EMLSAG00000001097, EMLSAG00000001097-683863 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001097 vs. GO
Match: - (symbol:mbd3a "methyl-CpG binding domain protein 3a" species:7955 "Danio rerio" [GO:0005634 "nucleus" evidence=IEA] [GO:0003677 "DNA binding" evidence=IEA] InterPro:IPR001739 InterPro:IPR016177 Pfam:PF01429 PROSITE:PS50982 SMART:SM00391 ZFIN:ZDB-GENE-030131-9077 GO:GO:0005634 GO:GO:0003677 SUPFAM:SSF54171 Gene3D:3.30.890.10 HOVERGEN:HBG052417 OrthoDB:EOG7QNVMV TreeFam:TF325032 InterPro:IPR025884 Pfam:PF14048 GeneTree:ENSGT00410000025376 KO:K11591 EMBL:CABZ01061879 EMBL:CU855938 EMBL:AY398379 RefSeq:NP_997934.1 UniGene:Dr.104630 STRING:7955.ENSDARP00000082941 Ensembl:ENSDART00000088508 Ensembl:ENSDART00000149508 GeneID:337133 KEGG:dre:337133 CTD:337133 OMA:SALPNGW NextBio:20812076 Uniprot:Q6TGX7) HSP 1 Score: 43.1282 bits (100), Expect = 5.268e-5 Identity = 22/66 (33.33%), Postives = 38/66 (57.58%), Query Frame = 0 Query: 8 RRDEVSNLPRRWCREEISR-----GNRTGVYYIAPTGVRVRNRNELGKVLAEHYDLTASDHFSEKI 68 +R E S LP W EE++R ++ VYY +PTG + R++ +L + L + DL++ D + K+ Sbjct: 4 KRWECSALPNGWKMEEVTRKSGLSAGKSDVYYFSPTGKKFRSKPQLVRYLGKSMDLSSFDFRTGKM 69
BLAST of EMLSAG00000001097 vs. C. finmarchicus
Match: gi|592850921|gb|GAXK01106623.1| (TSA: Calanus finmarchicus comp118638_c0_seq1 transcribed RNA sequence) HSP 1 Score: 55.0694 bits (131), Expect = 1.666e-9 Identity = 28/70 (40.00%), Postives = 40/70 (57.14%), Query Frame = 0 Query: 8 RRDEVSNLPRRWCREEISR-----GNRTGVYYIAPTGVRVRNRNELGKVLAEHYDLTASDHFSEKIHSXI 72 RR E LP+ W REE+ R + VYY P G +VR++ EL KVL + +DL+ D+ S +HS + Sbjct: 683 RRSECGALPKGWIREEVMRKGGLSAGKFDVYYYPPEGKKVRSKPELIKVLGDTFDLSCFDYSSGTMHSTL 892
BLAST of EMLSAG00000001097 vs. C. finmarchicus
Match: gi|592803746|gb|GAXK01150822.1| (TSA: Calanus finmarchicus comp154982_c0_seq1 transcribed RNA sequence) HSP 1 Score: 32.3426 bits (72), Expect = 1.094e-1 Identity = 18/43 (41.86%), Postives = 21/43 (48.84%), Query Frame = 0 Query: 11 EVSNLPRRWCREEISR-----GNRTGVYYIAPTGVRVRNRNEL 48 E LP W R+ R R V+ I PTG R R+RNEL Sbjct: 3829 EDETLPSGWHRKVSQRKSGASAGRYEVFIIGPTGKRFRSRNEL 3957
BLAST of EMLSAG00000001097 vs. C. finmarchicus
Match: gi|592929682|gb|GAXK01028863.1| (TSA: Calanus finmarchicus comp626038_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.510e+0 Identity = 12/26 (46.15%), Postives = 18/26 (69.23%), Query Frame = 0 Query: 27 GNRTGVYYIAPTGVRVRNRNELGKVL 52 G R V+Y+AP G R+RN +E+ + L Sbjct: 679 GGRRKVFYLAPCGRRLRNLDEVHRYL 756
BLAST of EMLSAG00000001097 vs. C. finmarchicus
Match: gi|592917938|gb|GAXK01040437.1| (TSA: Calanus finmarchicus comp146613_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 6.394e+0 Identity = 14/27 (51.85%), Postives = 16/27 (59.26%), Query Frame = 0 Query: 19 WCREEISRGNRTGVYYIAPTGVRVRNR 45 WC E RGN G +PTGVRV+ R Sbjct: 2197 WCFETGWRGNTKGKTRKSPTGVRVQWR 2277
BLAST of EMLSAG00000001097 vs. L. salmonis peptides
