TD A Sbjct: 488 PDYDTTSINNDIALLRLASDVEFNNNVIPACLPTDRTQQYTDYEA 622
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Match: gi|592931436|gb|GAXK01027117.1| (TSA: Calanus finmarchicus comp18562_c1_seq2 transcribed RNA sequence) HSP 1 Score: 41.2022 bits (95), Expect = 1.381e-4 Identity = 20/45 (44.44%), Postives = 26/45 (57.78%), Query Frame = 0 Query: 27 PDYDSTTHENDIVILTTVFNMGPNINSIPVCLPQVSTHDFTDMPA 71 PDYD+T+ NDI +L ++ N N IP CLP T +TD A Sbjct: 472 PDYDTTSINNDIALLRLASDVEFNNNVIPACLPTDRTQQYTDYEA 606
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Match: gi|592922300|gb|GAXK01036089.1| (TSA: Calanus finmarchicus comp108889_c0_seq2 transcribed RNA sequence) HSP 1 Score: 40.817 bits (94), Expect = 1.437e-4 Identity = 21/56 (37.50%), Postives = 31/56 (55.36%), Query Frame = 0 Query: 17 LYSISDKAYHPDYDSTTHENDIVILTTVFNMGPNINSIPVCLPQVSTHDFTDMPAT 72 ++ + KA HPDYDS T+E+D ILT + P+CLP S + D+ +T Sbjct: 645 VFDVCSKAEHPDYDSNTNEHDFAILTLCKPITFRKTVSPICLPTQSGASYDDVLST 812
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Match: gi|592816175|gb|GAXK01138393.1| (TSA: Calanus finmarchicus comp102651_c0_seq1 transcribed RNA sequence) HSP 1 Score: 38.891 bits (89), Expect = 9.861e-4 Identity = 17/45 (37.78%), Postives = 24/45 (53.33%), Query Frame = 0 Query: 18 YSISDKAYHPDYDSTTHENDIVILTTVFNMGPNINSIPVCLPQVS 62 + I K HPDY+ T +NDI ++ + + IPVCLP S Sbjct: 1212 FDIESKTVHPDYNPATFQNDIALIRLSKKVVYKEHIIPVCLPDAS 1346
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Match: gi|592949817|gb|GAXK01008736.1| (TSA: Calanus finmarchicus comp2504983_c0_seq1 transcribed RNA sequence) HSP 1 Score: 35.4242 bits (80), Expect = 3.503e-3 Identity = 17/52 (32.69%), Postives = 27/52 (51.92%), Query Frame = 0 Query: 18 YSISDKAYHPDYDSTTHENDIVILTTVFNMGPNINSIPVCLPQVSTHDFTDM 69 + + K HP+Y T+E+D ILT + + N P+CLP S + D+ Sbjct: 11 FDVCSKEEHPNYKPDTNEHDFAILTLCKPLAFSKNVSPICLPGQSGDSYDDV 166
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Match: gi|592780298|gb|GAXK01174270.1| (TSA: Calanus finmarchicus comp231606_c1_seq1 transcribed RNA sequence) HSP 1 Score: 36.5798 bits (83), Expect = 3.603e-3 Identity = 22/64 (34.38%), Postives = 29/64 (45.31%), Query Frame = 0 Query: 12 SPRYILYSISDKAYHPDYDSTTHEN---DIVILTTVFNMGPNINSIPVCLPQVSTHDFTDMPAT 72 + R I ++ HP YD TH N +V L T + N PVCLP+ +DF AT Sbjct: 602 TSRTIRTNVVQIVNHPKYDQGTHNNYDLSLVKLETKIDFTRTPNVRPVCLPKDDHNDFVGYKAT 793
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Match: gi|592801113|gb|GAXK01153455.1| (TSA: Calanus finmarchicus comp5336380_c0_seq1 transcribed RNA sequence) HSP 1 Score: 35.4242 bits (80), Expect = 4.106e-3 Identity = 22/53 (41.51%), Postives = 30/53 (56.60%), Query Frame = 0 Query: 8 SEAFSPRYILYSISDKAYHPDYDSTTHENDIVILTTVFNMGPNINSIPVCLPQ 60 +E + PR +L +S H YDS T +NDI +L + NI + PVCLPQ Sbjct: 211 NEEYLPRRVL-RVSLILLHYYYDSVTMQNDIALLKLAEVVDMNIYT-PVCLPQ 363
BLAST of EMLSAG00000000672 vs. L. salmonis peptides
Match: EMLSAP00000000672 (pep:novel supercontig:LSalAtl2s:LSalAtl2s11073:836:1279:-1 gene:EMLSAG00000000672 transcript:EMLSAT00000000672 description:"snap_masked-LSalAtl2s11073-processed-gene-0.0") HSP 1 Score: 153.68 bits (387), Expect = 6.649e-50 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0 Query: 1 IKTGSVDSEAFSPRYILYSISDKAYHPDYDSTTHENDIVILTTVFNMGPNINSIPVCLPQVSTHDFTDMPATCK 74 IKTGSVDSEAFSPRYILYSISDKAYHPDYDSTTHENDIVILTTVFNMGPNINSIPVCLPQVSTHDFTDMPATCK Sbjct: 1 IKTGSVDSEAFSPRYILYSISDKAYHPDYDSTTHENDIVILTTVFNMGPNINSIPVCLPQVSTHDFTDMPATCK 74
BLAST of EMLSAG00000000672 vs. L. salmonis peptides
Match: EMLSAP00000009899 (pep:novel supercontig:LSalAtl2s:LSalAtl2s645:169207:181410:1 gene:EMLSAG00000009899 transcript:EMLSAT00000009899 description:"maker-LSalAtl2s645-snap-gene-1.9") HSP 1 Score: 105.916 bits (263), Expect = 5.916e-29 Identity = 51/60 (85.00%), Postives = 53/60 (88.33%), Query Frame = 0 Query: 1 IKTGSVDSEAFSPRYILYSISDKAYHPDYDSTTHENDIVILTTVFNMGPNINSIPVCLPQ 60 IKTGS+DSEAFS RYILYSISDK YHP YDSTTH+NDIVILT FNM PNIN IPVCLPQ Sbjct: 334 IKTGSLDSEAFSTRYILYSISDKEYHPYYDSTTHQNDIVILTAEFNMVPNINLIPVCLPQ 393
BLAST of EMLSAG00000000672 vs. L. salmonis peptides
Match: EMLSAP00000002190 (pep:novel supercontig:LSalAtl2s:LSalAtl2s14046:94:441:1 gene:EMLSAG00000002190 transcript:EMLSAT00000002190 description:"maker-LSalAtl2s14046-snap-gene-0.3") HSP 1 Score: 76.2554 bits (186), Expect = 1.648e-19 Identity = 37/44 (84.09%), Postives = 39/44 (88.64%), Query Frame = 0 Query: 29 YDSTTHENDIVILTTVFNMGPNINSIPVCLPQVSTHDFTDMPAT 72 YDSTTHENDIVILT FN+ PNIN IPVCLPQVSTHDFT+M AT Sbjct: 1 YDSTTHENDIVILTAEFNIVPNINLIPVCLPQVSTHDFTNMLAT 44 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000672 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000672 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 3
BLAST of EMLSAG00000000672 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000672 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000672 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000672 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s11073:836..1279- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000672-683438 ID=EMLSAG00000000672-683438|Name=EMLSAG00000000672|organism=Lepeophtheirus salmonis|type=gene|length=444bp|location=Sequence derived from alignment at LSalAtl2s11073:836..1279- (Lepeophtheirus salmonis)back to top Add to Basket
|