EMLSAG00000001150, EMLSAG00000001150-683916 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000001150
Unique NameEMLSAG00000001150-683916
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000001150 vs. GO
Match: - (symbol:spo "spook" species:7227 "Drosophila melanogaster" [GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS] [GO:0009055 "electron carrier activity" evidence=ISS;NAS] [GO:0016020 "membrane" evidence=NAS] [GO:0008258 "head involution" evidence=IMP] [GO:0007494 "midgut development" evidence=IMP] [GO:0007417 "central nervous system development" evidence=IMP] [GO:0007391 "dorsal closure" evidence=IMP] [GO:0005506 "iron ion binding" evidence=IEA] [GO:0020037 "heme binding" evidence=ISM;IEA] [GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0042335 "cuticle development" evidence=IMP] [GO:0006697 "ecdysone biosynthetic process" evidence=IMP] [GO:0048566 "embryonic digestive tract development" evidence=IMP] [GO:0001700 "embryonic development via the syncytial blastoderm" evidence=IMP] [GO:0048477 "oogenesis" evidence=IMP] [GO:0016491 "oxidoreductase activity" evidence=ISM] [GO:0005783 "endoplasmic reticulum" evidence=IDA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PROSITE:PS00086 GO:GO:0005783 EMBL:AE014296 GO:GO:0005789 GO:GO:0005506 GO:GO:0007391 GO:GO:0004497 GO:GO:0016491 GO:GO:0048477 GO:GO:0007417 GO:GO:0042335 eggNOG:COG2124 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0007494 GO:GO:0048566 GO:GO:0016705 GO:GO:0008258 GeneTree:ENSGT00720000108651 GO:GO:0006697 EMBL:AF484415 EMBL:AY071053 RefSeq:NP_647975.2 UniGene:Dm.31174 ProteinModelPortal:Q9VRM7 SMR:Q9VRM7 BioGrid:64094 DIP:DIP-17643N IntAct:Q9VRM7 MINT:MINT-280396 PaxDb:Q9VRM7 EnsemblMetazoa:FBtr0077130 GeneID:38631 KEGG:dme:Dmel_CG10594 UCSC:CG10594-RA CTD:38631 FlyBase:FBgn0003486 InParanoid:Q9VRM7 KO:K14939 OrthoDB:EOG70087V PhylomeDB:Q9VRM7 GenomeRNAi:38631 NextBio:809614 Bgee:Q9VRM7 Uniprot:Q9VRM7)

HSP 1 Score: 246.899 bits (629), Expect = 2.187e-73
Identity = 160/474 (33.76%), Postives = 243/474 (51.27%), Query Frame = 0
Query:   18 PGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQF-NMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKF---IRSFVENKILLNQKF-------DDDFLNT-----YQRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF-----QALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFID------------TETGFLS----------IPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKN-MEISLPPGMLA 437
            PGP  WP+IG+LHLL  Y   PF  FT L + YGDI+S+  G   C+VVN  EL +EVL       S RP+F R+           +A CD S LQ++RR L ++   P+  S    ++ ++  EE+ H   +  N       I++K  I KA AN+F +Y CS+  F YDD  F   +  +D IFWE+N G  +DF PW      F Q+ LN    +   IR F+  +I+ +++        D DF +       +  + ++  I+F LED IGGHSAV N+++ +L +I ++ DI + +Q+EI        +++   +   M    A  +E +R + SPI+PH +  DT I  Y V   T++FINN+ LN S   W  P  +NP RF++            +++G  S          IP HF PFSIG+R+C+G  L +      V ++++  ++S  N   I + P  LA
Sbjct:   56 PGPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLVPGEPINIKPLILKACANMFSQYMCSLR-FDYDDVDFQQIVQYFDEIFWEINQGHPLDFLPW---LYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDALLKSLLEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLRYSSSPIVPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIP-HFLPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNISSHNPSTIKISPESLA 524          
BLAST of EMLSAG00000001150 vs. GO
Match: - (symbol:spok "spookier" species:7227 "Drosophila melanogaster" [GO:0005575 "cellular_component" evidence=ND] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0005506 "iron ion binding" evidence=IEA] [GO:0020037 "heme binding" evidence=ISM;IEA] [GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA] [GO:0007591 "molting cycle, chitin-based cuticle" evidence=IMP] [GO:0006697 "ecdysone biosynthetic process" evidence=IMP] [GO:0016491 "oxidoreductase activity" evidence=ISM] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00463 PROSITE:PS00086 GO:GO:0005506 GO:GO:0004497 GO:GO:0016491 eggNOG:COG2124 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0007591 GO:GO:0016705 GeneTree:ENSGT00720000108651 GO:GO:0006697 KO:K14939 OrthoDB:EOG70087V EMBL:CM000459 RefSeq:NP_001104460.2 UniGene:Dm.29332 ProteinModelPortal:A8Y592 SMR:A8Y592 STRING:7227.FBpp0289444 PaxDb:A8Y592 EnsemblMetazoa:FBtr0300207 GeneID:5740359 KEGG:dme:Dmel_CG41624 CTD:5740359 FlyBase:FBgn0086917 InParanoid:A8Y592 PhylomeDB:A8Y592 GenomeRNAi:5740359 NextBio:20891398 Bgee:A8Y592 Uniprot:A8Y592)

HSP 1 Score: 228.794 bits (582), Expect = 1.766e-66
Identity = 149/479 (31.11%), Postives = 233/479 (48.64%), Query Frame = 0
Query:   18 PGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFV--------ENKILLNQ---KFDDDFLNTYQRIEKN--KELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKETRNMVLLN--------ACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDT------ETGF------------------------------------LSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLS 423
            PGP  WP+IG+++LL  ++  PF  F  L K YGDI+S+ +G   C+VVN  +L KEVL     +F  RP+F R+           +A CD S LQ++RR L ++   P+  S    ++  +   E+N ++ Q     +    D+K  I  A+AN+F +Y CS+  F+Y DK F   I  +D IFWE+N G   D+ PW   F       +      IR F+        E+ I +N+    F D  L + +  +KN  +  I+F LED IGGHSAV N+++  L +I ++  I   ++ E+    A   K  R + L +        A   E +R + SPI+PH +  DT I  + V+  T++FINN+ LN S S W  P  ++P+RF++       E+G                                      SIP  F PFS+G+R+C+G  L +      +A+I++  +++
Sbjct:   52 PGPHPWPIIGNINLLGRFQYNPFYGFGTLTKKYGDIYSLSLGHTRCIVVNNVDLIKEVLNKNGKYFGGRPDFFRYHKLFGGDRNNSLALCDWSQLQQKRRNLARRHCSPRESSSYFSKMSEIGGLEVNQLLDQLTNISSGYPCDVKPLILAASANMFCQYMCSVR-FNYSDKGFQKIIEYFDEIFWEINQGYSFDYIPWLVPFYCNHISRIVHWSASIRKFILERIVNHRESNININEPDKDFTDALLKSLKE-DKNVSRNTIIFMLEDFIGGHSAVGNLVMLALAYIAKNPTIALHIRNEVDTVSA---KGIRRICLYDMNVMPYTMASISEVLRYSSSPIVPHVAMEDTVIKGFGVRKGTIVFINNYVLNMSESFWNHPEQFDPERFLENNFTNNKESGLKCDDNKRTEFIRKNDNDGSTKSKKYGKQNLNNKLLKKSIP-QFLPFSVGKRTCIGQSLVRGFGFLLLANIIQNYNVN 524          
BLAST of EMLSAG00000001150 vs. GO
Match: - (symbol:CYP17A1 "Steroid 17-alpha-hydroxylase/17,20 lyase" species:9606 "Homo sapiens" [GO:0004508 "steroid 17-alpha-monooxygenase activity" evidence=IDA] [GO:0005506 "iron ion binding" evidence=IEA] [GO:0005739 "mitochondrion" evidence=IEA] [GO:0005783 "endoplasmic reticulum" evidence=NAS] [GO:0005789 "endoplasmic reticulum membrane" evidence=TAS] [GO:0006694 "steroid biosynthetic process" evidence=TAS] [GO:0006702 "androgen biosynthetic process" evidence=TAS] [GO:0006704 "glucocorticoid biosynthetic process" evidence=TAS] [GO:0006805 "xenobiotic metabolic process" evidence=TAS] [GO:0007548 "sex differentiation" evidence=TAS] [GO:0008202 "steroid metabolic process" evidence=IDA;TAS] [GO:0009635 "response to herbicide" evidence=IEA] [GO:0010034 "response to acetate" evidence=IEA] [GO:0010212 "response to ionizing radiation" evidence=IEA] [GO:0016125 "sterol metabolic process" evidence=TAS] [GO:0017085 "response to insecticide" evidence=IEA] [GO:0018879 "biphenyl metabolic process" evidence=IEA] [GO:0018894 "dibenzo-p-dioxin metabolic process" evidence=IEA] [GO:0018958 "phenol-containing compound metabolic process" evidence=IEA] [GO:0018963 "phthalate metabolic process" evidence=IEA] [GO:0019825 "oxygen binding" evidence=TAS] [GO:0020037 "heme binding" evidence=IDA] [GO:0021766 "hippocampus development" evidence=IEA] [GO:0030325 "adrenal gland development" evidence=IEA] [GO:0030424 "axon" evidence=IEA] [GO:0030728 "ovulation" evidence=IEA] [GO:0031667 "response to nutrient levels" evidence=IEA] [GO:0032526 "response to retinoic acid" evidence=IEA] [GO:0033327 "Leydig cell differentiation" evidence=IEA] [GO:0034097 "response to cytokine" evidence=IEA] [GO:0042446 "hormone biosynthetic process" evidence=IDA] [GO:0042448 "progesterone metabolic process" evidence=IDA] [GO:0042493 "response to drug" evidence=IEA] [GO:0043025 "neuronal cell body" evidence=IEA] [GO:0044281 "small molecule metabolic process" evidence=TAS] [GO:0047442 "17-alpha-hydroxyprogesterone aldolase activity" evidence=IEA] [GO:0048545 "response to steroid hormone" evidence=IEA] [GO:0051591 "response to cAMP" evidence=IEA] [GO:0051597 "response to methylmercury" evidence=IEA] [GO:0060992 "response to fungicide" evidence=IEA] [GO:0071222 "cellular response to lipopolysaccharide" evidence=IEA] [GO:0071236 "cellular response to antibiotic" evidence=IEA] [GO:0071371 "cellular response to gonadotropin stimulus" evidence=IEA] [GO:0090031 "positive regulation of steroid hormone biosynthetic process" evidence=IEA] Reactome:REACT_111217 InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PROSITE:PS00086 UniPathway:UPA00062 GO:GO:0005739 GO:GO:0021766 GO:GO:0030424 DrugBank:DB00157 Reactome:REACT_15493 GO:GO:0006702 GO:GO:0006704 GO:GO:0005789 GO:GO:0030325 GO:GO:0018879 GO:GO:0071236 GO:GO:0018894 GO:GO:0033327 GO:GO:0030728 GO:GO:0018958 GO:GO:0042493 GO:GO:0060992 GO:GO:0009635 GO:GO:0042448 GO:GO:0005506 GO:GO:0019825 GO:GO:0043025 GO:GO:0034097 eggNOG:COG2124 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0071222 GO:GO:0048545 GO:GO:0010212 GO:GO:0010034 GO:GO:0032526 GO:GO:0031667 GO:GO:0017085 GO:GO:0006805 Orphanet:90796 GO:GO:0051591 GO:GO:0007548 GO:GO:0051597 GO:GO:0016125 EMBL:AL358790 OrthoDB:EOG7RBZ85 DrugBank:DB00396 GO:GO:0018963 HOVERGEN:HBG106944 GO:GO:0047442 GO:GO:0004508 CTD:1586 HOGENOM:HOG000036991 KO:K00512 TreeFam:TF105095 EMBL:M14564 EMBL:M19489 EMBL:M63871 EMBL:M31153 EMBL:M31146 EMBL:M31147 EMBL:M31148 EMBL:M31149 EMBL:M31150 EMBL:M31151 EMBL:M31152 EMBL:BT020000 EMBL:BC062997 EMBL:BC063388 PIR:A40921 RefSeq:NP_000093.1 UniGene:Hs.438016 PDB:2C17 PDB:3RUK PDB:3SWZ PDBsum:2C17 PDBsum:3RUK PDBsum:3SWZ ProteinModelPortal:P05093 SMR:P05093 BioGrid:107958 IntAct:P05093 STRING:9606.ENSP00000358903 BindingDB:P05093 ChEMBL:CHEMBL3522 GuidetoPHARMACOLOGY:1361 PhosphoSite:P05093 DMDM:117283 PaxDb:P05093 PRIDE:P05093 DNASU:1586 Ensembl:ENST00000369887 GeneID:1586 KEGG:hsa:1586 UCSC:uc001kwg.3 GeneCards:GC10M104580 HGNC:HGNC:2593 HPA:HPA048533 MIM:202110 MIM:609300 neXtProt:NX_P05093 Orphanet:90793 PharmGKB:PA27090 InParanoid:P05093 OMA:QELFLIM PhylomeDB:P05093 BioCyc:MetaCyc:HS07560-MONOMER SABIO-RK:P05093 ChiTaRS:CYP17A1 GeneWiki:CYP17A1 GenomeRNAi:1586 NextBio:6519 PRO:PR:P05093 ArrayExpress:P05093 Bgee:P05093 CleanEx:HS_CYP17A1 Genevestigator:P05093 GO:GO:0071371 GO:GO:0090031 Uniprot:P05093)

HSP 1 Score: 151.754 bits (382), Expect = 7.832e-39
Identity = 137/454 (30.18%), Postives = 214/454 (47.14%), Query Frame = 0
Query:   16 YPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNF--------HRFPVAFCDS-SFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQE--ELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLN--QKFDDD----FLNTYQRIEKNKE----------------LILFALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKET-----RN-MVLLNACFYETVRLT-CSP-IIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFID-TETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKN 426
            YP      PL+GSL  L  +  +    F KL+K YG I+S+R+G+   V+V  ++L KEVL+ K   FS RP          +R  +AF DS +  Q  RR  +  F + K     L+++  +CQE   L  M+   N      +ID+   +  A  NV I   C   S+   D   N      + I   ++   L+D  PW  +F     + L SH K IR+ + NKIL N  +KF  D     L+T  + + N +                 IL  + D+ G G    T+V+   L  +L +  +KK+L +EI   Q + F  T     RN ++LL A   E +RL   +P +IPH++  D+SIG + V   T + IN   L+++   W++P  + P+RF++   T  +S    + PF  G RSC+G  L +      +A +L+  DL + +
Sbjct:   27 YPKSLLSLPLVGSLPFLPRHGHM-HNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKI--ICQEISTLCDMLATHNG----QSIDISFPVFVAVTNV-ISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVK-IRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEID--QNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPD 469          
BLAST of EMLSAG00000001150 vs. GO
Match: - (symbol:CYP17A1 "Steroid 17-alpha-hydroxylase/17,20 lyase" species:9598 "Pan troglodytes" [GO:0004508 "steroid 17-alpha-monooxygenase activity" evidence=ISS] [GO:0008202 "steroid metabolic process" evidence=ISS] [GO:0020037 "heme binding" evidence=ISS] [GO:0042446 "hormone biosynthetic process" evidence=ISS] [GO:0042448 "progesterone metabolic process" evidence=ISS] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PROSITE:PS00086 UniPathway:UPA00062 GO:GO:0016020 GO:GO:0006694 GO:GO:0042448 GO:GO:0005506 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0042446 HOVERGEN:HBG106944 GO:GO:0047442 GO:GO:0004508 CTD:1586 KO:K00512 EMBL:AF458330 RefSeq:NP_001009052.1 UniGene:Ptr.6525 ProteinModelPortal:Q8HYN1 GeneID:450141 KEGG:ptr:450141 NextBio:20833104 Uniprot:Q8HYN1)

HSP 1 Score: 151.369 bits (381), Expect = 9.830e-39
Identity = 137/454 (30.18%), Postives = 214/454 (47.14%), Query Frame = 0
Query:   16 YPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNF--------HRFPVAFCDS-SFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQE--ELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLN--QKFDDD----FLNTYQRIEKNKE----------------LILFALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKET-----RN-MVLLNACFYETVRLT-CSP-IIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFID-TETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKN 426
            YP      PL+GSL  L  +  +    F KL+K YG I+S+R+G+   V+V  ++L KEVL+ K   FS RP          +R  +AF DS +  Q  RR  +  F + K     L+++  +CQE   L  M+   N      +ID+   +  A  NV I   C   S+   D   N      + I   ++   L+D  PW  +F     + L SH K IR+ + NKIL N  +KF  D     L+T  + + N +                 IL  + D+ G G    T+V+   L  +L +  +KK+L +EI   Q + F  T     RN ++LL A   E +RL   +P +IPH++  D+SIG + V   T + IN   L+++   W++P  + P+RF++   T  +S    + PF  G RSC+G  L +      +A +L+  DL + +
Sbjct:   27 YPKSLLSLPLVGSLPFLPRHGHM-HNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKI--ICQEISTLCDMLATHNG----QSIDISFPVFVAVTNV-ISLICFNTSYKNGDPELNIIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVK-IRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEID--QNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTQVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPD 469          
BLAST of EMLSAG00000001150 vs. GO
Match: - (symbol:cyp1b1 "cytochrome P450, family 1, subfamily B, polypeptide 1" species:7955 "Danio rerio" [GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0005506 "iron ion binding" evidence=IEA] [GO:0016712 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen" evidence=IEA] [GO:0005575 "cellular_component" evidence=ND] [GO:0016491 "oxidoreductase activity" evidence=IEA] [GO:0004497 "monooxygenase activity" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR008066 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PRINTS:PR01683 PROSITE:PS00086 ZFIN:ZDB-GENE-030902-1 GO:GO:0005506 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0016712 HOVERGEN:HBG106944 EMBL:BC162380 EMBL:AY534681 UniGene:Dr.151870 UniGene:Dr.85241 InParanoid:Q5GH26 Uniprot:Q5GH26)

HSP 1 Score: 146.747 bits (369), Expect = 4.031e-37
Identity = 116/430 (26.98%), Postives = 209/430 (48.60%), Query Frame = 0
Query:   18 PGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF-------PVAFCDSSFLQEERRKL----IKKFTIPKSHSLSLDRLDRLCQEELNHMILQF-NMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQ------QPLNSH-CKFIRSFV-ENKILLNQKFDDDFLNTY-----------QRIEKNKELILFALEDLIGGHSAVTNVILR-ILVHILEHGDIKKELQKEIQPF----QALTFKETRNMVLLNACFYETVRLTC-SPI-IPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLS--IPAHFQPFSIGRRSCVGYKLTQL 407
            PGPF WP+IG+   L N    P   F+++ + YGD+F I++GS N VV+NG+ + KE L+ KA  F+ RP+F  F        +AF + +   +  RK+    ++ F+   ++  +    ++    E+  +I  F N  +          +  + AN  +   C  + ++YDD  F   +   D     V  G ++D  PW   F   ++      + LN   C FI   V E++  ++     D  + +             +  +KE +   + D+ G      +  L+ I++ ++ + +I+K LQ+++       +  T  +  ++  L A  YE +R T  +P+ IPH + +DTSI  Y +  DTVIF+N   LN+ P+ W +P  +NP+RF+D E G L+  +  +   FS+G+R C+G  ++++
Sbjct:   38 PGPFSWPVIGNAAQLGN---TPHFYFSRMAQKYGDVFQIKLGSRNVVVLNGDAI-KEALVKKATDFAGRPDFASFRFVSNGKSMAFGNYTPWWKLHRKVAQSTVRNFST--ANIQTKQTFEKHIVSEIGELIRLFLNKSREQQFFQPHRYLVVSVANT-MSAVCFGNRYAYDDAEFQQVVGRNDQFTKTVGAGSMVDVMPWMQYFPNPIRTLFDQFKELNKEFCAFIELKVSEHRKTISPSHVRDMTDAFIVALDKGLSGGSGVSLDKEFVPPTISDIFGASQDTLSTALQWIILLLVRYPEIQKRLQEDVDRVVDRSRLPTIADQPHLPYLMAFIYEVMRFTSFTPLTIPHSTTKDTSINGYPIPKDTVIFVNQWSLNHDPTKWDQPEVFNPQRFLD-EDGSLNKDLTTNVLIFSLGKRRCIGEDVSKI 459          
BLAST of EMLSAG00000001150 vs. GO
Match: - (symbol:CYP17A1 "Steroid 17-alpha-hydroxylase/17,20 lyase" species:10036 "Mesocricetus auratus" [GO:0004508 "steroid 17-alpha-monooxygenase activity" evidence=ISS] [GO:0008202 "steroid metabolic process" evidence=ISS] [GO:0020037 "heme binding" evidence=ISS] [GO:0042446 "hormone biosynthetic process" evidence=ISS] [GO:0042448 "progesterone metabolic process" evidence=ISS] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PROSITE:PS00086 UniPathway:UPA00062 GO:GO:0016020 GO:GO:0006694 GO:GO:0042448 GO:GO:0005506 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0042446 HOVERGEN:HBG106944 GO:GO:0047442 GO:GO:0004508 CTD:1586 EMBL:U66494 RefSeq:NP_001268860.1 PDB:1JO9 PDBsum:1JO9 ProteinModelPortal:P70687 GeneID:101831170 Uniprot:P70687)

HSP 1 Score: 146.362 bits (368), Expect = 5.060e-37
Identity = 124/444 (27.93%), Postives = 208/444 (46.85%), Query Frame = 0
Query:   24 PLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF--------PVAFCDSSFLQEERRKL-IKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKIL--LNQKFDDDFL-----------------NTYQRIEKNK---ELILFALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQP----FQALTFKETRNMVLLNACFYETVRL--TCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPA-HFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNME 428
            PL+GSL  +  +   P   F KL++ YG I+S+R+GS   V++   +L KEVL+ K   FS RP+             +AF DS    +  RKL +  F + +  +  L+++  +CQ+  +  +  F +  N  +IDL   I  +  N+ I   C   S+   D +  +     + I   + N  L+D FPW ++F       +  + K IR  V + IL    +KF+ D +                 NT +    N      IL  + D+ G G     +V+  I+  +L + ++KK++QKEI       +  TF +  ++++L A   E +R+      +IPHR+  D SIG + +   T + IN   L++S   W +P  + P+RF+D     L  P+  + PF  G RSC+G  L +      +AH+L+  DL + + E
Sbjct:   35 PLVGSLPFIPRHGH-PHVNFFKLQEKYGPIYSLRLGSTTTVIIGQYQLAKEVLVKKGKEFSGRPHMVTLGLLSDQGKGIAFADSGGSWQLHRKLALSSFALFRDGNQKLEKI--ICQKASS--LCDFLLTHNEESIDLSEPIFNSITNI-ICIICFGISYENRDPILATIKSFTEGILNSLGNDHLVDIFPWLTIFPNKTVDMIKKNVK-IRDEVLSGILEKCKEKFNSDSISSLMDLLIQAKTNADNNNTSEGQGSNAFSDMHILATIADIFGAGIETTASVLSWIIAFLLHNPEVKKKIQKEIDQNIGFSRTPTFNDRNHLLMLEATIREVLRIRPVAPMLIPHRANSDMSIGEFSIPKFTPVIINLWALHHSEKEWDQPDRFMPERFLDPTGSHLITPSLSYLPFGAGARSCIGEVLARQELFLFMAHLLQRFDLDVPDDE 471          
BLAST of EMLSAG00000001150 vs. GO
Match: - (symbol:LOC424944 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0004497 "monooxygenase activity" evidence=IEA] [GO:0005506 "iron ion binding" evidence=IEA] [GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PROSITE:PS00086 GO:GO:0005506 GO:GO:0004497 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0016705 OrthoDB:EOG7RBZ85 TreeFam:TF352043 GeneTree:ENSGT00730000110385 EMBL:AADN03005794 Ensembl:ENSGALT00000013480 OMA:MHEREKA Uniprot:F1P1T3)

