EMLSAG00000001125, EMLSAG00000001125-683891 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001125 vs. C. finmarchicus
Match: gi|592892385|gb|GAXK01065990.1| (TSA: Calanus finmarchicus comp4260_c0_seq1 transcribed RNA sequence) HSP 1 Score: 34.2686 bits (77), Expect = 2.609e-2 Identity = 13/14 (92.86%), Postives = 13/14 (92.86%), Query Frame = 0 Query: 65 AGPNTKGSQFFICT 78 AGPNT GSQFFICT Sbjct: 470 AGPNTNGSQFFICT 511
BLAST of EMLSAG00000001125 vs. C. finmarchicus
Match: gi|592786337|gb|GAXK01168231.1| (TSA: Calanus finmarchicus comp366_c0_seq1 transcribed RNA sequence) HSP 1 Score: 33.4982 bits (75), Expect = 5.191e-2 Identity = 12/14 (85.71%), Postives = 13/14 (92.86%), Query Frame = 0 Query: 65 AGPNTKGSQFFICT 78 AGPNT GSQFF+CT Sbjct: 371 AGPNTNGSQFFLCT 412
BLAST of EMLSAG00000001125 vs. C. finmarchicus
Match: gi|592913989|gb|GAXK01044386.1| (TSA: Calanus finmarchicus comp5103297_c0_seq1 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 3.962e-1 Identity = 17/65 (26.15%), Postives = 31/65 (47.69%), Query Frame = 0 Query: 18 ITFQPDTQGKKFLFQKLVTFIVYYKASCVRWAILLIIIEEKTGCIDKAGPNTKGSQFFICTCVDI 82 I++ P G++FLFQK+ +++ +W + +I + C+ P T G I T + I Sbjct: 159 ISWAPIRDGRQFLFQKITECSAQFRSRITKWVTIFVITQISLLCVFPT-PMTPGPSVGILTLLII 350
BLAST of EMLSAG00000001125 vs. C. finmarchicus
Match: gi|592772893|gb|GAXK01181675.1| (TSA: Calanus finmarchicus comp128686_c0_seq1 transcribed RNA sequence) HSP 1 Score: 29.6462 bits (65), Expect = 9.784e-1 Identity = 11/14 (78.57%), Postives = 12/14 (85.71%), Query Frame = 0 Query: 65 AGPNTKGSQFFICT 78 AGPNT GSQFF+ T Sbjct: 461 AGPNTNGSQFFVST 502
BLAST of EMLSAG00000001125 vs. C. finmarchicus
Match: gi|592779060|gb|GAXK01175508.1| (TSA: Calanus finmarchicus comp3873_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 2.456e+0 Identity = 11/14 (78.57%), Postives = 12/14 (85.71%), Query Frame = 0 Query: 65 AGPNTKGSQFFICT 78 AGP+T GSQFFI T Sbjct: 385 AGPDTNGSQFFITT 426
BLAST of EMLSAG00000001125 vs. C. finmarchicus
Match: gi|592846881|gb|GAXK01110663.1| (TSA: Calanus finmarchicus comp3810942_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 2.472e+0 Identity = 11/16 (68.75%), Postives = 12/16 (75.00%), Query Frame = 0 Query: 64 KAGPNTKGSQFFICTC 79 AG NT GSQFF+CT Sbjct: 175 NAGANTNGSQFFLCTS 222
BLAST of EMLSAG00000001125 vs. C. finmarchicus
Match: gi|592954082|gb|GAXK01004471.1| (TSA: Calanus finmarchicus comp4880247_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 3.179e+0 Identity = 16/32 (50.00%), Postives = 19/32 (59.38%), Query Frame = 0 Query: 2 LDASFFELIHDFVKLR-ITFQPDTQGKKFLFQ 32 LD FFE +HD +KL I FQ D G + FQ Sbjct: 567 LDIRFFEFVHDLLKLAGIIFQRDKIGFRVCFQ 662
BLAST of EMLSAG00000001125 vs. C. finmarchicus
Match: gi|592931822|gb|GAXK01026731.1| (TSA: Calanus finmarchicus comp19391_c6_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 3.397e+0 Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 0 Query: 65 AGPNTKGSQFFI 76 AGPNT GSQFF+ Sbjct: 1879 AGPNTNGSQFFV 1914
BLAST of EMLSAG00000001125 vs. C. finmarchicus
Match: gi|592807163|gb|GAXK01147405.1| (TSA: Calanus finmarchicus comp42352_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 4.087e+0 Identity = 10/13 (76.92%), Postives = 11/13 (84.62%), Query Frame = 0 Query: 66 GPNTKGSQFFICT 78 GPNT GSQFF+ T Sbjct: 379 GPNTNGSQFFVLT 417
BLAST of EMLSAG00000001125 vs. C. finmarchicus
Match: gi|592942009|gb|GAXK01016544.1| (TSA: Calanus finmarchicus comp3599333_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 4.565e+0 Identity = 15/46 (32.61%), Postives = 25/46 (54.35%), Query Frame = 0 Query: 19 TFQPDTQGKKFLFQKLVTFIVYYKA---SCVRWAILLIIIEEKTGC 61 F D GK +LF K+ FI+ Y S + +A+++ +IE+ C Sbjct: 360 VFLHDF*GKLYLFGKITPFIINYSGYHLSFISFAVVIDMIEDVVNC 497
BLAST of EMLSAG00000001125 vs. L. salmonis peptides
Match: EMLSAP00000001125 (pep:novel supercontig:LSalAtl2s:LSalAtl2s118:191854:192176:1 gene:EMLSAG00000001125 transcript:EMLSAT00000001125 description:"maker-LSalAtl2s118-snap-gene-2.2") HSP 1 Score: 177.563 bits (449), Expect = 5.488e-59 Identity = 86/86 (100.00%), Postives = 86/86 (100.00%), Query Frame = 0 Query: 1 MLDASFFELIHDFVKLRITFQPDTQGKKFLFQKLVTFIVYYKASCVRWAILLIIIEEKTGCIDKAGPNTKGSQFFICTCVDILNSY 86 MLDASFFELIHDFVKLRITFQPDTQGKKFLFQKLVTFIVYYKASCVRWAILLIIIEEKTGCIDKAGPNTKGSQFFICTCVDILNSY Sbjct: 1 MLDASFFELIHDFVKLRITFQPDTQGKKFLFQKLVTFIVYYKASCVRWAILLIIIEEKTGCIDKAGPNTKGSQFFICTCVDILNSY 86 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001125 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000001125 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 13
Pagesback to top
BLAST of EMLSAG00000001125 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000001125 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000001125 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000001125 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000001125 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s118:191854..192176+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001125-683891 ID=EMLSAG00000001125-683891|Name=EMLSAG00000001125|organism=Lepeophtheirus salmonis|type=gene|length=323bp|location=Sequence derived from alignment at LSalAtl2s118:191854..192176+ (Lepeophtheirus salmonis)back to top Add to Basket
|