Match: EMLSAP00000001097 (pep:novel supercontig:LSalAtl2s:LSalAtl2s117:967131:967352:-1 gene:EMLSAG00000001097 transcript:EMLSAT00000001097 description:"augustus-LSalAtl2s117-processed-gene-9.3") HSP 1 Score: 150.214 bits (378), Expect = 1.226e-48 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0 Query: 1 MYGNEGVRRDEVSNLPRRWCREEISRGNRTGVYYIAPTGVRVRNRNELGKVLAEHYDLTASDHFSEKIHSXIQ 73 MYGNEGVRRDEVSNLPRRWCREEISRGNRTGVYYIAPTGVRVRNRNELGKVLAEHYDLTASDHFSEKIHSXIQ Sbjct: 1 MYGNEGVRRDEVSNLPRRWCREEISRGNRTGVYYIAPTGVRVRNRNELGKVLAEHYDLTASDHFSEKIHSXIQ 73
BLAST of EMLSAG00000001097 vs. L. salmonis peptides
Match: EMLSAP00000002677 (pep:novel supercontig:LSalAtl2s:LSalAtl2s154:562822:564714:-1 gene:EMLSAG00000002677 transcript:EMLSAT00000002677 description:"maker-LSalAtl2s154-augustus-gene-5.11") HSP 1 Score: 111.309 bits (277), Expect = 3.732e-31 Identity = 54/66 (81.82%), Postives = 57/66 (86.36%), Query Frame = 0 Query: 3 GNEGVRRDEVSNLPRRWCREEISRGNRTGVYYIAPTGVRVRNRNELGKVLAEHYDLTASDHFSEKI 68 GNEGVRR EVS LPR WCREEISRGNRT V+YI+P GVRVRNRNELGKVL EHYDLTA D+ S KI Sbjct: 16 GNEGVRRVEVSTLPRGWCREEISRGNRTDVHYISPLGVRVRNRNELGKVLGEHYDLTAFDYSSGKI 81
BLAST of EMLSAG00000001097 vs. nr
Match: gi|919087540|ref|XP_013380854.1| (PREDICTED: methyl-CpG-binding domain protein 2-like [Lingula anatina]) HSP 1 Score: 54.299 bits (129), Expect = 5.957e-7 Identity = 30/72 (41.67%), Postives = 43/72 (59.72%), Query Frame = 0 Query: 8 RRDEVSNLPRRWCREEISR-----GNRTGVYYIAPTGVRVRNRNELGKVLAEHYDLTASDHFSEKI-HSXIQ 73 RR + + LP W REE+ R +T VYYI+P G + R++ +L + L + YDLTA D + KI HS I+ Sbjct: 6 RRSDCTGLPSGWMREEVVRKSGLSAGKTDVYYISPDGRKFRSKPQLARHLGDLYDLTAFDFRTGKIVHSSIR 77
BLAST of EMLSAG00000001097 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold17_size721972-snap-gene-2.9 (protein:Tk09963 transcript:maker-scaffold17_size721972-snap-gene-2.9-mRNA-1 annotation:"methyl- binding transcription") HSP 1 Score: 53.5286 bits (127), Expect = 2.266e-10 Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 0 Query: 6 GVRRDEVSNLPRRWCREEISR--------GNRTG-------VYYIAPTGVRVRNRNELGKVLAEHYDLTASDHFSEKIH 69 G RR EV+ LP+ W REE R G + G V Y +P G ++++ EL K L EHYD+TA D S KI+ Sbjct: 59 GYRRSEVAGLPKGWIREESPRFPTHLHNGGFQNGSSQTPVDVVYYSPRGQVIKSKPELAKALGEHYDVTAFDFQSGKIN 137 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001097 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 1
BLAST of EMLSAG00000001097 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 4
BLAST of EMLSAG00000001097 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 2
BLAST of EMLSAG00000001097 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000001097 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000001097 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 1
BLAST of EMLSAG00000001097 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s117:967131..967352- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001097-683863 ID=EMLSAG00000001097-683863|Name=EMLSAG00000001097|organism=Lepeophtheirus salmonis|type=gene|length=222bp|location=Sequence derived from alignment at LSalAtl2s117:967131..967352- (Lepeophtheirus salmonis)back to top Add to Basket
|