HSP 1 Score: 145.591 bits (366), Expect = 9.565e-37
Identity = 111/428 (25.93%), Postives = 214/428 (50.00%), Query Frame = 0
Query:   17 PPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRP--NFHRFPVA----FCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSI---HSFSYDDKLFNS------FILSYDAIFWEVNNGRLMDFFPW-TSLFAGFVQQPLNSHCKFIRSFVENKILLNQKFD----DDFLNTY-QRIEKNKE----------LILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEI----QPFQALTFKETRNMVLLNACFYETVRLT--CSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQL 407
            PPGP   P+IG+L LL    K+  E   KL  IYG+I+++ +G    VV+NG +  K+ ++  ++  S RP   F+R  +     F  S    +++R+     TI +S     + L+   Q E +H++  F   K     + ++ I  A AN+     C++   H FS +D+ F+       F++ + A  W    GR+ D FPW    F G   Q + ++  F+ + V N+I ++++       D ++ Y  +I K K+          ++   ++ L+GG    +  +L  L++++++ +I++ +Q+EI    +P   +++++ + +   NA  +ET+R +   S  +P    R+T++  + +K  T++  N H + Y    W  P  ++P  F+D +  F++  A F PFS G R C+G ++ ++
Sbjct:   42 PPGPVPLPIIGNLWLLDF--KLRRETLAKLTNIYGNIYTVWMGQTPVVVLNGYKAVKDAIVTHSEETSGRPLTPFYRDMMGEKGIFLTSGHTWKQQRRF--GMTIIRSLGFGKNNLEHQIQTEASHLLHIFANTKG-RPFNPRTSIVHAIANI----ICAVVFGHRFSSEDESFSKLIKAVYFVIYFQATIW----GRMYDAFPWLMHRFPG-PHQKVFAYNNFMHNLVMNEIQMHEREKAGDPQDLIDFYLTQIAKTKDDPTSTFNKDNMVQTVVDLLLGGTETTSTTLLWALLYMVQYPEIQERVQREIEAVLEPSHVISYEDRKRLPYTNAVIHETLRYSNITSVGVPRLCVRNTTLLGFHIKKGTLVLPNLHSVVYDSDHWATPCKFDPNHFLDVDGNFVNKEA-FLPFSAGHRVCLGEQMARV 454          
BLAST of EMLSAG00000001150 vs. GO
Match: - (symbol:Cyp17a1 "Steroid 17-alpha-hydroxylase/17,20 lyase" species:10041 "Peromyscus leucopus" [GO:0004508 "steroid 17-alpha-monooxygenase activity" evidence=ISS] [GO:0008202 "steroid metabolic process" evidence=ISS] [GO:0020037 "heme binding" evidence=ISS] [GO:0042446 "hormone biosynthetic process" evidence=ISS] [GO:0042448 "progesterone metabolic process" evidence=ISS] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PROSITE:PS00086 UniPathway:UPA00062 GO:GO:0016020 GO:GO:0006694 GO:GO:0042448 GO:GO:0005506 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0042446 HOVERGEN:HBG106944 GO:GO:0047442 GO:GO:0004508 EMBL:AY054747 ProteinModelPortal:Q91Z85 Uniprot:Q91Z85)

HSP 1 Score: 145.206 bits (365), Expect = 1.235e-36
Identity = 115/444 (25.90%), Postives = 209/444 (47.07%), Query Frame = 0
Query:   24 PLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRFP--------VAFCDSSFLQEERRKL-IKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLN------QKFDDDFLNTYQRIEKNKEL------------------ILFALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQP----FQALTFKETRNMVLLNACFYETVRL--TCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPA-HFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKN 426
            PL+GSL  L  +  +    F KL++ YG I+S+R+G+   V++   +L +EVL+ K   FS RP              +AF DS    +  RKL +  F + +     L+ +  +CQE  +  +    +  N  ++DL   I  +  N+ I   C   S+   D +  +     + I   ++N  L+D FPW ++F     + +  H K     V +++L++      +KF++D ++    I    ++                  IL  + D  G G    T+V+  I+  +L + ++KK++QKEI       +  TF +  ++++L A   E +R+      +IPH++  D+SIG + +  DT + IN   L+++   W +P  + P+RF+D     L  P+  + PF  G R+C+G  L + +    VA +L+  DL + +
Sbjct:   35 PLVGSLPFLPRHGHMHVNFF-KLQEKYGPIYSLRLGTIPTVIIGQYQLAREVLIKKGKEFSGRPQMVTLGLLSNQGKGIAFADSDDAWQLHRKLALSSFALFRDGDQRLETI--ICQEASS--LCDLLLTHNEESVDLSQPIFMSVTNI-ICAICFSTSYENRDPILTTIQTFTEGILNCLDNENLVDIFPWLTIFPNKTLEKIKRHVK-----VRDEVLIDMLEKCKEKFNNDSISNLTDILIQAKMNADNNNTTDHQGSFSDSHILSTVGDFFGAGIETTTSVLCWIVAFLLHNPEVKKKIQKEIDQNIGFSRTPTFNDRNHLLMLEATIREVLRIRPVAPMLIPHKANIDSSIGEFTIPKDTHVVINLWALHHNEKEWDQPDRFMPERFLDATGSHLITPSLSYLPFGAGPRACIGEVLARQVLFLYVACLLQRFDLDVPD 467          
BLAST of EMLSAG00000001150 vs. GO
Match: - (symbol:cyp1c1 "cytochrome P450, family 1, subfamily C, polypeptide 1" species:7955 "Danio rerio" [GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0005506 "iron ion binding" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0016491 "oxidoreductase activity" evidence=IEA] [GO:0004497 "monooxygenase activity" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PROSITE:PS00086 ZFIN:ZDB-GENE-050522-501 GO:GO:0005506 GO:GO:0004497 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0016705 HOVERGEN:HBG106944 EMBL:DQ007044 UniGene:Dr.83194 ProteinModelPortal:Q4ZIL6 InParanoid:Q4ZIL6 Uniprot:Q4ZIL6)

HSP 1 Score: 140.969 bits (354), Expect = 3.443e-35
Identity = 115/426 (27.00%), Postives = 203/426 (47.65%), Query Frame = 0
Query:   18 PGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF-------PVAFCDSSFLQEERRKL----IKKFTIPKSHSLSLDRLDRLCQEELNHMILQF-NMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQ---QPLNSHCKFIRSFVENKILLNQK-FDDDFLNTYQR-----IEKNKELILF------ALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQPFQAL----TFKETRNMVLLNACFYETVRLTC-SPI-IPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLS--IPAHFQPFSIGRRSCVGYKLTQL 407
            PGPF WPL+G+   L +   +P   F+KL K YG+++ IR+G  + VV+NG+   ++ L+  +  F+ RPN   F        + F + S   +  RK+    ++ F++  S +      ++    E   ++ +F  +  +  + +     + A ANV I   C    + +DD  F + +   +     V  G L+D  PW   F   V+   Q   +  K   ++V++K+L ++  +D D            IE  KE  L        + DLIG G   V+  +  +L+ ++++  I+ +LQ++I          + ++  N+  L+A  YET+R T   P+ IPH +  D +I       DTV+FIN   +N+ P  W +P  +NP RF+D E G L+  +      FS G+R C+G ++ ++
Sbjct:   50 PGPFAWPLVGNAMQLGH---MPHITFSKLAKKYGNVYQIRLGCSDIVVLNGDAAIRKALVQHSTEFAGRPNLVSFQMISGGRSLTFTNYSKQWKTHRKVAQSTLRAFSMANSQTRKT--FEQHVVGEAMDLVQKFLRLSADGRHFNPAHEATVAAANV-ICALCFGKRYGHDDPEFRTLLGRVNKFGETVGAGSLVDVMPWLQSFPNPVRSVYQNFKTINKEFFNYVKDKVLQHRDTYDPDVTRDISDAIIGVIEHGKESTLTKDFVESTVTDLIGAGQDTVSTAMQWMLLLLVKYPSIQSKLQEQIDKVVGRDRLPSIEDRCNLAYLDAFIYETMRFTSFVPVTIPHSTTSDVTIEGLHTPKDTVVFINQWSVNHDPQKWSDPHIFNPSRFLD-ENGALNKDLTNSVMIFSTGKRRCIGEQIAKV 468          
BLAST of EMLSAG00000001150 vs. GO
Match: - (symbol:CYP17A1 "Steroid 17-alpha-hydroxylase/17,20 lyase" species:9940 "Ovis aries" [GO:0004508 "steroid 17-alpha-monooxygenase activity" evidence=ISS] [GO:0008202 "steroid metabolic process" evidence=ISS] [GO:0020037 "heme binding" evidence=ISS] [GO:0042446 "hormone biosynthetic process" evidence=ISS] [GO:0042448 "progesterone metabolic process" evidence=ISS] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PROSITE:PS00086 UniPathway:UPA00062 GO:GO:0016020 GO:GO:0006694 GO:GO:0042448 GO:GO:0005506 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0042446 HOVERGEN:HBG106944 GO:GO:0047442 GO:GO:0004508 CTD:1586 EMBL:L40335 EMBL:AF251388 RefSeq:NP_001009483.1 UniGene:Oar.399 ProteinModelPortal:Q29497 GeneID:493968 Uniprot:Q29497)

HSP 1 Score: 140.198 bits (352), Expect = 5.368e-35
Identity = 131/470 (27.87%), Postives = 218/470 (46.38%), Query Frame = 0
Query:    1 LTVIYYFY--NGKNNNIYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNF--------HRFPVAFCD-SSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNS--------------HCK--FIRSFVEN--KILLNQKFDDDFLNTYQRIEKNKELI-----LFALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKET-----RN-MVLLNACFYETVRL--TCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFID-TETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKN 426
            LT+ Y F+     +   YP      PL+GSL  L    +   E F KL++ YG I+S R+GS   V++  ++L +EVLL K   FS RP          ++  +AF D  +  Q  R+ ++  F + K  +L   +L+++  +E N ++  F   ++  +IDL   +S A  N+ I + C   SF  +D    +     D I   +    L+D FP   +F     + +                 C+  F    + N   IL+  K + D  NT    E++ +L+     L  + D+ G G    T+VI  I+ ++L H  +KK +Q  I   Q + F  T     RN +VLL A   E +R+      +IPH++  D+SIG+  +   T + +N   L+++   W +P  + P+RF+D T T  +S    + PF  G RSCVG  L +      ++ +L+  +L I +
Sbjct:   10 LTLAYLFWPKTKHSGAKYPRSLPSLPLVGSLPFLPRRGQ-QHENFFKLQEKYGPIYSFRLGSKTTVMIGHHQLAREVLLKKGKEFSGRPKVATLDILSDNQKGIAFADHGAHWQLHRKLVLNAFALFKDGNL---KLEKIINQEAN-VLCDFLATQHGQSIDLSEPLSLAVTNI-ISFICFNFSFKNEDPALKAIQNVNDGILEVLGKEVLLDIFPALKIFPSKAMEKMKGCVETRNELLSEILEKCQENFTSDSITNLLHILMQAKVNADNNNTGP--EQDSKLLSNRHMLATIADIFGAGVETTTSVIKWIVAYLLHHPSLKKRIQDSID--QNIGFNRTPTISDRNRLVLLEATIREVLRIRPVAPMLIPHKAIIDSSIGDLTIDKGTDVVVNLWALHHNEKEWQQPDLFMPERFLDPTGTQLISPSLSYLPFGAGPRSCVGEMLARQELFLFMSRLLQRFNLEIPD 469          
BLAST of EMLSAG00000001150 vs. C. finmarchicus
Match: gi|592765779|gb|GAXK01188789.1| (TSA: Calanus finmarchicus comp326371_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 111.694 bits (278), Expect = 1.928e-25
Identity = 110/463 (23.76%), Postives = 197/463 (42.55%), Query Frame = 0
Query:    3 VIYYFYNGKNNNIYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRP----NFHRF---PVAFCDSSFLQEERRKLI---KKFTIPKSHXXXXXXXXXXCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCK------FIRSFVENKILLN-----QKFD--DDFLNTYQRI--EKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF---QALTFKETRNMVLLNACFYETVRLTCS-PIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLS-IPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGM 435
            V+Y    GK N   PPGP GWPL+G+   L +    PF    +  K +GD+ S+ +   N VV++  E  K+     +D F+ RP    N  +     +AF       + RR ++   KK  + KS               LN + L     +    +D K  +   T+NV +   C    + Y D  +  F  + + I        L+DF P              ++        F R  +E+K   N     + +D  DD+LNT++ I  E+N+ L+    +    G    +  +   ++H++ +   + E   +I      +  +  + +N+  + A   ET+R+  + P+I H +K  T++ +Y +   T+I IN + +N     + +P  +NP R+I+ E  F   +      F  GRR+C G  L ++     +  +++   LS+   +  +P GM
Sbjct:  394 VLYKTIFGKKNFRLPPGPSGWPLVGNAFQLGSS---PFIKHDEFSKTFGDMHSVSLFGHNAVVLSSMEAVKDCNFGASDAFNHRPVWLGNLTKSIAPGIAFRGVDNYIDNRRFVLNNLKKRGMGKSELEPTI---------LNEVELMLTYIEENGPLDPKDVLGNYTSNV-VSQVCFEKRWDYGDPDYAKFHQAIEKIQVLSEVLALVDFVPVLGYLPKIKSMSDENYVSVAYIRNFFRKIIESKRKENTDGIFEGYDIVDDYLNTHKEITDEENENLVDICHDLFFAGTDTTSATLGFAVIHLINNPQFQDEFFAQIDKVLKGRDPSLSDLQNLPFVEATIQETLRVNPNVPLIFHATKNATALRDYIIPQKTMILINAYSVNNDEKYFEDPFTFNPHRWINEEGKFRGDLVDKLATFGEGRRACPGKPLARMEMFMVLVKLMQNFKLSVPAGD-PVPDGM 1740          
BLAST of EMLSAG00000001150 vs. C. finmarchicus
Match: gi|592836376|gb|GAXK01121168.1| (TSA: Calanus finmarchicus comp745244_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 91.6633 bits (226), Expect = 5.801e-19
Identity = 116/493 (23.53%), Postives = 205/493 (41.58%), Query Frame = 0
Query:   13 NNIYPPGPFGWPLIGSLHLLKNYEK----IPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAK-------ADHFSDRPNFHR-FPVAFCDSSFLQEERRKLIKKFTI----PKSHXXXXXXXXXXCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIR--SFVENKI-------------LLNQK---FDDDFLNTY--QRIEKNK----------ELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF----QALTFKETRNMVLLNACFYETVRL-TCSPIIPHRS-KRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPP----GMLATKPGPVVFCSKI 449
            NNI  PGP  +P  GS+  +  Y++     P+     + ++YG +  + +G     V+ G    K+  + +       +D F+D  +F R   V F D    +E+R+ +IK   +      S    +      C + L  +I +     N   + L         NV I    +   F Y+DK     I              L+D F   SL    V  P   + K+I   SF+ N I             L++++   FD+D L  Y    +E+NK          +LI+  ++   GG   ++  +   L++ L H ++  ++Q+EI       + +T ++  N+    A   E  R+ +  PI P R  +   S+GNY +    ++ +N + L+ +   W +P N+ P+RF+  + G +      QPFS G+R C+G  + +       ++++K     I   + SLP     G L    GP VF + +
Sbjct:  109 NNI--PGPLCFPFCGSVFSMVTYDRQLLSYPYRVMHHMSEVYGSVMRVMLGDQEWFVLTGLAEIKQFAMKEESTSHLPSDTFNDMYSFGRPLGVIFPDGHLWREQRKFVIKTLKLLGVGKHSLEEHIAEETGQCCKYLEDVIKE-----NDGVVRLDDFFDLPCLNV-IWSLVNSTRFDYNDKHLKKMI-------------ELIDTFTMNSLVGPLVGIP---YLKYIPPFSFIYNNIKFHMDKFKVYMSDLVHEQKSSFDEDNLRGYVDHFLEENKKGAEMHYTDEQLIVTLIDFFTGGSGTMSKTLGFSLLYCLHHPEVMTKVQEEIDEVLGGREKVTLEDRENLPYTEATLMEVSRVGSVLPIAPPRKCQGAISVGNYKIPKGGLVQMNLYSLHRNKEHWVDPENFRPERFL--KDGKVVQDEWLQPFSYGKRKCLGESIAKNTVFLMFSNLMKNFSFGISESD-SLPSKDPVGGLTI--GPQVFRANV 1500          
BLAST of EMLSAG00000001150 vs. C. finmarchicus
Match: gi|592878288|gb|GAXK01079613.1| (TSA: Calanus finmarchicus comp1784207_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 91.6633 bits (226), Expect = 5.876e-19
Identity = 107/442 (24.21%), Postives = 180/442 (40.72%), Query Frame = 0
Query:   16 YPPGPFGWPLIGS-LHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNF--------------HRFP---VAFCDSSFLQEERRKLIKK---FTIPKSHXXXXXXXXXXCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFF---PW----TSLFAGFVQQPLNSHCKFIRSFVENKI-LLNQKFDDDFLNTYQRIEKNKE----------------LILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQ----PFQALTFKETRNMVLLNACFYETVRLTCSPII--PHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQ 406
            +PPGP   P++G+ LHL  N      ++F  LR  YG+IF +RIG    VV++  +    V L K  +FS RP +              H  P   V F   S    +R+ ++KK   F + KS             E++  ++          ++ L    S +  N  I    +   F  DD L +S     D+    +++ RL+  F   PW     S   G ++    +    +++ V++ I   N  ++ D ++ +  I K KE                L    LE    G + V   +    +++    +++ ++ KEI         +T +  +++   NA  +E +R+T    I  PH +     I NY +   T +F    ++   P  W  P   NP+RF+D E+G         PF +GRR C+G  L Q
Sbjct:  104 FPPGPANLPVLGAILHLSDNL----LQSFLTLRSKYGNIFGLRIGPTPTVVIS--DFKTCVQLFKDANFSARPTYLTEVMGSVMHQAEDHPSPNRGVVFSSGSNWDTQRKFVLKKLSEFGVGKSKLEGT------VAEQVEMLVKVLRKQAKTGSVKLGERFSISLVNS-IWNIVTGSQFDLDDPLIHSIYKGIDSF---IDSHRLIGVFMVFPWLRHLISYLGGALENMKANVRNMMKAIVDDHIKTFNDGYERDLVDAF--IGKIKEADDPKSSFFGKRGRTNLEQNMLELFGAGANPVATTLSFCFLYLARMPEVQDKVFKEISDNCGADSVITLQHLKHLPYTNAFIHEVLRITAINFIGTPHMNISAAKIDNYDLPAGTTVFAFLWYILNDPEYWTNPRELNPERFLD-ESGSFVKDERLIPFLVGRRQCLGMALAQ 1372          
BLAST of EMLSAG00000001150 vs. C. finmarchicus
Match: gi|592838631|gb|GAXK01118913.1| (TSA: Calanus finmarchicus comp193694_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 84.7297 bits (208), Expect = 1.152e-16
Identity = 106/462 (22.94%), Postives = 182/462 (39.39%), Query Frame = 0
Query:    1 LTVIYYFYNGKNNNIYPPGPFGWPLIGSLHL--LKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRFPVA-------------FCDSSFLQEERRKLIKKFTIPKSHXXXXXXXXXXCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLM--------DFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLNQKFDDDFLNTY--QRIEKNKE------LILFALED-LIGGHSAVTNVILRILVHIL---EHGDIKKELQKEIQPFQALTFKETRNMVLLNACFYETVRLTCSPIIP----HRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLS 423
            L V++     K    +PPGP  WP+IG+  L  LK  +         +   YG      +G+   + +N   +T++  L   + FS R N   F +A             F D      +RR  +K     K         + + QEE + +++ F    +  +  ++S ++    NV  R   S   F  DD      + +    F   +  R             P  + F  F          F  S  E+K  ++Q    DF++ Y  +    NKE      L++  L+  L G  +  T++   +L  IL        + E+++ +   Q  +  +   +V   A   E  RL+C+  +P    HR   DT+I  +    D+++  N +++  S S W EP  + P+RFI        +P    PFS+GRR C+G  L +   +    H+++ L  S
Sbjct:  362 LIVVFILKARKKPKNFPPGPPKWPIIGTYALSPLKQTKDNHRVIVANMVADYGPTIGTFVGASPVIYLNDPVMTRK--LFSMEVFSGRINSTGFRLARSPNGKAKPYGILFTDGDMWHGQRRFSLKTL---KDLGFGRTNSESIIQEEAS-LLVDFLSENSTQDFGMQSTMNIPVINVLWRMVAS-KRFQMDDSDALEIMAALTIQFGTSSAFRRFLTLLPGSNQLVPALTGFKKFRALLDRLFSMFRESIREHKDTIDQSAPRDFIDYYLMEISRSNKEDFSEDQLLVIILDLFLAGAETTSTSLKWAVLFMILNPEAQDKCRAEIERVVGSRQP-SLADMEKLVYCQATILEIQRLSCT--VPSSLNHRVMADTNIDGFFFPKDSIVIANFYYMMTSSSFWEEPAAFKPERFIKDGQVQKDLP-QMMPFSVGRRVCMGDSLAKNELSIFFTHMVQRLKFS 1714          
BLAST of EMLSAG00000001150 vs. C. finmarchicus
Match: gi|592939286|gb|GAXK01019267.1| (TSA: Calanus finmarchicus comp81223_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 83.5741 bits (205), Expect = 2.600e-16
Identity = 111/479 (23.17%), Postives = 197/479 (41.13%), Query Frame = 0
Query:   14 NIYPPGPFGWPLIGSL----HLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPN-----FHRF-----------PVAFCDSSFLQEERR---KLIKKFTIPKSHXXXXXXXXXXCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPW-------TSLFAGFVQQPLNSHCKFIRSFVENKILLNQKFDDDFLNTYQRIEKNKEL---------------ILFALEDLIGGHSAVTNVILRILVHIL-EHGDIKKELQKEIQPF--QALTFKETR-NMVLLNACFYETVRLTCSPII---PHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLATKP 440
            N +P GP  +P+IGS+      LKN       AF + RK YG I   ++G+   VV++  ++  E    K D F  RP+     F  F            + F      +E+RR   + +K+F + KS       L  +  +E+  ++ +    ++  +I+LK   + A  N   +      S   D ++   F  + + +     +G +M   PW        + F    + P         S  ++    +++   DF++ Y  I+K KE                I   + DL G  S  T+ +L    + L  + D+++++Q EI       +   E R  M   +A  +E +R +C  II   PH +  +     + +   T ++ N  ++   P  W+ P  +NP+RFID E+G         PF +G+R C+G +L Q      +  +L+ L  S    +    P M+  +P
Sbjct:  239 NNFPTGPRSFPIIGSILSVGFDLKN-------AFNRWRKEYGAIVGFKLGNQLSVVISDFDMLNEAF--KDDRFCGRPSNLQEVFAAFFSKDKNEKSSGGIVFSHGDHWREQRRFAMRTLKEFGVGKS------FLQTVINDEVAKLVEELRE-ESGESINLKFRTNLAVVNTLWQILNGEKSDMKDPQMAKVFRSTAEFVVENSLSGPVM-IMPWLRHLPFFNTKFEKARRSPQEMRKLTSMSIKKHMDTFDEEHQRDFIDCY--IKKMKETSDEKSSFFKGHGEGNIQRTVMDLFGAGSETTSSVLTFAFNYLTRYPDMQEKIQAEIDTVIGSRMPLIEDRPQMPYTDAFIHEVLRHSC--IIYTTPHATTEEVQFHGHTLPAGTSVYANVSWIMNDPEYWHNPEQFNPERFID-ESGQFRKDERCIPFLVGKRYCLGQQLAQHELFLFLTGLLQGLSFSTPLQD----PSMVNIEP 1597          
BLAST of EMLSAG00000001150 vs. C. finmarchicus
Match: gi|592939284|gb|GAXK01019269.1| (TSA: Calanus finmarchicus comp81223_c0_seq4 transcribed RNA sequence)

HSP 1 Score: 83.5741 bits (205), Expect = 2.846e-16
Identity = 111/479 (23.17%), Postives = 197/479 (41.13%), Query Frame = 0
Query:   14 NIYPPGPFGWPLIGSL----HLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPN-----FHRF-----------PVAFCDSSFLQEERR---KLIKKFTIPKSHXXXXXXXXXXCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPW-------TSLFAGFVQQPLNSHCKFIRSFVENKILLNQKFDDDFLNTYQRIEKNKEL---------------ILFALEDLIGGHSAVTNVILRILVHIL-EHGDIKKELQKEIQPF--QALTFKETR-NMVLLNACFYETVRLTCSPII---PHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLATKP 440
            N +P GP  +P+IGS+      LKN       AF + RK YG I   ++G+   VV++  ++  E    K D F  RP+     F  F            + F      +E+RR   + +K+F + KS       L  +  +E+  ++ +    ++  +I+LK   + A  N   +      S   D ++   F  + + +     +G +M   PW        + F    + P         S  ++    +++   DF++ Y  I+K KE                I   + DL G  S  T+ +L    + L  + D+++++Q EI       +   E R  M   +A  +E +R +C  II   PH +  +     + +   T ++ N  ++   P  W+ P  +NP+RFID E+G         PF +G+R C+G +L Q      +  +L+ L  S    +    P M+  +P
Sbjct:  204 NNFPTGPRSFPIIGSILSVGFDLKN-------AFNRWRKEYGAIVGFKLGNQLSVVISDFDMLNEAF--KDDRFCGRPSNLQEVFAAFFSKDKNEKSSGGIVFSHGDHWREQRRFAMRTLKEFGVGKS------FLQTVINDEVAKLVEELRE-ESGESINLKFRTNLAVVNTLWQILNGEKSDMKDPQMAKVFRSTAEFVVENSLSGPVM-IMPWLRHLPFFNTKFEKARRSPQEMRKLTSMSIKKHMDTFDEEHQRDFIDCY--IKKMKETSDEKSSFFKGHGEGNIQRTVMDLFGAGSETTSSVLTFAFNYLTRYPDMQEKIQAEIDTVIGSRMPLIEDRPQMPYTDAFIHEVLRHSC--IIYTTPHATTEEVQFHGHTLPAGTSVYANVSWIMNDPEYWHNPEQFNPERFID-ESGQFRKDERCIPFLVGKRYCLGQQLAQHELFLFLTGLLQGLSFSTPLQD----PSMVNIEP 1562          
BLAST of EMLSAG00000001150 vs. C. finmarchicus
Match: gi|592939285|gb|GAXK01019268.1| (TSA: Calanus finmarchicus comp81223_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 83.5741 bits (205), Expect = 2.846e-16
Identity = 111/479 (23.17%), Postives = 197/479 (41.13%), Query Frame = 0
Query:   14 NIYPPGPFGWPLIGSL----HLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPN-----FHRF-----------PVAFCDSSFLQEERR---KLIKKFTIPKSHXXXXXXXXXXCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPW-------TSLFAGFVQQPLNSHCKFIRSFVENKILLNQKFDDDFLNTYQRIEKNKEL---------------ILFALEDLIGGHSAVTNVILRILVHIL-EHGDIKKELQKEIQPF--QALTFKETR-NMVLLNACFYETVRLTCSPII---PHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLATKP 440
            N +P GP  +P+IGS+      LKN       AF + RK YG I   ++G+   VV++  ++  E    K D F  RP+     F  F            + F      +E+RR   + +K+F + KS       L  +  +E+  ++ +    ++  +I+LK   + A  N   +      S   D ++   F  + + +     +G +M   PW        + F    + P         S  ++    +++   DF++ Y  I+K KE                I   + DL G  S  T+ +L    + L  + D+++++Q EI       +   E R  M   +A  +E +R +C  II   PH +  +     + +   T ++ N  ++   P  W+ P  +NP+RFID E+G         PF +G+R C+G +L Q      +  +L+ L  S    +    P M+  +P
Sbjct:  204 NNFPTGPRSFPIIGSILSVGFDLKN-------AFNRWRKEYGAIVGFKLGNQLSVVISDFDMLNEAF--KDDRFCGRPSNLQEVFAAFFSKDKNEKSSGGIVFSHGDHWREQRRFAMRTLKEFGVGKS------FLQTVINDEVAKLVEELRE-ESGESINLKFRTNLAVVNTLWQILNGEKSDMKDPQMAKVFRSTAEFVVENSLSGPVM-IMPWLRHLPFFNTKFEKARRSPQEMRKLTSMSIKKHMDTFDEEHQRDFIDCY--IKKMKETSDEKSSFFKGHGEGNIQRTVMDLFGAGSETTSSVLTFAFNYLTRYPDMQEKIQAEIDTVIGSRMPLIEDRPQMPYTDAFIHEVLRHSC--IIYTTPHATTEEVQFHGHTLPAGTSVYANVSWIMNDPEYWHNPEQFNPERFID-ESGQFRKDERCIPFLVGKRYCLGQQLAQHELFLFLTGLLQGLSFSTPLQD----PSMVNIEP 1562          
BLAST of EMLSAG00000001150 vs. C. finmarchicus
Match: gi|592885187|gb|GAXK01073188.1| (TSA: Calanus finmarchicus comp149142_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 77.411 bits (189), Expect = 2.895e-14
Identity = 102/487 (20.94%), Postives = 194/487 (39.84%), Query Frame = 0
Query:   17 PPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRFPVAFCDSSFLQE------------------ERRKLIKKFTIP--KSHXXXXXXXXXXCQEELNHMILQFNMFKNWTN--IDLKSCISKATANVFIRYFCSIHSFSYDDKLF--------NSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLNQKFDD-----------DFLNTY--------QRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPFQA--LTFKETRNMVLLNACFYETVRL-TCSPIIPHRSK-RDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLD-LSIKNMEISLPPGMLATKPGPVVFCSKI 449
            PPGP   P +G+   +   + +P +A+  L   +G I  + +G  N +V+ G +  KE +    +   DR       +    S  + E                  E+ + I++F +   +         +    EE   +I       + T+  I+L+  ++ A  N+ +    +   FSYDD L         N  ++  D I      G+   F P    F  F+    +   K   S ++ K  +N + D+           D ++ +        Q I    +LI   L+    G  + +  +L  +  ++ H +I+ ++  ++    +  +T K+   +  + A   E  R    +P  P R   +DT + +  +   T++  N + L+   + W +P  + P+RF+D    F S   +  PF IGRR C+G  L ++     +++I +    + I +   SL P +  T  GP  F +KI
Sbjct:  106 PPGPSIHPFLGNFPTMAKLDPVPHKAWHSLTLQFGPIVRLVMGLNNMLVIGGYDDMKEAM--NNELLDDRAPSPTANLVLFGSETVDEISLFARGKLPNDAKLHPIEKWREIRRFILKSLRDLGAGKSGSEEAIIEESKTLIKSITEAVDGTDGEINLEKTLNCAALNI-VWNLVAGKRFSYDDPLMRQLVDFSGNFMLMGKDVI------GKPFGFMP----FLRFIPPFKDKFNKLSSSLIKFKEYINSEIDEHKESFDKENQRDLMDMFIAKMEEDTQGIFTQTQLIYICLDLFNAGSESTSKSLLFAIALMMRHPEIQDKVHDDLDKIDSDCVTMKDRTKIPYVEATLNEIWRFCNVAPFGPPRQAYKDTPLKSTIIPAGTLVMYNTYSLHMDEAHWGDPEVFRPERFLDDCGAFRSDEMNL-PFGIGRRKCLGESLARMENFLFLSNIFQNFKFVQIGDSPPSLEPEVGFTN-GPYPFTTKI 1521          
BLAST of EMLSAG00000001150 vs. C. finmarchicus
Match: gi|592853811|gb|GAXK01103733.1| (TSA: Calanus finmarchicus comp166686_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 75.0998 bits (183), Expect = 1.185e-13
Identity = 99/465 (21.29%), Postives = 180/465 (38.71%), Query Frame = 0
Query:    4 IYYFYNGKNNNI-YPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKI--------YGDIFSIRIGSFNCVVVNGNELTK-----EVLLAKADHFSDR----PNF--HRFPVAFCDSSFLQEERRKLIKKFTIPKSHXXXXXXXXXXCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNN--GRLMDFFPWTSL-------FAGFVQQPLNSHCKFIRSFVENKILLNQKFDDDFLNTY-QRIEKNK-------ELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF---QALTFKETRNMVLLNACFYETVRLTCSPIIP----HRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSI 424
            I+Y +  +   + YPPGP  WPLIGS  L       PF +  +  ++        YG      +G+   V ++     +     EV   + ++   R    PN   + + +   D      +RR  +K     K         D + QEE + +I          +   K+ ++    NV  R   S   F  DD      +++         +   RL+   P  S        F  F     N    F +S  E+K  L+     DF++ Y   IEK K       +L+    +  I G    +  +   ++ +  + D++++ ++EI+     +     +   +V   A   E  R+ C+  +P    HR   DT++  +    +T++  N +++  S + W  P  ++P RFI        +P    PFS+GRR C+G  L +   +     +++ L  S+
Sbjct:  226 IFYLWKSQKKPLNYPPGPPKWPLIGSFTL------SPFASQKEDHRMKVANMVEEYGPTIGTYLGTNPIVYLHDPVFIRKVFNMEVFSGRVNNPEGRKLRSPNGKPNAYGILTTDGQTWHGQRRFSLKTL---KDLGFGRTSSDLIIQEEASLLIDHLIERSANGDFHFKNTMNIPVINVLWRMVAS-KRFEMDDAKAEKIMMALTQTIGNPRSPFQRLLRLMPGASKLMRKSENFKRFQLLVENLFSMFRQSIKEHKETLDPSAPRDFIDYYIMEIEKTKDDDFSEDQLMGIIFDLFIAGAETTSTTLKWAVLFLTLNPDVQQKCRQEIEDMIGSRQPALPDMDKLVYCQATILEIQRMGCT--VPSSLNHRVMEDTTVDGHFFPKNTIVLANIYYMMKSEAFWENPSVFDPNRFIKAGKLQKDLP-QMMPFSVGRRVCMGDSLAKNELSIFFTSMVQRLKFSV 1581          
BLAST of EMLSAG00000001150 vs. C. finmarchicus
Match: gi|592811180|gb|GAXK01143388.1| (TSA: Calanus finmarchicus comp1067522_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 73.1738 bits (178), Expect = 4.961e-13
Identity = 96/438 (21.92%), Postives = 181/438 (41.32%), Query Frame = 0
Query:   13 NNIYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSD-RPNFHRFPVAFCDS------SFLQEERRKLIKKFTIP--KSHXXXXXXXXXXCQEELNHMILQFNM-FKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGR------------LMDFFPWTSLFAGFVQQPLNSHCKF--IRSFVENKILLNQK-FDDDFLNTY------------QRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEI---QPFQALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKR----DTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQ 406
              + P  P   P++G +  ++    + F+A  K+ ++ G +F +R+   + VV+   +  KE   A ++   D RP      + +C S       F   E  K +++F++   ++      + +    EE   +I  F     N T + + +  +KA  N+  +       + YDD   +  I   D     V+ G             L    P+ S F       LNS  +   +R+F++  I  ++K FD D +  Y             +I   ++L++  L+   GG    +  ++  + +++ + ++++++  EI    P + +  ++T ++ L NA   E  RL   PIIP   +R    D  IG Y +   T I  N       P++W +P  + P+R I  +   L        F  GRR C+G  L +
Sbjct:   26 GQVPPSVPGRHPILGDVQTVQQSVHV-FQALEKIARVIGPVFRLRLLHQDIVVLGSYDAIKE---AHSNPLLDKRPANPVMDLLYCGSLKKRGIIFNNTEEWKTLRRFSLKTLRNFGFGKAKFEDGILEECQTLIHYFETKGANNTEVPISNIFNKAALNIVWKTIAG-ERYDYDDTRLDKLISMLDTF---VDLGASLLSGPLGLLPFLRHVPPFKSDF-------LNSKREMDKLRAFLKETIDDHKKTFDKDNIRDYIDTFINEVEVSDDKIICEEQLVICCLDLFAGGSETSSKSLMFFICYMILYPELQEKVLNEIIDVAPDRLVRMEDTSDLPLTNAVLTEIWRL--HPIIPMDPQREAMGDVRIGGYDIPAGTGILTNYFAAQADPTVWEDPQIFKPERHIGQQENLLL-------FGTGRRKCLGEPLAR 1267          
BLAST of EMLSAG00000001150 vs. L. salmonis peptides
Match: EMLSAP00000001150 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1190:174024:175828:-1 gene:EMLSAG00000001150 transcript:EMLSAT00000001150 description:"maker-LSalAtl2s1190-snap-gene-0.33")

HSP 1 Score: 939.102 bits (2426), Expect = 0.000e+0
Identity = 456/456 (100.00%), Postives = 456/456 (100.00%), Query Frame = 0
Query:    1 LTVIYYFYNGKNNNIYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRFPVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLNQKFDDDFLNTYQRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLATKPGPVVFCSKIFADTEII 456
            LTVIYYFYNGKNNNIYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRFPVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLNQKFDDDFLNTYQRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLATKPGPVVFCSKIFADTEII
Sbjct:    1 LTVIYYFYNGKNNNIYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRFPVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLNQKFDDDFLNTYQRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLATKPGPVVFCSKIFADTEII 456          
BLAST of EMLSAG00000001150 vs. L. salmonis peptides
Match: EMLSAP00000004688 (pep:novel supercontig:LSalAtl2s:LSalAtl2s245:535864:537578:-1 gene:EMLSAG00000004688 transcript:EMLSAT00000004688 description:"maker-LSalAtl2s245-augustus-gene-5.13")

HSP 1 Score: 98.5969 bits (244), Expect = 2.836e-22
Identity = 102/450 (22.67%), Postives = 193/450 (42.89%), Query Frame = 0
Query:    1 LTVIYYFYNGKNN-NIYPPGPFGWPLIGSLHLLK-NYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPN------FHRFPVAFCDSSFLQEERRKLI-KKFTIP--KSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSI---HSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGF------VQQPLNSHCKFIRSFVE---------------NKILLNQKFDDDFLNTYQRIEKNKELILFALEDLIGGHSAVTNV-ILRILVHILEHGDIKKELQKEIQPFQAL-TFKETRNMVLL---NACFYETVRLTCSPIIP----HRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQ 406
            LT++Y   + K +    PPGP G+P++G + L+K  +  + F+   K    +G I S+++G    VV++  +  K+    K  +FS RP          + +   +    + +R+ L+ +K  +   KS + SL++++ +   E+   +       + T ++L    + A +NV     CSI     F Y D  F  F+  +D  F        M F P+  +  G       ++Q       F+R  +                +  L+ +   D F   Y   ++ +++IL    DL       T   +L  +V +L +  I  +++ E+          +  +M+ L    A  YE +R   S ++P    H + R+     + +  ++ +    H ++ +P  W  P  + P+RFI+ E G L  P HF PF +G+R C+G +L +
Sbjct:   22 LTLLYILKHLKKSFKDLPPGPIGYPIVGIIPLIKKEFHLLLFDYAMK----FGKIVSLKMGGETVVVLSDYQTIKKAFSCK--YFSARPKTELSQLLGGYGIVNSEGPLWKTQRKYLLNQKLGMKHWKSGAGSLEQIESVVSREVQSFLYTLENDYSNTFVNLTPLFNCAVSNVI----CSIIXSRRFRYQDPKFQRFMFLFDEGFRLFTMTGAMTFLPFLKVLPGISDTCTKLRQNREEMIAFVREIISEHRQELDPQNPKDLIDSYLVQESTPDQFFEDYDPEQQLEQIIL----DLFSASVETTRTSLLWAIVFMLHNPKILSKVRDELNSVVGEDNLPQLSDMIKLPYTRATLYEIMRR--SSVVPMGTTHATDREVQFEGFVLPQNSHVIPLIHAVHMNPKNWENPEEFRPERFINKE-GVLFKPEHFMPFGVGQRKCLGDRLAE 454          
BLAST of EMLSAG00000001150 vs. L. salmonis peptides
Match: EMLSAP00000002359 (pep:novel supercontig:LSalAtl2s:LSalAtl2s144:369128:376155:1 gene:EMLSAG00000002359 transcript:EMLSAT00000002359 description:"snap_masked-LSalAtl2s144-processed-gene-3.3")

HSP 1 Score: 80.4925 bits (197), Expect = 1.517e-16
Identity = 99/447 (22.15%), Postives = 190/447 (42.51%), Query Frame = 0
Query:   16 YPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLR-KIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKAD---------HFSDRPNFHRFPVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTN----IDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSF-------------ILSY--DAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSH-CKFIRSFVENKILLNQKFDDDFLNTYQRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKET------RNMVLLNACFYETVRL-TCSPI-IPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSI 424
            +PPGP   P++G+L  +     I   A T  +   YGD++S+ IG+ + VV+N  +L K+ L A+ D           + R + H   +        +E+RR  ++     K      + LD + Q E    I   ++ K   N    + ++S  +    N+  +     + F  D++                  IL Y   A F+   + R+ D       F   +++ +  +     R F++  + + +  D+D  N ++     ++L+   L+    G       +L  +++I  + + + +  +EI+   A+  KE       ++MV  NA   E  R+ +  P+ +PH + +D  I  YC+   T I+ N    + +P  +  P ++ P+RFI  E G L     F PF +G+R C+G  + +         +L+ L +S+
Sbjct:   26 FPPGPPNLPIVGTLPYMNG---IGSNALTDPKFGKYGDLYSLFIGNIHLVVINNYQLAKD-LFAREDVSYRRETWWTLNVRGDGHPLGIINTSGHVWKEQRRFAVRNL---KDFGFGKNTLDAVIQNEARFTIE--DIIKESKNNNGVLRMESTFNVGIINILWQIIAG-YRFDKDNEKTKEMMGHLHEVYSEGYSILHYIPAARFFIKRDKRMDDMLRTKEFFRSQIREHMKDYDASNPRDFID--VYIKEMLDEDRENFHE-----EQLMTTCLDFFQAGGETSATTLLWSVLYISLYPEAQAKCVEEIE---AVLGKEDPSQEVYKDMVYCNATLMEIQRMASVGPLTLPHVTIKDLFIDGYCIPRGTEIYGNIIAFHNNPKFFPSPKSFRPERFI--ENGKLKKLEAFAPFGVGKRICMGESMAKNQLFIFFVMMLQKLKISV 450          
BLAST of EMLSAG00000001150 vs. L. salmonis peptides
Match: EMLSAP00000007758 (pep:novel supercontig:LSalAtl2s:LSalAtl2s453:376415:377986:-1 gene:EMLSAG00000007758 transcript:EMLSAT00000007758 description:"maker-LSalAtl2s453-augustus-gene-3.8")

HSP 1 Score: 72.0182 bits (175), Expect = 7.924e-14
Identity = 93/422 (22.04%), Postives = 164/422 (38.86%), Query Frame = 0
Query:   17 PPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRFPVAF---------CDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFN-MFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCK---FIRSFV-----ENKILLNQKFDDDFLNTYQRIE---------KNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKETRNMVLLN---ACFYETVRLT--CSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQ 406
            PPGPF  PL+GSL  L +        F  L + +G I+++ +     VV+N   + K++   +      +  +HRF   +          +    Q +RR  +      K+       L+ +   E++H+    + M    +++ +         NV      S H F Y         L  D     +  G  ++ F   S+FA +V  PLN   +   +++ F+     E+K  L      DF++ Y  IE           K+LI+   +  + G    +  +L I++ +  H DI+ +  +EI       F    +M +L    A   E  R        + H+  +   +G Y +   T +  N H  +  P ++  P  +NP RF          P  F P+  G+R C+G  L +
Sbjct:   30 PPGPFSLPLVGSLPFLSSQGSPGILDFA-LGEKFGSIYTVDVIWSKIVVLNDFGMAKDLFNREDVSGRYQGQWHRFTKGYDGIAYGIINNEGPMWQSQRRFALTNL---KNLGFGKKSLESVIYNEVHHLFEVIDEMIDGCSDVLIHDIFHVPIINVLWSIIAS-HRFEYSQAREIVEKLGLD-----LKKGIHINIF--ISIFANYV--PLNESDEAMLYMKRFISKNXDEHKNNLEVNAPKDFIDFY-LIEMLKSQDPYFSKKQLIVMLFDFFLAGSETTSTTLLWIILLMCLHNDIQLKCYQEISQNIGNNFPREEDMKMLPFTLATISEVQRYANIAPASLVHKVLQTIRVGKYLIPKGTSVIANYHKFHMDPKVFPHPHEFNPYRFYKVPK-----PEQFVPYGFGKRICMGKSLAK 431          
BLAST of EMLSAG00000001150 vs. L. salmonis peptides
Match: EMLSAP00000007328 (pep:novel supercontig:LSalAtl2s:LSalAtl2s412:195302:204629:-1 gene:EMLSAG00000007328 transcript:EMLSAT00000007328 description:"maker-LSalAtl2s412-snap-gene-2.12")

HSP 1 Score: 71.2478 bits (173), Expect = 1.614e-13
Identity = 107/463 (23.11%), Postives = 186/463 (40.17%), Query Frame = 0
Query:    3 VIYYFYNGKNNNIYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRFPVAFCDSSFL----------QEERRKLIKKFTIPKSHSLSLDRLDRLCQEELN---HMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQ--PLNSHCKFIRSFVENKILLNQKFDD--DFLNTY-QRIEKNKEL-ILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKETRNMVLLNACFYETVRL-TCSPI-IPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLT--QLICTFSVAHILKTLDLSIKNMEISLPPGMLATKPGP 442
             + YF   +    +PPGP   PL+GS+  +               + +GD++++ IG    +V+N  +LTKE L  K +  S R  +    V       L          Q +RR  +++    +        LD + QEE       ILQ +  KN   + + S  + +  NV  +       F  ++      +   + +F    +  ++ + P    F    ++   + S  +F R  +   I  +Q  D+  DF++ Y + + K+ E    F +E LI                     +IK +LQ + +P Q         +   +A   E  RL +  P+ +P  + +D  +  Y +   T I+ N    +  P  + EPL + P+RF+  +   +    HF PF +GRR C+G  L   QLI  F +          ++N+ IS+P G    KP P
Sbjct:    2 ALGYFKRKRWVARFPPGPRNLPLVGSIPFMNGIGTQ--GCLNPDYRKFGDLYTLFIGPIPLIVINSFQLTKE-LYVKEEISSRRDTWWTINVRGDGKQSLGIINTGGMKWQTQRRFALRQL---REFGFGKRSLDSVIQEEAQASIDTILQESS-KNDGKVLMASNFNVSIINVLWQIVAG-QRFDPEESSTKERMEHLNEVFRVGYS--VLHYLPIARYFIKKDERRDKMLSLKEFFREMIREHIK-DQDDDNPRDFIDVYLKEVHKSGEKPSYFHIEQLIQKKCKE---------------EIKDKLQGDEKPTQDCI----SELPYTHATLMEVQRLASVGPMSLPRYTTKDIDVNGYSIPEGTEIYSNFMAFHRDPDFFPEPLEFKPERFLTEDGSRVKKDEHFLPFGLGRRICMGESLARHQLIIFFIMI---------LQNLNISVPIGQ--EKPDP 423          
BLAST of EMLSAG00000001150 vs. L. salmonis peptides
Match: EMLSAP00000006822 (pep:novel supercontig:LSalAtl2s:LSalAtl2s383:99037:100275:-1 gene:EMLSAG00000006822 transcript:EMLSAT00000006822 description:"maker-LSalAtl2s383-augustus-gene-2.10")

HSP 1 Score: 60.8474 bits (146), Expect = 2.612e-10
Identity = 42/185 (22.70%), Postives = 86/185 (46.49%), Query Frame = 0
Query:  235 LNQKFDDDFLNTYQ-RIEKN-------KELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTF---KETRNMVLLNACFYETVRL--TCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQ 406
            L++   +DF++ Y   ++KN       K+L    ++  + G       ++  L+++  +  ++++  +EI           ++ +N+    A   E  RL  T    +PH++ +D  IG+Y V   T+   N    ++ P+++  P  +NP R++     + S P  F PF  G+R C+G  L +
Sbjct:  156 LDENSPNDFMDVYLIEMKKNVDSTFSKKQLASLCIDLFLAGAETTNTTLVWALLYMSLYEGVQEKCAEEINSVLGSRMPQEEDMKNLPYTIATLNEIQRLCNTAPASLPHKNLKDIKIGDYVVPKGTLFLANLIGFHHDPNIFENPQQFNPDRWLH----YKSCPQQFVPFGFGKRICMGVSLAK 336          
BLAST of EMLSAG00000001150 vs. L. salmonis peptides
Match: EMLSAP00000005269 (pep:novel supercontig:LSalAtl2s:LSalAtl2s281:237457:238966:1 gene:EMLSAG00000005269 transcript:EMLSAT00000005269 description:"maker-LSalAtl2s281-snap-gene-2.7")

HSP 1 Score: 58.5362 bits (140), Expect = 1.473e-9
Identity = 42/156 (26.92%), Postives = 76/156 (48.72%), Query Frame = 0
Query:  270 AVTNVILRILVHILE-HGDIKKELQKEIQPFQALTFKETRNMVLLNACFYETVRLTCSPIIPHRSK--RDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDL 422
            + T++ L  L +IL  H +I+++L KEI   Q   F E       +A   ET+R+   P+  H     +DT +    +KN T++ +  +  +Y+P  +  P  + P+RF   E     IP  ++PF  G RSC+ Y+   +     +  ++K  ++
Sbjct:  272 STTSMTLCCLTYILATHPEIQEKLYKEIVSSQDKDFSEHS---YTSAVIKETLRM-YPPVTLHLRACVKDTEVEGILIKNGTIVEMPIYASHYNPEFFPTPNEFKPERFFQ-ENNLEIIPNTYRPFGDGNRSCIAYRFAMMELQLILEKLVKKFEI 422          
BLAST of EMLSAG00000001150 vs. L. salmonis peptides
Match: EMLSAP00000005721 (pep:novel supercontig:LSalAtl2s:LSalAtl2s309:682709:688189:1 gene:EMLSAG00000005721 transcript:EMLSAT00000005721 description:"maker-LSalAtl2s309-augustus-gene-6.40")

HSP 1 Score: 58.5362 bits (140), Expect = 1.593e-9
Identity = 46/189 (24.34%), Postives = 86/189 (45.50%), Query Frame = 0
Query:  241 DDFLNTYQRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKK----ELQKEIQPFQALTFKETRNMVLLNACFYETVR-LTCSPIIPHR-SKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLS 423
            DD  N Y     N++LI+   +  + G    +  +   +++++ + +I++    E++  IQ    +  K+   +   +A   E  R  T  PI P R S +D  +  +    +  + +N + +  S   W  P  +NP RF++ E G + IP  F PF  GRR C+G  +  +     V+++L     S
Sbjct:  293 DDKDNPYL---SNEDLIMCCQDFFLAGAETSSKTLCTFILYMVLYPNIQENAASEIRDAIQKDTQIKSKDRHLLPYTDAVLMEVRRYATPFPITPFRCSNKDIRVNGFDXPANVPVQVNLNGVLRSKYCWKAPDIFNPSRFLN-EKGAVEIPNAFMPFGFGRRRCIGEDIGNISNFLIVSNLLHNFKFS 477          
BLAST of EMLSAG00000001150 vs. L. salmonis peptides
Match: EMLSAP00000012088 (pep:novel supercontig:LSalAtl2s:LSalAtl2s865:171159:172708:-1 gene:EMLSAG00000012088 transcript:EMLSAT00000012088 description:"maker-LSalAtl2s865-snap-gene-0.12")

HSP 1 Score: 53.1434 bits (126), Expect = 9.322e-8
Identity = 48/194 (24.74%), Postives = 87/194 (44.85%), Query Frame = 0
Query:  242 DFLNTYQRIEK----------NKELILF-ALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKETRNMVLLNACFYETVRLTCSPIIPHRS--KRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDL 422
            DFLN   ++ K          N E+I   A+   I G+S  +  +  +   +  H +I+++L KEI   +   F E       +A   ET+R+   P+  H     +DT +    +K  T+I +  +  +Y+P  +  P  + P+RF   E     IP  ++PF  G RSC+ Y+   +     +  ++K  ++
Sbjct:  275 DFLNVLVQMRKKSHEDPNTLLNDEIITAQAIIFFIAGYSTTSTTLCCLTYMLATHPEIQEKLYKEIVSSEDKDFSEHS---YTSAVIKETLRM-YPPVALHLRVCAKDTEVEGIPIKKGTIIEMPIYASHYNPEFFPNPNEFKPERFFQ-ENNLEIIPNTYRPFGNGNRSCIAYRFAMMEXQLILEKLVKKFEI 463          
BLAST of EMLSAG00000001150 vs. L. salmonis peptides
Match: EMLSAP00000009405 (pep:novel supercontig:LSalAtl2s:LSalAtl2s5:994028:996076:1 gene:EMLSAG00000009405 transcript:EMLSAT00000009405 description:"augustus_masked-LSalAtl2s5-processed-gene-10.0")

HSP 1 Score: 50.447 bits (119), Expect = 6.626e-7
Identity = 51/235 (21.70%), Postives = 95/235 (40.43%), Query Frame = 0
Query:  200 LMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLNQKFDDDFLNTYQRIEKNK----------ELILF-ALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKETRNMVLLNACFYETVRLTCSPIIPHR-SKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDL 422
            L++ FP    +            K   S + N+   N K   DF+N    + KN           E+I   A+   + G+   ++ +  ++  +  + +I+ +L +EI   +   F E       +A   E +RL     +  R    DT +    +KN T+I +  +  +Y P  +  P  + P+RF   E     IP  F+PF  G R C+ Y+   +     +  ++K  ++
Sbjct:  222 LLNLFPGMIKYIDIFGNAYEELIKIANSIIANRETENIK-KKDFINVLVEMRKNNNECPNELLNNEIITAQAVIFFVAGYVTTSHSLCCLIYVLATNPEIQDQLYQEILSSEDQGFDEHS---YTSAVIKEALRLYPPATMHTRVCTHDTEVEGIFIKNGTIIEMPIYASHYYPEFFPNPEEFKPERFFK-ENNSEIIPDTFRPFGDGNRICIAYRFAMMELQIVIEKLVKKFEI 451          
BLAST of EMLSAG00000001150 vs. SwissProt
Match: gi|33860144|sp|Q9VRM7.3|CP307_DROME (RecName: Full=Cytochrome P450 307a1; AltName: Full=CYPCCCVIIA1; AltName: Full=Protein spook)

HSP 1 Score: 246.899 bits (629), Expect = 9.629e-75
Identity = 160/474 (33.76%), Postives = 243/474 (51.27%), Query Frame = 0
Query:   18 PGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQF-NMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKF---IRSFVENKILLNQKF-------DDDFLNT-----YQRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF-----QALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFID------------TETGFLS----------IPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKN-MEISLPPGMLA 437
            PGP  WP+IG+LHLL  Y   PF  FT L + YGDI+S+  G   C+VVN  EL +EVL       S RP+F R+           +A CD S LQ++RR L ++   P+  S    ++ ++  EE+ H   +  N       I++K  I KA AN+F +Y CS+  F YDD  F   +  +D IFWE+N G  +DF PW      F Q+ LN    +   IR F+  +I+ +++        D DF +       +  + ++  I+F LED IGGHSAV N+++ +L +I ++ DI + +Q+EI        +++   +   M    A  +E +R + SPI+PH +  DT I  Y V   T++FINN+ LN S   W  P  +NP RF++            +++G  S          IP HF PFSIG+R+C+G  L +      V ++++  ++S  N   I + P  LA
Sbjct:   56 PGPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLVPGEPINIKPLILKACANMFSQYMCSLR-FDYDDVDFQQIVQYFDEIFWEINQGHPLDFLPW---LYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDALLKSLLEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLRYSSSPIVPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIP-HFLPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNISSHNPSTIKISPESLA 524          
BLAST of EMLSAG00000001150 vs. SwissProt
Match: gi|117283|sp|P05093.1|CP17A_HUMAN (RecName: Full=Steroid 17-alpha-hydroxylase/17,20 lyase; AltName: Full=17-alpha-hydroxyprogesterone aldolase; AltName: Full=CYPXVII; AltName: Full=Cytochrome P450 17A1; AltName: Full=Cytochrome P450-C17; Short=Cytochrome P450c17; AltName: Full=Steroid 17-alpha-monooxygenase)

HSP 1 Score: 151.754 bits (382), Expect = 2.127e-39
Identity = 137/454 (30.18%), Postives = 214/454 (47.14%), Query Frame = 0
Query:   16 YPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNF--------HRFPVAFCDS-SFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQE--ELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLN--QKFDDD----FLNTYQRIEKNKE----------------LILFALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKET-----RN-MVLLNACFYETVRLT-CSP-IIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFID-TETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKN 426
            YP      PL+GSL  L  +  +    F KL+K YG I+S+R+G+   V+V  ++L KEVL+ K   FS RP          +R  +AF DS +  Q  RR  +  F + K     L+++  +CQE   L  M+   N      +ID+   +  A  NV I   C   S+   D   N      + I   ++   L+D  PW  +F     + L SH K IR+ + NKIL N  +KF  D     L+T  + + N +                 IL  + D+ G G    T+V+   L  +L +  +KK+L +EI   Q + F  T     RN ++LL A   E +RL   +P +IPH++  D+SIG + V   T + IN   L+++   W++P  + P+RF++   T  +S    + PF  G RSC+G  L +      +A +L+  DL + +
Sbjct:   27 YPKSLLSLPLVGSLPFLPRHGHM-HNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKI--ICQEISTLCDMLATHNG----QSIDISFPVFVAVTNV-ISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVK-IRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEID--QNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPD 469          
BLAST of EMLSAG00000001150 vs. SwissProt
Match: gi|38503035|sp|Q8HYN1.1|CP17A_PANTR (RecName: Full=Steroid 17-alpha-hydroxylase/17,20 lyase; AltName: Full=17-alpha-hydroxyprogesterone aldolase; AltName: Full=CYPXVII; AltName: Full=Cytochrome P450 17A1; AltName: Full=Cytochrome P450-C17; Short=Cytochrome P450c17)

HSP 1 Score: 151.369 bits (381), Expect = 2.706e-39
Identity = 137/454 (30.18%), Postives = 214/454 (47.14%), Query Frame = 0
Query:   16 YPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNF--------HRFPVAFCDS-SFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQE--ELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLN--QKFDDD----FLNTYQRIEKNKE----------------LILFALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKET-----RN-MVLLNACFYETVRLT-CSP-IIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFID-TETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKN 426
            YP      PL+GSL  L  +  +    F KL+K YG I+S+R+G+   V+V  ++L KEVL+ K   FS RP          +R  +AF DS +  Q  RR  +  F + K     L+++  +CQE   L  M+   N      +ID+   +  A  NV I   C   S+   D   N      + I   ++   L+D  PW  +F     + L SH K IR+ + NKIL N  +KF  D     L+T  + + N +                 IL  + D+ G G    T+V+   L  +L +  +KK+L +EI   Q + F  T     RN ++LL A   E +RL   +P +IPH++  D+SIG + V   T + IN   L+++   W++P  + P+RF++   T  +S    + PF  G RSC+G  L +      +A +L+  DL + +
Sbjct:   27 YPKSLLSLPLVGSLPFLPRHGHM-HNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKI--ICQEISTLCDMLATHNG----QSIDISFPVFVAVTNV-ISLICFNTSYKNGDPELNIIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVK-IRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEID--QNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTQVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPD 469          
BLAST of EMLSAG00000001150 vs. SwissProt
Match: gi|2493377|sp|P70687.1|CP17A_MESAU (RecName: Full=Steroid 17-alpha-hydroxylase/17,20 lyase; AltName: Full=17-alpha-hydroxyprogesterone aldolase; AltName: Full=CYPXVII; AltName: Full=Cytochrome P450 17A1; AltName: Full=Cytochrome P450-C17; Short=Cytochrome P450c17)

HSP 1 Score: 146.362 bits (368), Expect = 1.818e-37
Identity = 124/444 (27.93%), Postives = 208/444 (46.85%), Query Frame = 0
Query:   24 PLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF--------PVAFCDSSFLQEERRKL-IKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKIL--LNQKFDDDFL-----------------NTYQRIEKNK---ELILFALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQP----FQALTFKETRNMVLLNACFYETVRL--TCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPA-HFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNME 428
            PL+GSL  +  +   P   F KL++ YG I+S+R+GS   V++   +L KEVL+ K   FS RP+             +AF DS    +  RKL +  F + +  +  L+++  +CQ+  +  +  F +  N  +IDL   I  +  N+ I   C   S+   D +  +     + I   + N  L+D FPW ++F       +  + K IR  V + IL    +KF+ D +                 NT +    N      IL  + D+ G G     +V+  I+  +L + ++KK++QKEI       +  TF +  ++++L A   E +R+      +IPHR+  D SIG + +   T + IN   L++S   W +P  + P+RF+D     L  P+  + PF  G RSC+G  L +      +AH+L+  DL + + E
Sbjct:   35 PLVGSLPFIPRHGH-PHVNFFKLQEKYGPIYSLRLGSTTTVIIGQYQLAKEVLVKKGKEFSGRPHMVTLGLLSDQGKGIAFADSGGSWQLHRKLALSSFALFRDGNQKLEKI--ICQKASS--LCDFLLTHNEESIDLSEPIFNSITNI-ICIICFGISYENRDPILATIKSFTEGILNSLGNDHLVDIFPWLTIFPNKTVDMIKKNVK-IRDEVLSGILEKCKEKFNSDSISSLMDLLIQAKTNADNNNTSEGQGSNAFSDMHILATIADIFGAGIETTASVLSWIIAFLLHNPEVKKKIQKEIDQNIGFSRTPTFNDRNHLLMLEATIREVLRIRPVAPMLIPHRANSDMSIGEFSIPKFTPVIINLWALHHSEKEWDQPDRFMPERFLDPTGSHLITPSLSYLPFGAGARSCIGEVLARQELFLFMAHLLQRFDLDVPDDE 471          
BLAST of EMLSAG00000001150 vs. SwissProt
Match: gi|57012714|sp|Q91Z85.1|CP17A_PERLE (RecName: Full=Steroid 17-alpha-hydroxylase/17,20 lyase; AltName: Full=17-alpha-hydroxyprogesterone aldolase; AltName: Full=CYPXVII; AltName: Full=Cytochrome P450 17A1; AltName: Full=Cytochrome P450-C17; Short=Cytochrome P450c17)

HSP 1 Score: 145.206 bits (365), Expect = 4.650e-37
Identity = 115/444 (25.90%), Postives = 209/444 (47.07%), Query Frame = 0
Query:   24 PLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRFP--------VAFCDSSFLQEERRKL-IKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLN------QKFDDDFLNTYQRIEKNKEL------------------ILFALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQP----FQALTFKETRNMVLLNACFYETVRL--TCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPA-HFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKN 426
            PL+GSL  L  +  +    F KL++ YG I+S+R+G+   V++   +L +EVL+ K   FS RP              +AF DS    +  RKL +  F + +     L+ +  +CQE  +  +    +  N  ++DL   I  +  N+ I   C   S+   D +  +     + I   ++N  L+D FPW ++F     + +  H K     V +++L++      +KF++D ++    I    ++                  IL  + D  G G    T+V+  I+  +L + ++KK++QKEI       +  TF +  ++++L A   E +R+      +IPH++  D+SIG + +  DT + IN   L+++   W +P  + P+RF+D     L  P+  + PF  G R+C+G  L + +    VA +L+  DL + +
Sbjct:   35 PLVGSLPFLPRHGHMHVNFF-KLQEKYGPIYSLRLGTIPTVIIGQYQLAREVLIKKGKEFSGRPQMVTLGLLSNQGKGIAFADSDDAWQLHRKLALSSFALFRDGDQRLETI--ICQEASS--LCDLLLTHNEESVDLSQPIFMSVTNI-ICAICFSTSYENRDPILTTIQTFTEGILNCLDNENLVDIFPWLTIFPNKTLEKIKRHVK-----VRDEVLIDMLEKCKEKFNNDSISNLTDILIQAKMNADNNNTTDHQGSFSDSHILSTVGDFFGAGIETTTSVLCWIVAFLLHNPEVKKKIQKEIDQNIGFSRTPTFNDRNHLLMLEATIREVLRIRPVAPMLIPHKANIDSSIGEFTIPKDTHVVINLWALHHNEKEWDQPDRFMPERFLDATGSHLITPSLSYLPFGAGPRACIGEVLARQVLFLYVACLLQRFDLDVPD 467          
BLAST of EMLSAG00000001150 vs. SwissProt
Match: gi|57015309|sp|Q29497.2|CP17A_SHEEP (RecName: Full=Steroid 17-alpha-hydroxylase/17,20 lyase; AltName: Full=17-alpha-hydroxyprogesterone aldolase; AltName: Full=CYPXVII; AltName: Full=Cytochrome P450 17A1; AltName: Full=Cytochrome P450-C17; Short=Cytochrome P450c17)

HSP 1 Score: 140.198 bits (352), Expect = 2.629e-35
Identity = 131/470 (27.87%), Postives = 218/470 (46.38%), Query Frame = 0
Query:    1 LTVIYYFY--NGKNNNIYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNF--------HRFPVAFCD-SSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNS--------------HCK--FIRSFVEN--KILLNQKFDDDFLNTYQRIEKNKELI-----LFALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKET-----RN-MVLLNACFYETVRL--TCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFID-TETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKN 426
            LT+ Y F+     +   YP      PL+GSL  L    +   E F KL++ YG I+S R+GS   V++  ++L +EVLL K   FS RP          ++  +AF D  +  Q  R+ ++  F + K  +L   +L+++  +E N ++  F   ++  +IDL   +S A  N+ I + C   SF  +D    +     D I   +    L+D FP   +F     + +                 C+  F    + N   IL+  K + D  NT    E++ +L+     L  + D+ G G    T+VI  I+ ++L H  +KK +Q  I   Q + F  T     RN +VLL A   E +R+      +IPH++  D+SIG+  +   T + +N   L+++   W +P  + P+RF+D T T  +S    + PF  G RSCVG  L +      ++ +L+  +L I +
Sbjct:   10 LTLAYLFWPKTKHSGAKYPRSLPSLPLVGSLPFLPRRGQ-QHENFFKLQEKYGPIYSFRLGSKTTVMIGHHQLAREVLLKKGKEFSGRPKVATLDILSDNQKGIAFADHGAHWQLHRKLVLNAFALFKDGNL---KLEKIINQEAN-VLCDFLATQHGQSIDLSEPLSLAVTNI-ISFICFNFSFKNEDPALKAIQNVNDGILEVLGKEVLLDIFPALKIFPSKAMEKMKGCVETRNELLSEILEKCQENFTSDSITNLLHILMQAKVNADNNNTGP--EQDSKLLSNRHMLATIADIFGAGVETTTSVIKWIVAYLLHHPSLKKRIQDSID--QNIGFNRTPTISDRNRLVLLEATIREVLRIRPVAPMLIPHKAIIDSSIGDLTIDKGTDVVVNLWALHHNEKEWQQPDLFMPERFLDPTGTQLISPSLSYLPFGAGPRSCVGEMLARQELFLFMSRLLQRFNLEIPD 469          
BLAST of EMLSAG00000001150 vs. SwissProt
Match: gi|57012725|sp|Q9N0U7.1|CP17A_CAPHI (RecName: Full=Steroid 17-alpha-hydroxylase/17,20 lyase; AltName: Full=17-alpha-hydroxyprogesterone aldolase; AltName: Full=CYPXVII; AltName: Full=Cytochrome P450 17A1; AltName: Full=Cytochrome P450-C17; Short=Cytochrome P450c17)

HSP 1 Score: 140.198 bits (352), Expect = 3.268e-35
Identity = 129/469 (27.51%), Postives = 220/469 (46.91%), Query Frame = 0
Query:    1 LTVIYYFYNGKNNNI--YPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNF--------HRFPVAFCD-SSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKIL--LNQKFDDDFLNTYQRI---------------EKNKELI-----LFALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKET-----RN-MVLLNACFYETVRL--TCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFID-TETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKN 426
            LT+ Y F+    ++   YP      PL+GSL  L    +   E F KL++ YG I+S R+GS   V++  ++L +EVLL K   FS RP          ++  +AF D  +  Q  R+ ++  F + K  +L   +L+++  +E N ++  F   ++  +IDL   +S A  N+ I + C   SF  +D    +     D I   ++   L+D FP   +F     + +   C   R+ + N+IL    + F  D +     I               +++ +L+     L  + D+ G G    T+VI  I+ ++L H  +KK +Q  I   Q + F  T     RN +VLL A   E +R+      +IPH++  D+SIG+  +   T + +N   L+++   W +P  + P+RF+D T T  +S    + PF  G RSCVG  L +      ++ +L+  +L I +
Sbjct:   10 LTLAYLFWPKTKHSAAKYPRSLPSLPLVGSLLFLPRRGQ-QHENFFKLQEKYGPIYSFRLGSKTTVMIGHHQLAREVLLKKGKEFSGRPKVATLDILSDNQKGIAFADHGAHWQLHRKLVLNAFALFKDGNL---KLEKIINQEAN-VLCDFLATQHGQSIDLSEPLSLAVTNI-ISFICFNFSFKNEDPALKAIQNVNDGILEVLSKEILLDIFPALKIFPSKAMEKMKG-CVETRNELLNEILEKCQENFTSDSITNLLHILMQAKVNADNNNAGPDQDSKLLSNRHMLATIADIFGAGVETTTSVIKWIVAYLLHHPSLKKRIQDSID--QNIGFNRTPTISDRNCLVLLEATIREVLRIRPVAPMLIPHKAIIDSSIGDLTIDKGTDVVVNLWALHHNEKEWQQPDLFMPERFLDPTGTQLISPSLSYLPFGAGPRSCVGEMLARQELFLFMSRLLQRFNLEIPD 469          
BLAST of EMLSAG00000001150 vs. SwissProt
Match: gi|2493376|sp|Q64410.1|CP17A_CAVPO (RecName: Full=Steroid 17-alpha-hydroxylase/17,20 lyase; AltName: Full=17-alpha-hydroxyprogesterone aldolase; AltName: Full=CYPXVII; AltName: Full=Cytochrome P450 17A1; AltName: Full=Cytochrome P450-C17; Short=Cytochrome P450c17)

HSP 1 Score: 138.272 bits (347), Expect = 1.199e-34
Identity = 122/463 (26.35%), Postives = 213/463 (46.00%), Query Frame = 0
Query:    1 LTVIYYFYNGKNNNIYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRP--------NFHRFPVAFCDSSFL-QEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKIL--LNQKFDDDFL---------------NTYQRIEKNKEL-----ILFALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQP----FQALTFKETRNMVLLNACFYETVRLT-CSPI-IPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIP-AHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSI 424
            L  +++   G +   YP      P++GSL  L     +    F KL+K YG I+S R+GS   VV+  ++L +E+L+ K   FS RP        + +   +AF DSS   Q  RR ++  F++ +     L+ +  +CQE     +  F    +    DL S I     N+ I   C   S+   D    +           +++  L+D FPW  +F     + +  + + IR  + +KIL    +KF  D +               N    ++++  L     IL  L D+ G G    ++V+L ++  +L +  +KK++Q+EI       +  TF +  ++++L A   E +R+   +PI IPH++  D+SIG + +  DT + +N   L+++   W  P  + P+RF+D     + +P + + PF  G RSCVG  L +       A +L+  DL +
Sbjct:   12 LAYLFWPRQGSSGTKYPKSLPSLPVVGSLPFLPKSGHMHVNFF-KLQKKYGPIYSFRLGSTTTVVIGHHQLARELLIKKGKEFSGRPLTTTVALLSDNGKGIAFADSSATWQLHRRLVLSSFSLFRDGEQKLENI--ICQEL--SALCDFLATCDGQVKDLSSSIFMTVVNI-ICMICFSVSYKEGDMELVTIRRFTTGFVNSLSDDNLVDIFPWLKIFPNKTLEMIRKYTE-IRGAMLSKILKECKEKFRSDSVSNLIDLLIQAKVNENNNNSSLDQDSNLFSDKHILTTLGDIFGAGVETSSSVVLWVIAFLLHNPQVKKKIQEEIDHNVGFSRTPTFSDRNHLLMLEATIREVLRIRPVAPILIPHKANTDSSIGEFAIDKDTNVLVNLWALHHNEQEWDRPDQFMPERFLDPTGSQIIVPSSSYLPFGAGPRSCVGEALARQEIFLITAWLLQKFDLEV 467          
BLAST of EMLSAG00000001150 vs. SwissProt
Match: gi|38503034|sp|Q8HYN0.1|CP17A_PAPCY (RecName: Full=Steroid 17-alpha-hydroxylase/17,20 lyase; AltName: Full=17-alpha-hydroxyprogesterone aldolase; AltName: Full=CYPXVII; AltName: Full=Cytochrome P450 17A1; AltName: Full=Cytochrome P450-C17; Short=Cytochrome P450c17)

HSP 1 Score: 137.887 bits (346), Expect = 1.660e-34
Identity = 128/455 (28.13%), Postives = 204/455 (44.84%), Query Frame = 0
Query:   16 YPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNF--------HRFPVAFCD-SSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQE--ELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCK----FIRSFVEN--------------KILLNQKFDDDFLNTYQRIEKNKEL-----ILFALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKET-----RN-MVLLNACFYETVRL--TCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFID-TETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKN 426
            YP      PL+GSL  L  +  +    F KL+K YG I+S+R+G+   V+V  ++L KEVL+ K   FS RP          +R  +AF D  +  Q  RR  +  F + K     L+++  +CQE   L  M+   N       ID+   +  A  NV I   C   S+   D          + I   +    L+D FPW  +F     + L  H K     +    EN               +L+  K + D  N     +++ EL     IL  + D+ G G    T+V+  I+  +L +  +KK+L +EI   Q + F  T     RN ++LL A   E +R+      +IPH++  D+SIG + V   T + IN   L+++   W++P  + P+RF++   T  +S    + PF  G RSC+G  L +      +A +L+  DL + +
Sbjct:   27 YPKSLLSLPLVGSLPFLPRHGHM-HNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQVTTLDILSNNRKGIAFADYGAHWQLHRRLAMATFALFKDGDQKLEKI--ICQEISTLCDMLATHNG----QTIDISFPVFVAITNV-ISLICFNISYKNGDPELKIVHNYNEGIIDSLGKESLVDLFPWLKVFPNKTLEKLKRHVKTRNDLLTKIFENYKEKFRSDSITNMLDVLMQAKMNSD--NGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWIVAFLLHNPQVKKKLYEEID--QNVGFSRTPTISDRNRLLLLEATIREVLRIRPVAPMLIPHKANVDSSIGEFAVDKGTHVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSLSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPD 469          
BLAST of EMLSAG00000001150 vs. SwissProt
Match: gi|38503033|sp|Q8HYM9.1|CP17A_MACMU (RecName: Full=Steroid 17-alpha-hydroxylase/17,20 lyase; AltName: Full=17-alpha-hydroxyprogesterone aldolase; AltName: Full=CYPXVII; AltName: Full=Cytochrome P450 17A1; AltName: Full=Cytochrome P450-C17; Short=Cytochrome P450c17 >gi|85718634|sp|Q2XVA1.1|CP17A_MACFA RecName: Full=Steroid 17-alpha-hydroxylase/17,20 lyase; AltName: Full=17-alpha-hydroxyprogesterone aldolase; AltName: Full=CYPXVII; AltName: Full=Cytochrome P450 17A1; AltName: Full=Cytochrome P450-C17; Short=Cytochrome P450c17)

HSP 1 Score: 137.887 bits (346), Expect = 1.677e-34
Identity = 128/455 (28.13%), Postives = 204/455 (44.84%), Query Frame = 0
Query:   16 YPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNF--------HRFPVAFCD-SSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQE--ELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCK----FIRSFVEN--------------KILLNQKFDDDFLNTYQRIEKNKEL-----ILFALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKET-----RN-MVLLNACFYETVRL--TCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFID-TETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKN 426
            YP      PL+GSL  L  +  +    F KL+K YG I+S+R+G+   V+V  ++L KEVL+ K   FS RP          +R  +AF D  +  Q  RR  +  F + K     L+++  +CQE   L  M+   N       ID+   +  A  NV I   C   S+   D          + I   +    L+D FPW  +F     + L  H K     +    EN               +L+  K + D  N     +++ EL     IL  + D+ G G    T+V+  I+  +L +  +KK+L +EI   Q + F  T     RN ++LL A   E +R+      +IPH++  D+SIG + V   T + IN   L+++   W++P  + P+RF++   T  +S    + PF  G RSC+G  L +      +A +L+  DL + +
Sbjct:   27 YPKSLLSLPLVGSLPFLPRHGHM-HNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQVTTLDILSNNRKGIAFADYGAHWQLHRRLAMATFALFKDGDQKLEKI--ICQEISTLCDMLATHNG----QTIDISFPVFVAITNV-ISLICFNISYKNGDPELKIVHNYNEGIIDSLGKESLVDLFPWLKVFPNKTLEKLKRHVKTRNDLLTKIFENYKEKFHSDSITNMLDVLMQAKMNSD--NGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWIVAFLLHNPQVKKKLYEEID--QNVGFSRTPTISDRNRLLLLEATIREVLRIRPVAPMLIPHKANVDSSIGEFAVDKGTHVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSLSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPD 469          
BLAST of EMLSAG00000001150 vs. Select Arthropod Genomes
Match: gb|EFA11558.2| (cytochrome P450 307A1 [Tribolium castaneum])

HSP 1 Score: 300.056 bits (767), Expect = 7.532e-95
Identity = 166/463 (35.85%), Postives = 259/463 (55.94%), Query Frame = 0
Query:    5 YYFYNGKNNNIYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPW-TSLFAGFVQQPLNSHCKFIRSFVENKILLNQK-----------FDDDFL-NTYQRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALT----FKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLATKP 440
            ++F   K +    PGP  WPLIGS+HLL  +E  PF+AFT L ++YGDIFSI +GS +CVVVN  +L KEVL+AK   F  RP+F RF           +A CD S LQ+ RR + + +  P+  SL  DR++ + +EEL   + Q +   +    ++K  +    AN+F +Y CS  SF+Y+DK F   +  +D IFWE+N G  +DF PW   ++ G +++ +++    IR F+ ++I+   +           F D  L +  +    N + I+F LED +GGHSA+ N+++  L  +++H ++ K +Q+E+      T      +   M    A   ET+R   SPI+PH + +DT I  + V   T++FINN+ LN   + W EP  + P+RF+ + TG +  PAHF PFS G+R+C+G +L Q      +A +L+  D+S K   + + PG +A  P
Sbjct:  126 WWFSRPKKSPSTIPGPRPWPLIGSMHLLAGHE-TPFQAFTALSRVYGDIFSIHLGSASCVVVNNFKLIKEVLIAKGGDFGGRPDFARFHKLFGGDRNNSLALCDWSSLQKTRRSIARTYCSPRFTSLQYDRVNNVGEEELKSFLHQLDQLPHGQPCNVKPAVLMVCANMFTQYMCST-SFAYEDKGFQKIVRYFDEIFWEINQGYAVDFLPWLLPVYTGHMKK-ISNWATEIRQFILSRIIDKHRATLDTNSPPRDFTDALLMHLEEDPNMNWQHIIFELEDFLGGHSAIGNLVMVTLAAVVDHPEVAKRIQEEVDQVTGGTRCPNLFDKAAMPYTEATILETLRTASSPIVPHVASKDTEIDGHEVSKGTIVFINNYELNQGDAYWDEPGLFKPERFL-SSTGNIVKPAHFIPFSTGKRTCIGQRLVQCFSFVVLATLLQYYDVSTKE-SVKVQPGCVAVPP 583          
BLAST of EMLSAG00000001150 vs. Select Arthropod Genomes
Match: EFX88041.1 (ecdysone biosynthesis protein [Daphnia pulex])

HSP 1 Score: 273.092 bits (697), Expect = 4.850e-85
Identity = 161/462 (34.85%), Postives = 244/462 (52.81%), Query Frame = 0
Query:   26 IGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRFPV----------AFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWT----NIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKI-----------------------LLNQKFDDDFLNTYQRIEKNKEL----ILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF-----QALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWY-EPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLATKP 440
            IGSLHLL  YE +PFEAF++L KIYGDIFSI +GS  CVVVN  +L KEVL+ K  HF  RPNF R+ +          A CD S+LQ +RR + + +  P+  S+  D L R+   E + M+ + ++          IDLK+ +    ANVF  Y CS   F Y++K F   +  +D IFW++N G  +DF PW         Q L S    IR F+   I                       L N+K + + +      +  K+L    +L+ LED +GGHSA+ N+++R +  +     +   +Q+EI+       + +  ++  +M    A   ET+RL+ SPI+PH + ++TS+  Y V+  T++F+NN+ LN SP  W  + L ++P RFI    G +  P +F PFS G+R+C+GY+L Q +   ++A +L+  D+S     I LP   +A  P
Sbjct:   71 IGSLHLLGQYE-VPFEAFSELSKIYGDIFSITLGSTPCVVVNSFKLIKEVLITKGPHFGGRPNFIRYDILFGGDRDNSLALCDWSYLQRDRRSIARHWCHPRVDSMQFDTLSRVLTSESDLMVNELSLMTAAAAAGKGIDLKTTMMTMCANVFTHYMCSTR-FDYNNKEFGKVVRLFDQIFWDINQGYAVDFLPWLMPVYRRHMQQLKSWGTDIRQFIVKTIIDEHRSTMDVNNPRDFTDVLLSQLGNEKNNGENVQAADHNDNEKQLDWNHVLYELEDFLGGHSAIGNLLMRAVGELCSSPHVMANIQEEIRKVTCDNSRPVVLEDRPSMPYTEATILETLRLSSSPIVPHVAMQNTSVAGYDVQEGTMVFLNNYELNISPDYWGDQALTFDPARFI--IQGKIVKPEYFIPFSTGKRACMGYRLVQHVSFVTLATLLQNFDVSASEDVIHLPKACVAVPP 528          
BLAST of EMLSAG00000001150 vs. Select Arthropod Genomes
Match: EAA10112.4 (AGAP008682-PA, partial [Anopheles gambiae str. PEST])

HSP 1 Score: 271.937 bits (694), Expect = 5.120e-85
Identity = 153/459 (33.33%), Postives = 255/459 (55.56%), Query Frame = 0
Query:   18 PGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLN--QKFDD-----DFLNTY-QRIEKNK------ELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF------QALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLS-IKNMEISLPPGMLATKPGPVVF 445
            PGP  +P+IG+L  L  YE +P++AF+ + + YG + ++R+GS N VVVNG E  KEVL+ K  HF  RPNF R+           +AFCD S +Q+ RR ++   T P+++S   D L+ +  +E+  M+      ++ T + +K  +    AN F +YF S H F  +D  F   + ++D IF+EVN G   DF P+         + ++   + IR+ + + I+ +  +++ +     D++++  + ++  +      E  LFALED++GGHSAV N +++   +I++H ++++ +Q E          Q +   +   M    A   E +RL  SPI+PH + +D+ IG Y V  DT+IF+NN+ L+ SP+LW EP  + P+RF+  + G L  P  F PF  GRRSC+GY++TQL+    +A++L+   ++ I   +  +P G LA      VF
Sbjct:   47 PGPKNYPIIGALKELNGYE-VPYQAFSDMGQRYGPVTALRLGSVNAVVVNGFESIKEVLINKGQHFDSRPNFRRYQLLFSGNKENSLAFCDWSEVQKARRDMLVPHTFPRNYSGRFDELNTIVVDEIGQML---GSVQHGTTVAIKPLVLSICANAFSQYFGS-HRFEVEDPRFQQLVRNFDQIFYEVNQGYAADFLPFLLPLHRQNLRRMDRLAEEIRTIILDTIIGDRYERWGEGSEPRDYVDSLIEHVKAGRGPALEWETALFALEDIVGGHSAVGNFLVKAFGYIVQHPEVQQRIQAEADGVLERHGRQVIELTDRAEMQYTEAVIMEALRLIASPIVPHVANQDSQIGGYTVAKDTLIFLNNYDLSMSPALWDEPERFRPERFL--QQGRLVKPDFFIPFGAGRRSCMGYRMTQLLSFSIIANLLRAYTIAPIAGQDYRVPVGSLAMPEQSYVF 498          
BLAST of EMLSAG00000001150 vs. Select Arthropod Genomes
Match: gb|EFA05673.1| (cytochrome P450 307B1 [Tribolium castaneum])

HSP 1 Score: 269.24 bits (687), Expect = 3.077e-84
Identity = 156/449 (34.74%), Postives = 237/449 (52.78%), Query Frame = 0
Query:   17 PPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLNQKFD--------DDFLNTYQRIEKNKEL-------ILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKETRNMVLL---NACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLA 437
            PP P   P+IG LHL+  Y+ +P++AFT L K +G +F +++G   CVV+NG +  +E L+ K  HF  RPNF R+           +AFC+ S  Q+ RR ++K +T P++ +     L+ L       ++   +     T    KS IS+  AN+F R+FCS  SF  D+  F   + +YD IF+EVN G   DF P+   F     + +N     IR FV + I+   +FD        DD++ +  +  K+ E         LFALED+IGGHSAV N ++++   + +   +++ + KEI            +  LL    A  +E +RL  SPI+P  + RD+SI    ++  TVIF+NN+ L+ SP LW EP  + P+RFI  E   L  P HF PF  GRRSC+GYK+ QL+    +  I++   +   +   ++P G LA
Sbjct:   35 PPSPLKLPIIGHLHLMSGYQ-VPYQAFTSLSKKFGSVFGLQLGYVKCVVINGQKNIREALVTKGHHFDSRPNFERYQQLFSGNKENSLAFCNWSTTQKTRRDMLKAYTFPRAFTNRFYTLEELVSSGTRSVVAALSTNTTST----KSVISRHCANIFTRHFCS-KSFDVDEATFVEMVDNYDEIFYEVNQGYAADFLPFLLPFHEKNLKRVNGLTHKIRDFVLDHII-EGRFDSFDVQAEPDDYVESLIKYVKSGESPQLSWDSALFALEDIIGGHSAVANFLVKLFAFLAKEPQVQENIHKEIDRVLGTKEVSISHRTLLPYTEATIFEAIRLIASPIVPRVANRDSSINGLEIEKGTVIFLNNYDLSMSPQLWDEPEKFKPERFIREER--LVKPEHFLPFGGGRRSCMGYKMVQLVSFGILGGIMQNFTIGADDTSYTVPVGSLA 474          
BLAST of EMLSAG00000001150 vs. Select Arthropod Genomes
Match: EEB17258.1 (cytochrome P450, putative [Pediculus humanus corporis])

HSP 1 Score: 268.47 bits (685), Expect = 8.509e-84
Identity = 159/451 (35.25%), Postives = 243/451 (53.88%), Query Frame = 0
Query:   18 PGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQF-NMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLNQK------------FDDDFLNTYQRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF----QALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNM-EISLPPGMLATKP 440
            PGP  WPLIGSLHL+      PF+ FTKL K YG I+SI +GS +CVVVN   L K+VL++K  HF  RP+F RF           +A CD + LQ+ RR + + +  P+  S + DRL  +  +E+N  I +  N+     +++LK  I    AN+F  Y CS   F+YDDK F   +L +D IFWE+N G  +DF PW   F       L+   K IR F+ ++I+ + +             D   L+  +    N + I+F LED +GGHSA+ N+++  L  I+++ ++  ++Q+EI       + +   +  +M    A   ET+R++ SPI+PH + +DT I  Y VK  +V+F+NN+ LN     W +P  + P+RFI      +  P  F PFS G+R+C+G +L Q      +A IL+  ++S  ++  I   P  +A  P
Sbjct:   34 PGPRPWPLIGSLHLMGGSSS-PFQVFTKLSKTYGSIYSITLGSSSCVVVNSFNLIKKVLISKGGHFGGRPDFIRFHKLFGGDRNNSLALCDWADLQKTRRSIARLYCSPRFASTNYDRLREVGLQEMNEFICELSNITTKSHDVELKPLIMATCANMFTSYMCSTR-FNYDDKEFTKTVLLFDNIFWEINQGYAVDFLPWLLPFYNRHMNRLSKWSKDIRQFILSRIIDHHRSTLDPNAPPRDFTDALLLHLEEDELLNWQHIIFELEDFLGGHSAIGNLVMLALAGIVKNPEVGTKIQEEIDRVVGNCRPVDLFDKPDMPFTEATILETLRMSSSPIVPHVANQDTMIEGYFVKKGSVVFLNNYELNTGEKYWSDPKKFKPERFIINNQ--IMKPEFFIPFSTGKRTCIGQRLVQGFSFILLATILQNYNVSCSDLSSIHFQPACVALPP 480          
BLAST of EMLSAG00000001150 vs. Select Arthropod Genomes
Match: EAL41693.4 (AGAP001039-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 262.307 bits (669), Expect = 5.097e-81
Identity = 158/467 (33.83%), Postives = 247/467 (52.89%), Query Frame = 0
Query:   18 PGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFN-MFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKIL-----------LNQKFDDDFLNTYQRIEKN--KELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF-----QALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNP----KRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNME-ISLPPGMLATKPG--PVVFCSK 448
            PGP  WP++GSL  L  Y+ +PFE FT L K YGD++SI +GS  C+VVN  +L +EVL     +F  RP+F RF           +A CD S LQ++RR L +K   P   S    ++  +   E++  + Q + +     +  +K  I +A AN+F  Y CS+  F Y+D+ F S + ++D IFWE+N G  +DF PW + F       L      IR F+  +I+             + F D  L +  R++ +  ++ I++ LED +GGHSA+ N+++  L +I +H ++   +Q+EI        + +T  +T +M    A  +E +R + SPI+PH +  DT I  Y V   TV+FINN+ LN S   W EP  +NP    +R +  E    +IP HF PFSIG+R+C+G  L +      +A+IL+  D+   ++  I + P  +A  P   P+ F  +
Sbjct:   66 PGPVPWPILGSLAFLGQYD-VPFEGFTALAKKYGDLYSITLGSTRCLVVNNLDLIREVLNQNGRYFGGRPDFLRFHKLFGGDRNNSLALCDWSTLQQKRRNLARKHCSPSDASSYYQKMSDVGVMEMHRFMDQLDEVVCPGKDFKVKPLIMQACANMFSEYMCSVR-FDYNDQGFMSIVRNFDEIFWEINQGYAVDFLPWLAPFYHKHMSKLTRWSAEIRDFILERIVNEREQTLGDDDTERDFADALLKSL-RLDPSVTRDTIMYMLEDFLGGHSAIGNLVMLALGYIAKHPEVGHRIQREIDRITERGKRNVTLYDTESMPYTVATIFEVLRYSSSPIVPHVATEDTCIAGYGVTKGTVVFINNYELNTSERYWSEPKRFNPSRENERTLQIERVRKNIP-HFLPFSIGKRTCIGQNLVRGFSFIIIANILQKYDVHSNDLSLIKMYPACVAVPPDTYPLAFTQR 528          
BLAST of EMLSAG00000001150 vs. Select Arthropod Genomes
Match: EGK96302.1 (AGAP001039-PB [Anopheles gambiae str. PEST])

HSP 1 Score: 257.299 bits (656), Expect = 9.553e-79
Identity = 163/502 (32.47%), Postives = 250/502 (49.80%), Query Frame = 0
Query:   18 PGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFN-MFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKIL-----------LNQKFDDDFLNTYQRIEKN--KELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF-----QALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTET-------------------------GFLS--------------IPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNME-ISLPPGMLATKPG--PVVFCSK 448
            PGP  WP++GSL  L  Y+ +PFE FT L K YGD++SI +GS  C+VVN  +L +EVL     +F  RP+F RF           +A CD S LQ++RR L +K   P   S    ++  +   E++  + Q + +     +  +K  I +A AN+F  Y CS+  F Y+D+ F S + ++D IFWE+N G  +DF PW + F       L      IR F+  +I+             + F D  L +  R++ +  ++ I++ LED +GGHSA+ N+++  L +I +H ++   +Q+EI        + +T  +T +M    A  +E +R + SPI+PH +  DT I  Y V   TV+FINN+ LN S   W EP  +NP RFI+T T                         G  S              IP HF PFSIG+R+C+G  L +      +A+IL+  D+   ++  I + P  +A  P   P+ F  +
Sbjct:   66 PGPVPWPILGSLAFLGQYD-VPFEGFTALAKKYGDLYSITLGSTRCLVVNNLDLIREVLNQNGRYFGGRPDFLRFHKLFGGDRNNSLALCDWSTLQQKRRNLARKHCSPSDASSYYQKMSDVGVMEMHRFMDQLDEVVCPGKDFKVKPLIMQACANMFSEYMCSVR-FDYNDQGFMSIVRNFDEIFWEINQGYAVDFLPWLAPFYHKHMSKLTRWSAEIRDFILERIVNEREQTLGDDDTERDFADALLKSL-RLDPSVTRDTIMYMLEDFLGGHSAIGNLVMLALGYIAKHPEVGHRIQREIDRITERGKRNVTLYDTESMPYTVATIFEVLRYSSSPIVPHVATEDTCIAGYGVTKGTVVFINNYELNTSERYWSEPKRFNPSRFIETATLAQIRTDLRDSPTAKQDLTNIIKTNGVSSENERTLQIERVRKNIP-HFLPFSIGKRTCIGQNLVRGFSFIIIANILQKYDVHSNDLSLIKMYPACVAVPPDTYPLAFTQR 563          
BLAST of EMLSAG00000001150 vs. Select Arthropod Genomes
Match: AHN57968.1 (spook, isoform C [Drosophila melanogaster])

HSP 1 Score: 246.899 bits (629), Expect = 4.667e-75
Identity = 160/474 (33.76%), Postives = 243/474 (51.27%), Query Frame = 0
Query:   18 PGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQF-NMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKF---IRSFVENKILLNQKF-------DDDFLNT-----YQRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF-----QALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFID------------TETGFLS----------IPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKN-MEISLPPGMLA 437
            PGP  WP+IG+LHLL  Y   PF  FT L + YGDI+S+  G   C+VVN  EL +EVL       S RP+F R+           +A CD S LQ++RR L ++   P+  S    ++ ++  EE+ H   +  N       I++K  I KA AN+F +Y CS+  F YDD  F   +  +D IFWE+N G  +DF PW      F Q+ LN    +   IR F+  +I+ +++        D DF +       +  + ++  I+F LED IGGHSAV N+++ +L +I ++ DI + +Q+EI        +++   +   M    A  +E +R + SPI+PH +  DT I  Y V   T++FINN+ LN S   W  P  +NP RF++            +++G  S          IP HF PFSIG+R+C+G  L +      V ++++  ++S  N   I + P  LA
Sbjct:   56 PGPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLVPGEPINIKPLILKACANMFSQYMCSLR-FDYDDVDFQQIVQYFDEIFWEINQGHPLDFLPW---LYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDALLKSLLEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLRYSSSPIVPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIP-HFLPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNISSHNPSTIKISPESLA 524          
BLAST of EMLSAG00000001150 vs. Select Arthropod Genomes
Match: AAF50766.3 (spook, isoform A [Drosophila melanogaster])

HSP 1 Score: 246.899 bits (629), Expect = 4.667e-75
Identity = 160/474 (33.76%), Postives = 243/474 (51.27%), Query Frame = 0
Query:   18 PGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQF-NMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKF---IRSFVENKILLNQKF-------DDDFLNT-----YQRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF-----QALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFID------------TETGFLS----------IPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKN-MEISLPPGMLA 437
            PGP  WP+IG+LHLL  Y   PF  FT L + YGDI+S+  G   C+VVN  EL +EVL       S RP+F R+           +A CD S LQ++RR L ++   P+  S    ++ ++  EE+ H   +  N       I++K  I KA AN+F +Y CS+  F YDD  F   +  +D IFWE+N G  +DF PW      F Q+ LN    +   IR F+  +I+ +++        D DF +       +  + ++  I+F LED IGGHSAV N+++ +L +I ++ DI + +Q+EI        +++   +   M    A  +E +R + SPI+PH +  DT I  Y V   T++FINN+ LN S   W  P  +NP RF++            +++G  S          IP HF PFSIG+R+C+G  L +      V ++++  ++S  N   I + P  LA
Sbjct:   56 PGPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLVPGEPINIKPLILKACANMFSQYMCSLR-FDYDDVDFQQIVQYFDEIFWEINQGHPLDFLPW---LYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDALLKSLLEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLRYSSSPIVPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIP-HFLPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNISSHNPSTIKISPESLA 524          
BLAST of EMLSAG00000001150 vs. Select Arthropod Genomes
Match: EDP28053.2 (spookier [Drosophila melanogaster])

HSP 1 Score: 228.794 bits (582), Expect = 4.669e-68
Identity = 149/479 (31.11%), Postives = 233/479 (48.64%), Query Frame = 0
Query:   18 PGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFV--------ENKILLNQ---KFDDDFLNTYQRIEKN--KELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTFKETRNMVLLN--------ACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDT------ETGF------------------------------------LSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLS 423
            PGP  WP+IG+++LL  ++  PF  F  L K YGDI+S+ +G   C+VVN  +L KEVL     +F  RP+F R+           +A CD S LQ++RR L ++   P+  S    ++  +   E+N ++ Q     +    D+K  I  A+AN+F +Y CS+  F+Y DK F   I  +D IFWE+N G   D+ PW   F       +      IR F+        E+ I +N+    F D  L + +  +KN  +  I+F LED IGGHSAV N+++  L +I ++  I   ++ E+    A   K  R + L +        A   E +R + SPI+PH +  DT I  + V+  T++FINN+ LN S S W  P  ++P+RF++       E+G                                      SIP  F PFS+G+R+C+G  L +      +A+I++  +++
Sbjct:   52 PGPHPWPIIGNINLLGRFQYNPFYGFGTLTKKYGDIYSLSLGHTRCIVVNNVDLIKEVLNKNGKYFGGRPDFFRYHKLFGGDRNNSLALCDWSQLQQKRRNLARRHCSPRESSSYFSKMSEIGGLEVNQLLDQLTNISSGYPCDVKPLILAASANMFCQYMCSVR-FNYSDKGFQKIIEYFDEIFWEINQGYSFDYIPWLVPFYCNHISRIVHWSASIRKFILERIVNHRESNININEPDKDFTDALLKSLKE-DKNVSRNTIIFMLEDFIGGHSAVGNLVMLALAYIAKNPTIALHIRNEVDTVSA---KGIRRICLYDMNVMPYTMASISEVLRYSSSPIVPHVAMEDTVIKGFGVRKGTIVFINNYVLNMSESFWNHPEQFDPERFLENNFTNNKESGLKCDDNKRTEFIRKNDNDGSTKSKKYGKQNLNNKLLKKSIP-QFLPFSVGKRTCIGQSLVRGFGFLLLANIIQNYNVN 524          
BLAST of EMLSAG00000001150 vs. nr
Match: gi|939635450|ref|XP_014293876.1| (PREDICTED: cytochrome P450 307a1-like [Halyomorpha halys])

HSP 1 Score: 295.049 bits (754), Expect = 1.245e-91
Identity = 165/437 (37.76%), Postives = 252/437 (57.67%), Query Frame = 0
Query:   18 PGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLNQKFDDDFLNTYQRIEK----NKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF---QALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLA 437
            PGP   P++GSLHLL  YE +P++AF KL   YG +F IR+GS  C+VV+  +  KEVL+ K +HF  RPNF R+           +AFCD S LQ+ RR++I+  T PK+ S    +L+ L  +EL  ++L   + K  TNI  K  +    ANVF+ +F +   F   D  F + ++ +D IF+EVN G   DF PW +       + +    K IR F++ +++ N   + D L+T     K    N+E  +FALED+IGGH+A+ N+I++IL  I    +++K++Q+E+      + +  ++   M    A   E++R  CSPI+PH + +DT+I +Y V+  T+IF+NN+ LN S  LW EP  + P+RF+ TE G L  P HF PF  GRRSC+GYK+TQ +    +A +++   ++       +P G LA
Sbjct:   35 PGPLPLPVLGSLHLLGGYE-LPYQAFDKLATKYGPVFGIRLGSVQCLVVSSLDTVKEVLINKGEHFDSRPNFSRYLNIFGGDKDNSLAFCDWSELQKTRREMIRDHTFPKAFSSKFHQLESLLNKEL--VVLSDQLSKGITNI--KPIMLHTCANVFMSFFTNTR-FQLGDIDFANILMYFDIIFYEVNQGYAADFMPWLNPMLTNNMKKMRKLGKIIRQFMDERVVCNGGQEGDLLHTLLESVKTGKMNRENAMFALEDIIGGHTAIANLIIKILGFISTQTEVQKKMQEEVDAVTCGKHIKLEDRLMMPYTEAVILESIRHICSPIVPHVASQDTTINDYQVEKGTLIFLNNYTLNMSTELWTEPEKFAPERFL-TEDGRLIKPEHFLPFGGGRRSCMGYKMTQYVSFSVLATMMQKYSITPDPTNGKVPRGDLA 464          
BLAST of EMLSAG00000001150 vs. nr
Match: gi|1080034663|ref|XP_018568738.1| (PREDICTED: cytochrome P450 307a1-like [Anoplophora glabripennis])

HSP 1 Score: 293.123 bits (749), Expect = 1.082e-90
Identity = 163/467 (34.90%), Postives = 254/467 (54.39%), Query Frame = 0
Query:    1 LTVIYYFYNGKNNNIYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPW-TSLFAGFVQQPLNSHCKFIRSFVENKILLNQK-----------FDDDFL-NTYQRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF----QALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLATKP 440
            + V+++    + ++   PGP  WP+IGSLH+L  Y K PFEAFT L K+YGDIF I +G   CVVVN   L KEVL+ K   F  RP+F R+           +A CD S LQ+ RR + K +  P+  SL  DR++ +  +EL   + +       T ID+K  I    AN+F +Y CS   F+YDD  F   +  +D IFWE+N G  +DF PW   ++ G +++ L+     IR F+ ++I+   +           F D  L +  +    N + I+F LED IGGHSA+ N+++  L  ++++ ++ + +QKE+       ++    +  NM    A  +E +R   SPI+PH +  DT I  Y ++  T++F+NN+ LN     W  P  + P+RF+ T +G ++ P HF PFS G+R+C+G +L Q      +A IL+  D+S  + E+ + PG +A  P
Sbjct:   10 VVVVWWLATARRDSKSLPGPRPWPIIGSLHVLGGY-KSPFEAFTALSKVYGDIFGISLGPAQCVVVNNFRLIKEVLINKGGDFGGRPDFLRYHKLFGGDRNNSLALCDWSALQKTRRSIAKSYCSPRFTSLQYDRVNEVGADELEVFLAKLQKLPQNTPIDIKPLILGTCANMFTQYMCSTR-FAYDDPEFRKIVRYFDEIFWEINQGYAVDFLPWLLPIYQGHMKK-LSHWAAEIRQFILSRIIDKHRATLDINSPPKDFTDALLIHLEEDPNMNWQHIIFELEDFIGGHSAIGNLVMITLASVVKYPEVAEHIQKEVDAVTKGKRSPNLFDKANMPYTEATLWEALRKASSPIVPHVATTDTEIDGYKIEKGTMVFLNNYELNVGEDYWNNPEKFMPERFL-THSGRVTKPGHFIPFSTGKRTCIGQRLVQCFSFIILATILQHYDVSAGS-EMEMKPGCVAVPP 471          
BLAST of EMLSAG00000001150 vs. nr
Match: gi|531444193|gb|AGT57834.1| (cytochrome P450 307a1, partial [Leptinotarsa decemlineata])

HSP 1 Score: 288.886 bits (738), Expect = 5.636e-89
Identity = 166/463 (35.85%), Postives = 250/463 (54.00%), Query Frame = 0
Query:    4 IYYFYNGKNNNIYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLNQK-----------FDDDFLNTYQRIEK-NKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF----QALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLATKP 440
            I+Y    K++++ PPGP  WPLIGSLHLL  +E  PF+AFT L KIYGD FSI +GS  C+VVN  +L +EVL+ K   F D PNF RF           +A CD S LQ++RR + + +  PK  SL  D  + +   E++  + +         +DLK+ + +A AN+F +Y CS   FSY D+ F   +  +D IFWE+N G  +DF PW   F     + L+   + IR+F+  +I+ + K           F D  L   Q     N E I+F LED IGGHSAV N+++  L  ++++  + K ++KE+       +     +  NM   +   +ET+R + SPI+PH +   T +  Y +   T +FINN+ LN     W  P  + P+RF+ + TG +  P HF PFS G+R+C+G KL Q   +  +A +L+  D++    ++ L  G +A  P
Sbjct:   24 IFYCKKRKSDSL-PPGPAPWPLIGSLHLLGQHE-TPFQAFTALSKIYGDFFSITLGSSRCIVVNNFDLIREVLITKGKDFGDCPNFQRFHRLFGGDRNNSLALCDWSDLQKKRRSIARSYCDPKCTSLKFDNANVVAINEMDLFMNELQKLPMNEPVDLKTVVLQACANMFTQYMCSTR-FSYQDEDFRRAVRHFDEIFWEINQGYAVDFMPWLKPFYEGHMKKLSFWAQEIRTFILERIIDSHKRTIDYNSTPRNFTDALLMQLQEDSTLNWEHIMFELEDFIGGHSAVGNLVMVTLAALVKYPHVAKRIRKEVDTVTKNERIPNLYDRANMPYTDCVLWETLRKSSSPIVPHVASDKTELQGYDIPKGTTVFINNYELNVGKQYWKNPEEFMPERFL-SPTGVVVKPTHFIPFSTGKRTCIGQKLVQSFSSVIIASLLQKYDIT-GGSDVELRVGSMAVPP 481          
BLAST of EMLSAG00000001150 vs. nr
Match: gi|1133413288|ref|XP_019872549.1| (PREDICTED: cytochrome P450 307a1-like [Aethina tumida])

HSP 1 Score: 288.115 bits (736), Expect = 8.882e-89
Identity = 165/458 (36.03%), Postives = 244/458 (53.28%), Query Frame = 0
Query:    9 NGKNNNIYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLNQKFDDDF------------LNTYQRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF----QALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLATKP 440
            N K+     PGP  WPLIGSLHLL  YE  PF+AFT L KIYGDIFSI +G+  CVVVN   L KEVL+ K   F  RP+F RF           +A CD S LQ+ RR + + +  P+  SL  D + R+  +E+N  I +          DLK  +  A AN+F +Y CS  SFSYDDK F   +  +D IFWE+N G  +DF PW           L++    IR F+ ++I+   +   D+            ++  +    N + I+F LED IGGHSA+ N+++  L  ++++ +++K +Q EI       +  T  +  +M    A  +ET+R   SPI+PH +  D+ I  + +   T++FINN+ LN     W +P  + P+RF+ +  G +  PAHF PFS G+R+C+G +L Q      +  +L+  D+S   +  +  PG +A  P
Sbjct:   22 NSKSACSTAPGPKPWPLIGSLHLLGAYE-TPFQAFTALSKIYGDIFSINLGNTPCVVVNNFNLIKEVLITKGSDFGGRPDFVRFHKLFGGDRNNSLALCDWSSLQKTRRSIARTYCSPRFTSLQYDTVSRVGLDEMNVFIHELQKLPMGRPCDLKPVVMAACANMFTQYMCST-SFSYDDKEFQQTVRYFDEIFWEINQGYAVDFLPWLLPIYNKHMNKLSNWAMEIRQFILSRIIDKHRATLDYNSPPRDFTDALLMHLEEDPNMNWQHIIFELEDFIGGHSAIGNLVMVTLASVVKYPEVQKRIQTEIDAVTNGTRMPTLMDKTSMPYTEATLWETLRKASSPIVPHVASTDSEIDGFKIPKGTMVFINNYELNLGEQHWEKPEEFRPERFL-SPAGNVVKPAHFIPFSTGKRTCIGQRLVQCFSFVVLTTLLQQYDISTNEVPKTQ-PGCVAVPP 475          
BLAST of EMLSAG00000001150 vs. nr
Match: gi|1059419007|ref|XP_017782270.1| (PREDICTED: cytochrome P450 307a1-like [Nicrophorus vespilloides])

HSP 1 Score: 286.189 bits (731), Expect = 3.581e-88
Identity = 165/476 (34.66%), Postives = 257/476 (53.99%), Query Frame = 0
Query:    1 LTVIYYFYNGKNNNI-YPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPW-TSLFAGFVQQPLNSHCKFIRSFVENKILLNQKFDDD------------FLNTYQRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPFQA----LTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQ------LICTFSVAHILKTLDLSIKNMEISLPPGMLATKPGP 442
            L ++Y+F   +  +   PPGP  WP+IGSLHLL  +E  PF+AFT L K+YGD+FSI +G+  CVVVN   L KEVL+ K   F  RP+F RF           +A CD S LQ+ RR + + +  P+  SL  D ++ +  +E++  +++         I+LK  I  A AN+F +Y CS  SF+YDD  F   + ++D IFWE+N G  +DF PW   ++ G +++ L+S    IR F+  +I+   +   D             ++  +    N + I+F LED +GGHSA+ N+++  L  +++H ++ K +Q+E++         T  +  +M    A  +ET+R   SPI+PH +  +T I  Y ++  TVIF+NN+ LN     W EP  + P+RF+ +  G +  PAHF PFS G+R+C+G +L Q      L   F    I    DL ++   +++PP     K  P
Sbjct:   10 LILVYWFTKPRKQDTNLPPGPKPWPVIGSLHLLGEHE-TPFQAFTSLSKVYGDVFSITLGTSKCVVVNNFNLIKEVLITKGADFGGRPDFIRFHKLFGGDRNNSLALCDWSSLQKTRRSIARTYCSPRFTSLQYDHVNAVGCKEVSVFLVELKKKDFSQPIELKPMILAACANMFTQYMCST-SFNYDDSDFKKVVRTFDEIFWEINQGYAVDFLPWLLPIYKGHMEK-LSSWASDIRKFILARIIDEHRLSLDHNLPPRDFTDALLMHLDEDPNLNWQHIIFELEDFLGGHSAIGNLVMITLACVVKHKEVVKRIQQEVESVTGGKRLPTLFDKASMPYTEATIWETLRTASSPIVPHVATLNTEIDGYTIEKGTVIFVNNYELNVGEDYWDEPEKFKPERFL-SPNGNVVKPAHFIPFSTGKRTCIGQRLVQSFSFILLTTLFQEYDIEPACDLKLRPGCVAVPPDCFKLKLTP 481          
BLAST of EMLSAG00000001150 vs. nr
Match: gi|1069813658|ref|XP_018330366.1| (PREDICTED: cytochrome P450 307a1-like [Agrilus planipennis])

HSP 1 Score: 285.034 bits (728), Expect = 1.153e-87
Identity = 164/464 (35.34%), Postives = 247/464 (53.23%), Query Frame = 0
Query:    4 IYYFYNGKNNNIYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWT-SLFAGFVQQPLNSHCKFIRSFVENKILLNQKFDDD------------FLNTYQRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF----QALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLATKP 440
            ++     K     PPGP  WP+IGSLHLL  +E  PF+AFT L K+YGDIFSI +G+  CVVVN  +  +EVL+ K   F  RP+F RF           +A CD S LQ+ RR + + +  PK  SL  D ++++  +    ++ +         + LK  +  A  N+F +Y CS   F Y D  F   +  +D IFWE+N G  +DF PW   L+A  +Q+ L+     IR F+  +I+   +   D             L+  +    N + I+F LED +GGHSAV N+++  L  I+++  + K++Q E+       +     +  +M    A  +ET+R   SPI+PH +  +T IG + V+  T++FINN+ LN     W +P  ++P+RFI  ETG L  PAHF PFS G+R+C+G +L Q      +A I++  D+S  N EI+L P  +A  P
Sbjct:   14 VWCLSEPKKKKNLPPGPKPWPVIGSLHLLGQHE-TPFQAFTALSKLYGDIFSITLGATPCVVVNNFDSIREVLITKGAEFGGRPDFMRFHKLFGGDRNNSLALCDWSSLQKTRRSIARNYCSPKFTSLQFDYVNQVGCQGTRVLLEELRSLPEGKPVALKPMVLAACMNMFTQYMCSA-KFDYRDAEFKRTVRYFDEIFWEINQGYAVDFLPWLLPLYANHMQK-LSDWASEIRKFILARIIEKHRATLDPSLPPKDFTDALLLHLDEDPNMNWQHIIFELEDFLGGHSAVGNLVMVALAEIVKNPQVGKKIQAEVDNVTNGERLPNLSDRTSMPYTEAVLWETLRSASSPIVPHVATAETEIGGFTVEKGTMVFINNYELNVGNVYWDKPELFSPERFISVETGTLVKPAHFIPFSTGKRTCIGQRLVQCFSFIIIATIMQYFDIS-SNEEINLKPCCMAVPP 473          
BLAST of EMLSAG00000001150 vs. nr
Match: gi|1049547450|gb|ANY58624.1| (putative cytochrome P450 307A1 [Lygus hesperus])

HSP 1 Score: 284.263 bits (726), Expect = 3.040e-87
Identity = 156/432 (36.11%), Postives = 250/432 (57.87%), Query Frame = 0
Query:   18 PGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILL--------NQKFDDDFLNTYQRIEKNK-----ELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKE---IQPFQALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLS 423
            PGP  WP++GSLHLL  YE +P++AF  L K+YG +FSI++G   C+VV+  E  KEV++ K DHF  RPNF+R+           +AF D S   + +R++++  T P++ +     LD L  EELN   L   + +  TN+  K  + +A ANVF+ YFCS   F  +D  F   + ++D IF+EVN G   DF PW         + +      IR F+ ++I+         N++  D   +  Q + ++K     +  +FALED++GGH+A+ N++++IL  + ++ +++K++Q+E   + P + +  ++   M    A   E++R   SPI+PH + +++ +  Y V+ DT+IF+NN+ LN SP LW EP  ++P+RFI  E G LS P  F PF  GRRSC+GYKLTQ I   ++A +++   +S
Sbjct:   43 PGPEPWPVLGSLHLLGGYE-VPYQAFDHLTKVYGPVFSIKLGQVQCLVVSSLEHIKEVIITKGDHFDGRPNFNRYNQLFDGNKENSLAFSDWSDKHKMKREMLRDHTFPRAFTERFHLLDTLVIEELNG--LSHQLAQGVTNV--KPALLQACANVFLSYFCST-KFMPNDPEFIKMVRNFDEIFYEVNQGYAADFMPWLMPLHASNMRKMRKWGAEIRGFMVDRIIQKRMDGWSENKEVVDYVDHLVQHLHESKPQFNFDAAMFALEDIVGGHAAIANLLIKILGFVAQNPEVQKKIQEEADSVAPNRDIVLEDRNQMPYTEATILESIRHVSSPIVPHVASQNSVVAGYAVEKDTLIFLNNYTLNMSPDLWKEPSKFSPERFISPE-GKLSKPEFFLPFGGGRRSCMGYKLTQFISFATLATLVQRFHVS 467          
BLAST of EMLSAG00000001150 vs. nr
Match: gi|193676474|ref|XP_001948715.1| (PREDICTED: cytochrome P450 307a1-like [Acyrthosiphon pisum])

HSP 1 Score: 284.648 bits (727), Expect = 3.105e-87
Identity = 166/455 (36.48%), Postives = 256/455 (56.26%), Query Frame = 0
Query:   15 IYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIH-SFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLNQK-----------FDDDFLNTYQRIEKNK----ELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKE----IQPFQALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLI--CTFSVAHILKTLDLSIKNMEISLPPGMLA 437
            + PP P  WP+IG L+L+  Y K+P+  F ++    G +F + +GS  CVVVNG    +EVL+ K DHF  RP+F RF           +AFCD S LQ+ RR+L++  T P + S    RLD   + EL  +    +   N   +D+K+ +    ANVF+ YFCS   S SYD   F  FI ++D +F+EVN G   DF P       +  + + S    IR+F+E +I   +K           F D+ L+   + +++     ++ LF+LED+IGGHSA+TN I++ L  +++  D+++ +Q+E    ++   ++   +   M    A  YE++RL  SPI+PH + RDTS+    ++  T +F+NN+ L+ SP LW  P +Y+P+RFI+ E G L  P +F PFS G+RSC+GYKL QL+  CT S      TL L ++++  ++P G LA
Sbjct:   40 VDPPAPKAWPIIGHLYLMARY-KVPYRVFDEIMADLGSVFRLDLGSVPCVVVNGLNNIREVLMIKGDHFDSRPSFRRFNQLFKGDKNNSLAFCDWSQLQKTRRELLRAHTFPNTTSNMYTRLDTCLKTELADLTDTLDTMANTECVDIKNMLLHTCANVFMSYFCSTRFSRSYDK--FREFIRNFDDVFYEVNQGAPCDFLPSLMPLYHWHFKKIRSWSSKIRNFMETEIFNKRKAAWVPGTKPVDFVDNLLDAVTQPDRDDGFDMDIGLFSLEDIIGGHSAITNFIVKTLGFLVDRPDVQRRIQEESDAVVRASGSVGLSDRSQMPYTEAVVYESLRLIASPIVPHLANRDTSVDGVRIRKGTTVFLNNYSLHMSPELWNNPEHYSPERFINAE-GRLEKPEYFIPFSGGKRSCMGYKLVQLLSFCTISTLLNKYTL-LPVEDVSYAVPKGNLA 489          
BLAST of EMLSAG00000001150 vs. nr
Match: gi|942374101|gb|JAN68980.1| (Cytochrome P450 307a1, partial [Daphnia magna])

HSP 1 Score: 286.574 bits (732), Expect = 2.523e-85
Identity = 174/501 (34.73%), Postives = 251/501 (50.10%), Query Frame = 0
Query:   17 PPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRFPV----------AFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWT---NIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLNQK----------FDDDFLNTYQRIEKNKEL--------------------ILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF-----QALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIG----------------------------NYCVKNDTVIFINNHFLNYSPSLWY-EPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLATKP 440
            PPGP GWP+IGSLHLL  YE +PFEAF++L K YGDIFSI +GS  CVVVN  +L KEVL+ K  HF  RPNF R+ +          A CD S+LQ +RR + + +  P++ S+  D L R+   E   M+ + ++    T    IDLK+ +    ANVF  Y CS   F YDDK F   +  +D IFW++N G  +DF PW         Q L S    IR F+   I+   +          F D  LN     EKN E                     +L+ LED +GGHSA+ N+++R +  +     +   +Q+EI+       + +  ++  NM    A   ET+RL+ SPI+PH + +DTS+                              Y V+  T++F+NN+ LN SP  W  + L ++P RF+    G +  P +F PFS G+R+C+GY+L Q +   ++A +L+  D+S     I LP   +A  P
Sbjct:  247 PPGPVGWPIIGSLHLLGKYE-VPFEAFSQLSKTYGDIFSITLGSTPCVVVNSFKLIKEVLITKGPHFGGRPNFIRYDILFGGDRDNSLALCDWSYLQRDRRSIARHWCHPRADSMQFDTLSRVLTSESGLMVNELSLKTAATGSRGIDLKTTMMTMCANVFTHYMCS-SRFDYDDKEFGKVVRLFDQIFWDINQGYAVDFLPWLMPVYRRHMQQLKSWGTDIRQFIVKTIIDEHRSTMDVNNPRDFTDVLLNQLDG-EKNNEQAANEDAQQHNNNAQQLDWNHVLYELEDFLGGHSAIGNLLMRAVGELCSSPHVMANIQEEIRRVTGDNGRPVVLEDRPNMPYTEATILETLRLSSSPIVPHVAMQDTSVAKKKKKKKKKKKKKKKQVLTFDFVPFQCKGYDVQEGTMVFLNNYELNISPDYWGDQSLTFDPARFL--IQGKIVKPEYFIPFSTGKRACMGYRLVQHVSFVTLATLLQNFDVSASEDAIHLPKACVAVPP 742          
BLAST of EMLSAG00000001150 vs. nr
Match: gi|985421790|ref|XP_015376294.1| (PREDICTED: cytochrome P450 307a1-like [Diuraphis noxia])

HSP 1 Score: 279.641 bits (714), Expect = 2.613e-85
Identity = 164/455 (36.04%), Postives = 254/455 (55.82%), Query Frame = 0
Query:   15 IYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIH-SFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKFIRSFVENKILLNQK-----------FDDDFLNTYQRIEKNK----ELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKE----IQPFQALTFKETRNMVLLNACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLI--CTFSVAHILKTLDLSIKNMEISLPPGMLA 437
            + P  P  WP+IG L+L+  Y K+P+  F  +    G +F + +GS  CVVVNG    +EVL+ K DHF  RP+F RF           +AFCD S LQ+ RR+L++  T P + S    RLD+  + EL  +I   +   +   +D+K+ +    ANVF+ YFCS   S SYD   F  FI ++D +F+EVN G   DF P       +  + + +    IR+F+E +I   +K           F D+ L+   +++++     ++ LF+LED+IGGHSA+TN I++ L  ++   D+++ +Q+E    ++   ++   +   M    A  YE++RL  SPI+PH + RDTS+    +   T +F+NN+ L+ SP LW  P +Y+P+RFI+ E G L  P +F PFS G+RSC+GYKL QL+  CT S      TL L ++++   +P G LA
Sbjct:   40 VEPLAPKTWPIIGHLYLMARY-KVPYRVFDDIMADLGSVFRLDLGSVPCVVVNGLNNIREVLMIKGDHFDSRPSFRRFNQLFKGDKNNSLAFCDWSQLQKTRRELLRAHTFPNTTSNMYSRLDKCTKTELADLIDTLDTMADTECVDIKNMLLHTCANVFMSYFCSTRFSRSYDK--FREFIQNFDNVFYEVNQGAPCDFLPSLIPLYHWRFKKIRTWSSKIRNFMETEIFNKRKAEWVPGTKPVDFVDNLLDAVTQLDRDDGFDMDIGLFSLEDIIGGHSAITNFIVKTLGFLVNRPDVQRRVQEEADAVVRASGSVGLSDRSQMPYTEAVIYESLRLIASPIVPHLANRDTSVDGVRIPKGTTVFLNNYSLHMSPELWKNPEHYSPERFINAE-GRLEKPEYFIPFSGGKRSCMGYKLVQLLSFCTISTLLNKYTL-LPVEDVSYEVPKGNLA 489          
BLAST of EMLSAG00000001150 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold297_size217559-snap-gene-1.23 (protein:Tk11594 transcript:maker-scaffold297_size217559-snap-gene-1.23-mRNA-1 annotation:"hypothetical protein SINV_01048")

HSP 1 Score: 293.508 bits (750), Expect = 2.729e-94
Identity = 189/471 (40.13%), Postives = 266/471 (56.48%), Query Frame = 0
Query:    9 NGKNNNIYPPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLA--KADHFSDRPNFHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTN--IDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCK---FIRSFVENKILLNQKFDD------DFLNTY---QRIEKNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALT---FKETRNMVLLN---ACFYETVRLTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLN-YNPKRFIDT--ETGFLSI--PAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLATKPGP 442
            N + N   P GP   PL+GSLHLL N + IPF  FT L   YG+IF++++G   CVVVN  EL  EVL A  K D F  RPNF R            +AFCD S LQ+ RR+L+ KFT   SHS     ++++C EE  HMI Q     +  N  ID+K  + K   N+F RYFC +   SYDD  F+ +I S+D +FWEVN GRL DF PW   F  F   PL    K    ++ +V+N ++      D      D L  Y      E + +   + LED++GGHSAV  ++LRIL  I E+ D++K++++E++  +  T        N  LL+   A  +ET+R+TCSPI+PH++ RD+SIG+  V+ DTV+FINNH L++S  LW      Y+P RF+     +G L    P HF+PFS+G+RSC+GYKL + +    +++IL++  LS       +P G+L     P
Sbjct:   46 NQRKNPNAPKGPTPLPLLGSLHLLGNRD-IPFSGFTDLMPKYGNIFALKMGESECVVVNSVELRDEVLNANQKGDDFDARPNFERIQRLFGGNKDNALAFCDFSPLQKLRRELMHKFTFTYSHSELWHEMNKICMEEGAHMIQQLRDMASPGNKSIDVKMTVLKTCGNIFNRYFCGVGHTSYDDPKFHDYIKSFDEVFWEVNTGRLSDFIPW---FISFECLPLRRAQKASLVVKDYVDNDLVEATTHHDSPMSFLDILRPYLNGSMPEMDSQTATYCLEDILGGHSAVGCMVLRILKDISENEDVQKKIKEELEQVKKETGHNISSLENASLLHWTRAAIFETIRMTCSPIVPHKAIRDSSIGDMNVEKDTVVFINNHHLHFSKELWGSDTEVYDPTRFLKQCEHSGSLIFMRPIHFKPFSLGKRSCMGYKLVESLTLSLLSNILESFSLSPAQENWKIPVGLLGLPDEP 512          
BLAST of EMLSAG00000001150 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1387_size43827-snap-gene-0.5 (protein:Tk06622 transcript:maker-scaffold1387_size43827-snap-gene-0.5-mRNA-1 annotation:"cytochrome p450")

HSP 1 Score: 112.464 bits (280), Expect = 4.773e-27
Identity = 105/449 (23.39%), Postives = 194/449 (43.21%), Query Frame = 0
Query:   17 PPGPFGWPLIGSLHLL----KNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPN---------FHR-FPVAFCDSSFLQEERR---KLIKKFTIPKSH---------SLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRL-----MDFFPWTSLFAGFVQQPLNSHCKFIRSFV-ENKILLNQKFDDDFLNTYQRIE----------KNKELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF----QALTFKETRNMVLLNACFYETVRLTCS-PIIPHRSK-RDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHIL 417
            PPGP+ +P +GS+  L     N  + P+ A  +L + YG I S+ +G    V++ G E  K+   +  D    RPN         F R   V F D    +E+R+   + +++F + K             S+  L   C E  NH +   + F    N+    C+     NV  R  C    F Y DK     I   +    E   G +     + + P  S     + + +    +F+ +FV E K  L+  FD  +++++ R +           +++L++   +   GG   ++  +   ++ ++++ ++++  +KEIQ        +T  +   +  + A   E  RL+   PI P R   +D  IG++ +   T + IN + L+ +   W +P ++ P RFI+ +TG +      QPF  G+R C+G  + +      +A+ L
Sbjct:   26 PPGPWVFPFMGSIPALGKADANALEFPYRAMHRLSQGYGPIMSMGLGQDMWVILTGLEEIKQ--FSMMDETVARPNLKSLYEIYSFDRPLGVIFPDGPLWKEQRKFMMRTLREFGLGKQTMEDHIQDEIKCSIQFLREQCNENANHEVAMQDFF----NL---PCL-----NVIWRLVCG-RRFDYGDKRLAELIEHMETFTMEQAIGPIAGISYLKYIPPFSQIYKRIHKHMGIFKEFLSNFVQEEKASLSTDFDRGYIDSFLRAQARGREAGEYFSDQQLVISVQDFFTGGSGTMSKTLAYAILFMVKYPEVQERARKEIQDALGSRDEVTLGDRAELPFIEAIVMEVQRLSSVLPIAPPRVPLKDVMIGDHMITQGTQVQINLYSLHRNQEHWGDPDSFRPDRFINPKTGAVEPDEWLQPFGYGKRKCLGETVAKHTVLLFLANFL 459          
BLAST of EMLSAG00000001150 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1406_size42870-snap-gene-0.12 (protein:Tk07895 transcript:maker-scaffold1406_size42870-snap-gene-0.12-mRNA-1 annotation:"cytochrome p450 monooxygenase")

HSP 1 Score: 102.449 bits (254), Expect = 1.123e-23
Identity = 116/475 (24.42%), Postives = 196/475 (41.26%), Query Frame = 0
Query:   16 YPPGPFGWPLIGSLHLLKNYEKIPFE-AFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPNFHRFPVAFCDSSFLQEERRKLI----------KKFTIP--KSHSLSLDRLDRLCQEELNHMILQFNMFKNWTN--IDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFP-----------WTSLFAGFVQQPLNSHCKFIRSFVEN-KILLNQKFD--DDFLNTYQRIEK--------NKELILFALEDL-IGGHSAVTNVILRILVHILEHGDIKKELQKEIQPF---QALTFKETRNMVLLNACFYETVRLT--CSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLT--QLICTFSVA----HILKTLDLSIKNMEISLPPG-MLATKP 440
            +PPGP   P++GS     N    PF   +      YG I  + +G    VVV   EL K+V     D  + RP        F  S  ++ +++ +I          +KFT+   K   L   +++   Q E N +    +   +W    +D+K   +    N+  +   ++  +  DD    + + S D    + +N R ++  P           W S F GF    LN    F  S +E+ K  L +  D  +DF+  Y + ++        N E +   + DL   G     N +   +++++ H   +K++Q E+      +    ++   +V   A   E  R        +PH++ RDT I  Y +  DTV+    +++   P  W  P  +NP+RFI  E G         PF IG+RSC+G  L   +L+  F+      H +K+ D    + E    PG ++A KP
Sbjct:   31 FPPGPPSLPIVGSFPFYPNVPS-PFSIGWKYFVHNYGKIVGVMMGHIPVVVVYDFELIKDVF--NRDEIAGRPQL------FTHSYRMKWKKQGIIFNDGPSWKSHRKFTLRTLKDLGLGKQKMEHTLQFEANQIC---DKIASWQGRPLDVKHVFNVGVLNILWKLVGNVR-YDLDDPSLLACVRSIDGGT-QGDNTRQIELLPILRHIPPFTKKWDS-FKGFADSLLN----FATSMIEDCKRDLEENIDQPEDFVTAYLKEQQESPENKDFNDEALAVTITDLFAAGSDTSANTLTWAILYMVLHPKCQKKVQDELDEILVGREPAIEDRSRLVYTEATLAEIQRKANIVPGAVPHKALRDTVIDGYSIPKDTVVCCPLYYVMSDPEYWQNPQVFNPERFI--ENGVFRKDERLIPFGIGKRSCLGESLARNELLIIFARMLQRFHFVKSPDHP--DPEDKFVPGFLIAAKP 482          
BLAST of EMLSAG00000001150 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold649_size119817-snap-gene-0.16 (protein:Tk01420 transcript:maker-scaffold649_size119817-snap-gene-0.16-mRNA-1 annotation:"cytochrome p450 family 2 subfamily d polypeptide partial")

HSP 1 Score: 93.9745 bits (232), Expect = 1.149e-20
Identity = 100/422 (23.70%), Postives = 181/422 (42.89%), Query Frame = 0
Query:   17 PPGPFGWPLIGSLHLLKNYEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEV-----LLAKADHFSDRPNFHRFPVAFCDSSFLQEERRKLIKKFTIP--KSHSLSLDRLDRLCQEELNHMILQFNM-FKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPW------TSLFA-GFVQQPLNSHCKFIRSFV-ENKILLNQKFDDDFLNTYQRIEK--------NKELILFALEDLIGGHSAVTNVILRILVHIL-EHGDIKKELQKEIQPF----QALTFKETRNMVLLNACFYETVRLT-CSPI-IPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQL 407
            PPGP G P++G L  L   +     +F +L K YGD+FSIR+G+   VV+N  E  K       LLA+ D F     F  F       +    E+ ++ +KFT    K+     ++++   +EE++ +I    +  +    +++   I+ +  NV            +D KL   F+ S +      +   ++ F P+       SLF  G +++ +     +++  V E+K   +     DF++ +    K        N+  +L    +L G     T+V L+  +  L E+  I+ + Q EI+      + +   +  N+    A   E +R     PI + H    DT +  + +   T IF N H ++  P  W +P    P+ ++D    F+     F  F +G+R C G ++ Q+
Sbjct:  343 PPGPVGVPILGYLPFLDVNDL--GGSFKRLAKKYGDVFSIRVGTEMAVVLNSYESIKAAFSNPKLLARPDTFM----FRFFSQGENGIASASGEKWEVQRKFTHSNLKALGFGQNKMESFIKEEIHELIELLEIKSQGGQPVEIGYDINVSIVNVIWAMITGERKPHHDQKL-RDFLTSVNKGIELASTSGILLFMPFLVKIFPESLFGIGKMRKWMKQSYGYLQEVVDEHKTNYSPDSQKDFIDAFLTEMKKDGAHPSFNEFQLLVLCSELFGAGGEPTSVTLKWALRFLAENPKIQAQAQAEIESVVGHDRLVDLADRPNLPYCQALMQELIRFADIHPIGVMHSPSEDTELNGFNLPKGTFIFPNFHAVHRDPRHWEKPEELYPEHWLDASGQFVPHHDGFLSFGVGKRKCPGQEVAQM 757          
BLAST of EMLSAG00000001150 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold243_size241480-processed-gene-0.6 (protein:Tk02952 transcript:snap_masked-scaffold243_size241480-processed-gene-0.6-mRNA-1 annotation:"cytochrome p450 cyp15a1-like partial")

HSP 1 Score: 91.2781 bits (225), Expect = 1.021e-19
Identity = 103/474 (21.73%), Postives = 188/474 (39.66%), Query Frame = 0
Query:    1 LTVIYYFYNGKNNNIYPPGPFGWPLIGSLHLLKNYEK------IPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPN---FHRF----------PVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVN-NGRLMDFFPWTSLFAGFVQQPLNSHCKFI---RSFVENKILLNQKFDD------------DFLNTY-QRIEKN-------------KELILFALEDLIGGHSAVTNVILRILVHILEHGDIKKELQKE----IQPFQALTFKETRNMVLLNACFYETVRLT--CSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGF-LSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILK 418
            L VI  +  G+     PPGP   P++GS+  +    +      IP + F  L + YG I  + +G    +V++  +L KE    K D  + RP    FH F           V        QE+RR  +++    K        ++ + Q E+  ++   +M +    +DL   ++ +  N              DD      + + D +      +G L   FP  +L+  F       H +F     +F   + L+ Q  +D            DF+  Y Q I+               K L    ++  +GG    +  ++   + +L H D++  + +E    I P      ++   +  L A   ET+R++      +PH     T +G Y +   + +  N    + +P ++ +P  +NP+RF+D +  F +   + F PFS+G+R C+G  L +      +A IL+
Sbjct:  259 LVVILLYIFGEQEKDVPPGPSSVPILGSIPFVPKRFRHGGRLHIP-KLFNYLAQTYGPISRVYLGPLPTIVISDLDLVKEAF--KKDEITSRPPMRPFHEFRYGTEDGGQRGVILSSGKEWQEQRRFSMRQL---KDFGFGRSSMEDMIQVEVQKLVNSLHM-ETGQPLDLNFKMNISIVNALWVILVG-ERLELDDARLLDIVKTLDKLLRGAQVSGLLSVLFP--TLYKYF-------HPRFALAKNTFESMRSLMTQAIEDHRQRFNPDEAPNDFIECYLQEIQSTSDPQSSFYQDQGLKSLDCVLIDLFMGGSETTSITLVWTFLCLLHHPDVQDRIHQELDSIIGPDSVPQLQDLPTLPYLRAVMTETLRVSSVVPNGVPHYVTVSTKVGGYLLPKGSAVMANIISPHLNPKVYEDPEEFNPQRFLDPDGKFQMPNSSQFAPFSLGKRFCLGQTLAEQEYYLFLAGILQ 715          
BLAST of EMLSAG00000001150 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold605_size125465-snap-gene-0.31 (protein:Tk06867 transcript:maker-scaffold605_size125465-snap-gene-0.31-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_314153")

HSP 1 Score: 88.5817 bits (218), Expect = 4.753e-19
Identity = 99/430 (23.02%), Postives = 183/430 (42.56%), Query Frame = 0
Query:   17 PPGPFGWPLIGSLHLLKN-YEKIPFEAFTKLRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPN-------FHRFPVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQ-EELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLMDFFPWTSLFAGFV---------QQPLNSHCKFIRSFVENKILLNQKFDDDFLNTY-----QRIEKNKELILF-----ALEDLI-----GGHSAVTNVILRILVHILEHGDIKKELQKEIQPF----QALTFKETRNMVLLNACFYETVRLTCSPI---IPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQ 406
            PPGP  +P++G L  +K  +    FE   K    +  IFS  +G  N VV++   L K+ L ++   F  RP           F +   + +  + +RR L+ +    +     ++ ++   Q E +N +   F   K+   ID +  ++ A ANV      SI  F  +D  F  F+  +D  F   N      FFP      G           +Q + +  K+I    E+K  L+++   D +++Y       +  N++L         LE +I      G   +   I   +V++L + ++  ++Q E++      +  T ++  N+    A   E +R + +P+     H  +RD     Y +  +T +    H ++ +P  W  P  + P+RF+  +   +    +F PFS+G+R C+G KL +
Sbjct:   61 PPGPMAYPIMGVLPKIKQEFHSFLFEESLK----FNGIFSAPMGQVNMVVLSDVRLIKKALGSR--DFIHRPKTPLFQDLLKGFGIINSEKALWKSQRRFLLHQKLGMRHWGAGMEHIEERIQFESINLIENLFIEQKDSLGIDPEPFLNSAVANVVCSVIMSIR-FDANDPKFIRFMDLFDEGFKLFNETGTAMFFPPLQYLPGAKNIFNKLSANRQEMLAFSKYI--IQEHKNTLDEEAPRDLIDSYLIRMADTVNNNEDLFHGYNPEEQLEQIILDLFSAGVETIKTTIRWGIVYMLHYPEVMAKIQSELEQVLGSERMPTIQDMPNLPYTRATICEILRRS-TPVPLATTHSCERDVEFEGYLIPKNTQVIPLIHAVHMNPDNWENPEEFRPERFLTEDGSDVIKSENFIPFSVGQRMCLGDKLAE 480          
BLAST of EMLSAG00000001150 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold281_size224178-snap-gene-1.20 (protein:Tk10990 transcript:maker-scaffold281_size224178-snap-gene-1.20-mRNA-1 annotation:"cytochrome p450 monooxygenase")

HSP 1 Score: 82.4185 bits (202), Expect = 4.452e-17
Identity = 107/438 (24.43%), Postives = 189/438 (43.15%), Query Frame = 0
Query:   24 PLIGSLHLLKNYEKIPFEAFTK-LRKIYGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRP-----------NFHRFPVAFCDSSFLQEERRKLIKKFTIPKSHSLSLDR--LDRLCQEELNHMILQFNMFKNWTNID--LKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEV--NNGRLMDFFPWTSLFAGFV----QQPLNSHCK-FIRSFVEN--KILLNQKFDDDFLNTYQRIEK-----NKELILFALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQPFQ----ALTFKETRNMVLLNACFYETVR---LTCSPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLS 423
            P++GS+  L+    +  + ++K L   YG +  +  GS   V++N  ++ KE L    +    RP           N   F +   D      +RR     FT+     L L +  L+ +   E   +    ++FK+  + D  +    +    NV    + SI    +++   N  IL + AI   +    G L  FF     F        ++  N   +  I+  +EN   ++      DDF+  Y R  +     N++ +L   +DL G G   V++ ++  L +++ H +++++  +EI   Q     +  +E +  V +NA   E  R   +T S IIPHR+ R T I  Y +  DT+I  N    N  P  + +P ++ P+RFID + G L       PF +G+R C G  L +      +A++++T   S
Sbjct:   57 PMLGSIPFLRG-PTLNDKIWSKDLADQYGPVVGLFFGSHPAVMINDPKVAKEAL--SGEDLLGRPRDPLAMSVRSENGRFFGLFLADGEIWNHQRR-----FTLRTMKDLGLGKSVLEEIMIFEAGQLC---DIFKSEVDRDVLIDGQFNIPVVNVL---WSSIAQVRFEND--NPKILEFMAILRGLFRGGGFLKQFFAILKHFPNLSGLNNRRATNLKLRAIIQEEIENHKDMVQTGASPDDFIGKYLREMETDPYLNEKELLHICQDLFGAGTETVSSTLIFSLAYLVMHPEVQQKCFEEIIRLQDIGGEINLREQQKFVYVNATINEVFRKSSMTAS-IIPHRALRPTKIMGYDIPYDTMILTNMMLNNNDPDYFQDPEDFRPERFID-DHGKLVKNDILTPFGVGKRICPGEALARGELFVFLAYLIRTFAFS 476          
BLAST of EMLSAG00000001150 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold224_size251237-snap-gene-1.46 (protein:Tk05456 transcript:maker-scaffold224_size251237-snap-gene-1.46-mRNA-1 annotation:"cytochrome p450 monooxygenase")

HSP 1 Score: 72.7886 bits (177), Expect = 4.274e-14
Identity = 69/279 (24.73%), Postives = 120/279 (43.01%), Query Frame = 0
Query:  196 NNGRLMDFFP-----WTSLFAGFVQQPLNSHCKFIRSFV--ENKILLNQKFD-DDFLNTY-QRIEKNKELILFALEDLIG--------GHSAVTNVILRILVHILEHGDIKKELQKEIQPFQALTF----KETRNMVLLNACFYETVRLTCSPIIP----HRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLSIKNMEISLPPGMLATKPGPVVFCSKI 449
             N  + + FP        L+   V++ L    K +   V  E+K  L+ K   +DF++ Y   +  N +   F  EDL+G        G   V + +   L+++  H DI+++ ++E++    +           +  + A   E  R  CS + P    H++  DT I  Y VK  T+++ N H      S W +P N+ P+RF+D     L     F PF  G+R C+G  L +       A +     + ++++ I L P    +KP P  + + I
Sbjct:  125 KNAYIEEIFPILQYVGKELYGHSVKEKLTRTNKAVFEAVIKEHKDKLSSKEQPEDFIDAYLTEMSVNDK---FTKEDLVGLCMDFFEAGGETVGSTLSWTLLYLANHPDIQEQCREEVKARLGVRVPTLEDRGHGLTFVEATIMEVQR--CSSVAPGGLEHKALEDTIIEGYHVKKGTLLYYNIHSFFNDKSYWGDPENFRPERFLDESGSGLKKYERFIPFGFGKRVCMGESLAK-------AELFIFTIMILQHLRIKLSPN--HSKPDPNAYEAGI 389          
BLAST of EMLSAG00000001150 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold58_size443543-snap-gene-0.8 (protein:Tk00687 transcript:maker-scaffold58_size443543-snap-gene-0.8-mRNA-1 annotation:"hypothetical protein BRAFLDRAFT_61918")

HSP 1 Score: 72.4034 bits (176), Expect = 9.998e-14
Identity = 97/452 (21.46%), Postives = 189/452 (41.81%), Query Frame = 0
Query:   41 EAFTKLRKIYGDIFSIRIGSFNCVVVNG-NELTKEVLLAKADHFSDRPN---------FHRFP------VAFCDSSFLQEERRKLIKKFTIPKSHSLSLDRLDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDA-IFWEVNNGRLMDFFPWTSLFAGFVQQPLNSHCKF---IRSFVENKI--LLN----QKFDDDFLNTYQRIEKNKEL---------------ILFALEDLIG-GHSAVTNVILRILVHILEHGDIKKELQKEIQPF---QALTFKETRNMVLLNACFYETVRLTCSP-IIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLT--QLICTFSVAHILKTLDLSIKNMEISLPPGMLATKPGPVV 444
            +A  + RK YG++  + +GS   VV++  +E++      K   F+ RP          F   P      + F +     E+RR  +K     +    S   ++ +  EE+  MI      ++  ++ L   +S    N            S+ D+     +   D  I  E  +G LM   PW   F  ++++   +  +    +R   E +   L N    +K   DF++ Y  ++K KE                +  +L D+ G G S+ ++++L   ++++++  I+ ++Q E+        ++  +  NM   +A  +E +R +C    +PH +  D S+  + +  DTV++ N   + ++   W +P  + P+RF+D ++ F        PF +G+R C+G  L   QL   F            +++ E+  P G  A    P+V
Sbjct:  104 DAMQRWRKEYGEVVGLHLGSELTVVLSDFDEISNAF---KDKRFTGRPKALTETMTAFFASHPGEKGGGIVFSEGEQWSEQRRFALKTL---RDFGFSKKAMEDVILEEVFKMIQVLRADED--SMSLNQVLSVGVVNSLWTILTG-QKLSHGDQTVMKIVTGTDDFINNESMSGPLM-MMPWLRFFP-YIKEKFQASKEAPLSMRKLQEEQSGELDNNNGVRKESKDFIDVY--LDKIKETRDRKSSFFGDQGRLNLQRSLTDIFGAGTSSGSSMLLFAFLYVIKYPKIQTKVQDELSRIIGKNTVSLDDRSNMPYTDAVLHEVMRHSCLVYAVPHATTEDVSVQGFDLPKDTVVYANLWQVMHNTDYWQDPEIFRPERFLDRDSKFRR-DERCIPFMLGKRFCIGQSLALQQLFLFFVTI---------LQHFELQAPGGAEAVSIEPIV 532          
BLAST of EMLSAG00000001150 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1571_size35388-snap-gene-0.6 (protein:Tk07363 transcript:maker-scaffold1571_size35388-snap-gene-0.6-mRNA-1 annotation:"probable cytochrome p450 303a1")

HSP 1 Score: 67.3958 bits (163), Expect = 4.804e-12
Identity = 86/406 (21.18%), Postives = 162/406 (39.90%), Query Frame = 0
Query:   50 YGDIFSIRIGSFNCVVVNGNELTKEVLLAKADHFSDRPN--FHRFPVAFCDSSFLQEERR--KLIKKFTIPKSHSLSLDR--LDRLCQEELNHMILQFNMFKNWTNIDLKSCISKATANVFIRYFCSIHSFSYDDKLFNSFILSYDAIFWEVNNGRLM--DFFPWTSLFAGFVQQPLNSHCKFIRSFVEN-KILLNQKF----------DDDFLNTYQR-------IEKNKELILFALEDLIGGHSAVT-NVILRILVHILEHGDIKKELQKEIQPF---QALTFKETRNMVLLNACFYETVRLTC--SPIIPHRSKRDTSIGNYCVKNDTVIFINNHFLNYSPSLWYEPLNYNPKRFIDTETGFLSIPAHFQPFSIGRRSCVGYKLTQLICTFSVAHILKTLDLS 423
            YG I    +G F  V V    L KE+     D F  RP    H + +       L  E    K  ++F++     L   +  ++     E N +  +    +    ++++   + A  N+  +   +   +  DD +    + + DA    V   ++M     PW    A  V+    ++ KF    V   K L+ Q+           D DF+  Y +        + N+  ++  + D+    S  T N +   +++++ H + ++++Q+EI      +     +   +    A   E  R +C     IPH + +DT+IG+Y +   T +    +F  + P  W EP ++ P RFI  + G          F IG+R C+G +L +         I++ LD++
Sbjct:  342 YGKIVGCMLGPFPSVTVYDYNLIKEIF--NKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQG-KPLEVRHVFNVAVLNILWKLVAN-RRYDLDDPMLLKCVSAIDA---SVQGEKIMLITLMPWLRHIAP-VRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFI--KDGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDIT 737          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000001150 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-2.187e-7333.76symbol:spo "spook" species:7227 "Drosophila melano... [more]
-1.766e-6631.11symbol:spok "spookier" species:7227 "Drosophila me... [more]
-7.832e-3930.18symbol:CYP17A1 "Steroid 17-alpha-hydroxylase/17,20... [more]
-9.830e-3930.18symbol:CYP17A1 "Steroid 17-alpha-hydroxylase/17,20... [more]
-4.031e-3726.98symbol:cyp1b1 "cytochrome P450, family 1, subfamil... [more]
-5.060e-3727.93symbol:CYP17A1 "Steroid 17-alpha-hydroxylase/17,20... [more]
-9.565e-3725.93symbol:LOC424944 "Uncharacterized protein" species... [more]
-1.235e-3625.90symbol:Cyp17a1 "Steroid 17-alpha-hydroxylase/17,20... [more]
-3.443e-3527.00symbol:cyp1c1 "cytochrome P450, family 1, subfamil... [more]
-5.368e-3527.87symbol:CYP17A1 "Steroid 17-alpha-hydroxylase/17,20... [more]

Pages

back to top
BLAST of EMLSAG00000001150 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592765779|gb|GAXK01188789.1|1.928e-2523.76TSA: Calanus finmarchicus comp326371_c0_seq1 trans... [more]
gi|592836376|gb|GAXK01121168.1|5.801e-1923.53TSA: Calanus finmarchicus comp745244_c0_seq2 trans... [more]
gi|592878288|gb|GAXK01079613.1|5.876e-1924.21TSA: Calanus finmarchicus comp1784207_c0_seq1 tran... [more]
gi|592838631|gb|GAXK01118913.1|1.152e-1622.94TSA: Calanus finmarchicus comp193694_c0_seq1 trans... [more]
gi|592939286|gb|GAXK01019267.1|2.600e-1623.17TSA: Calanus finmarchicus comp81223_c0_seq2 transc... [more]
gi|592939284|gb|GAXK01019269.1|2.846e-1623.17TSA: Calanus finmarchicus comp81223_c0_seq4 transc... [more]
gi|592939285|gb|GAXK01019268.1|2.846e-1623.17TSA: Calanus finmarchicus comp81223_c0_seq3 transc... [more]
gi|592885187|gb|GAXK01073188.1|2.895e-1420.94TSA: Calanus finmarchicus comp149142_c0_seq1 trans... [more]
gi|592853811|gb|GAXK01103733.1|1.185e-1321.29TSA: Calanus finmarchicus comp166686_c0_seq1 trans... [more]
gi|592811180|gb|GAXK01143388.1|4.961e-1321.92TSA: Calanus finmarchicus comp1067522_c0_seq1 tran... [more]

Pages

back to top
BLAST of EMLSAG00000001150 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 10
Match NameE-valueIdentityDescription
EMLSAP000000011500.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1190:1740... [more]
EMLSAP000000046882.836e-2222.67pep:novel supercontig:LSalAtl2s:LSalAtl2s245:53586... [more]
EMLSAP000000023591.517e-1622.15pep:novel supercontig:LSalAtl2s:LSalAtl2s144:36912... [more]
EMLSAP000000077587.924e-1422.04pep:novel supercontig:LSalAtl2s:LSalAtl2s453:37641... [more]
EMLSAP000000073281.614e-1323.11pep:novel supercontig:LSalAtl2s:LSalAtl2s412:19530... [more]
EMLSAP000000068222.612e-1022.70pep:novel supercontig:LSalAtl2s:LSalAtl2s383:99037... [more]
EMLSAP000000052691.473e-926.92pep:novel supercontig:LSalAtl2s:LSalAtl2s281:23745... [more]
EMLSAP000000057211.593e-924.34pep:novel supercontig:LSalAtl2s:LSalAtl2s309:68270... [more]
EMLSAP000000120889.322e-824.74pep:novel supercontig:LSalAtl2s:LSalAtl2s865:17115... [more]
EMLSAP000000094056.626e-721.70pep:novel supercontig:LSalAtl2s:LSalAtl2s5:994028:... [more]
back to top
BLAST of EMLSAG00000001150 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|33860144|sp|Q9VRM7.3|CP307_DROME9.629e-7533.76RecName: Full=Cytochrome P450 307a1; AltName: Full... [more]
gi|117283|sp|P05093.1|CP17A_HUMAN2.127e-3930.18RecName: Full=Steroid 17-alpha-hydroxylase/17,20 l... [more]
gi|38503035|sp|Q8HYN1.1|CP17A_PANTR2.706e-3930.18RecName: Full=Steroid 17-alpha-hydroxylase/17,20 l... [more]
gi|2493377|sp|P70687.1|CP17A_MESAU1.818e-3727.93RecName: Full=Steroid 17-alpha-hydroxylase/17,20 l... [more]
gi|57012714|sp|Q91Z85.1|CP17A_PERLE4.650e-3725.90RecName: Full=Steroid 17-alpha-hydroxylase/17,20 l... [more]
gi|57015309|sp|Q29497.2|CP17A_SHEEP2.629e-3527.87RecName: Full=Steroid 17-alpha-hydroxylase/17,20 l... [more]
gi|57012725|sp|Q9N0U7.1|CP17A_CAPHI3.268e-3527.51RecName: Full=Steroid 17-alpha-hydroxylase/17,20 l... [more]
gi|2493376|sp|Q64410.1|CP17A_CAVPO1.199e-3426.35RecName: Full=Steroid 17-alpha-hydroxylase/17,20 l... [more]
gi|38503034|sp|Q8HYN0.1|CP17A_PAPCY1.660e-3428.13RecName: Full=Steroid 17-alpha-hydroxylase/17,20 l... [more]
gi|38503033|sp|Q8HYM9.1|CP17A_MACMU1.677e-3428.13RecName: Full=Steroid 17-alpha-hydroxylase/17,20 l... [more]

Pages

back to top
BLAST of EMLSAG00000001150 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
gb|EFA11558.2|7.532e-9535.85cytochrome P450 307A1 [Tribolium castaneum][more]
EFX88041.14.850e-8534.85ecdysone biosynthesis protein [Daphnia pulex][more]
EAA10112.45.120e-8533.33AGAP008682-PA, partial [Anopheles gambiae str. PES... [more]
gb|EFA05673.1|3.077e-8434.74cytochrome P450 307B1 [Tribolium castaneum][more]
EEB17258.18.509e-8435.25cytochrome P450, putative [Pediculus humanus corpo... [more]
EAL41693.45.097e-8133.83AGAP001039-PA [Anopheles gambiae str. PEST][more]
EGK96302.19.553e-7932.47AGAP001039-PB [Anopheles gambiae str. PEST][more]
AHN57968.14.667e-7533.76spook, isoform C [Drosophila melanogaster][more]
AAF50766.34.667e-7533.76spook, isoform A [Drosophila melanogaster][more]
EDP28053.24.669e-6831.11spookier [Drosophila melanogaster][more]

Pages

back to top
BLAST of EMLSAG00000001150 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|939635450|ref|XP_014293876.1|1.245e-9137.76PREDICTED: cytochrome P450 307a1-like [Halyomorpha... [more]
gi|1080034663|ref|XP_018568738.1|1.082e-9034.90PREDICTED: cytochrome P450 307a1-like [Anoplophora... [more]
gi|531444193|gb|AGT57834.1|5.636e-8935.85cytochrome P450 307a1, partial [Leptinotarsa decem... [more]
gi|1133413288|ref|XP_019872549.1|8.882e-8936.03PREDICTED: cytochrome P450 307a1-like [Aethina tum... [more]
gi|1059419007|ref|XP_017782270.1|3.581e-8834.66PREDICTED: cytochrome P450 307a1-like [Nicrophorus... [more]
gi|1069813658|ref|XP_018330366.1|1.153e-8735.34PREDICTED: cytochrome P450 307a1-like [Agrilus pla... [more]
gi|1049547450|gb|ANY58624.1|3.040e-8736.11putative cytochrome P450 307A1 [Lygus hesperus][more]
gi|193676474|ref|XP_001948715.1|3.105e-8736.48PREDICTED: cytochrome P450 307a1-like [Acyrthosiph... [more]
gi|942374101|gb|JAN68980.1|2.523e-8534.73Cytochrome P450 307a1, partial [Daphnia magna][more]
gi|985421790|ref|XP_015376294.1|2.613e-8536.04PREDICTED: cytochrome P450 307a1-like [Diuraphis n... [more]

Pages

back to top
BLAST of EMLSAG00000001150 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 16
Match NameE-valueIdentityDescription
maker-scaffold297_size217559-snap-gene-1.232.729e-9440.13protein:Tk11594 transcript:maker-scaffold297_size2... [more]
maker-scaffold1387_size43827-snap-gene-0.54.773e-2723.39protein:Tk06622 transcript:maker-scaffold1387_size... [more]
maker-scaffold1406_size42870-snap-gene-0.121.123e-2324.42protein:Tk07895 transcript:maker-scaffold1406_size... [more]
maker-scaffold649_size119817-snap-gene-0.161.149e-2023.70protein:Tk01420 transcript:maker-scaffold649_size1... [more]
snap_masked-scaffold243_size241480-processed-gene-0.61.021e-1921.73protein:Tk02952 transcript:snap_masked-scaffold243... [more]
maker-scaffold605_size125465-snap-gene-0.314.753e-1923.02protein:Tk06867 transcript:maker-scaffold605_size1... [more]
maker-scaffold281_size224178-snap-gene-1.204.452e-1724.43protein:Tk10990 transcript:maker-scaffold281_size2... [more]
maker-scaffold224_size251237-snap-gene-1.464.274e-1424.73protein:Tk05456 transcript:maker-scaffold224_size2... [more]
maker-scaffold58_size443543-snap-gene-0.89.998e-1421.46protein:Tk00687 transcript:maker-scaffold58_size44... [more]
maker-scaffold1571_size35388-snap-gene-0.64.804e-1221.18protein:Tk07363 transcript:maker-scaffold1571_size... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1190supercontigLSalAtl2s1190:174024..175828 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s1190-snap-gene-0.33
Biotypeprotein_coding
EvidenceManual
NotePutative cytochrome P450 CYP307A1
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000001150 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000001150EMLSAT00000001150-696997Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1190:174024..175828-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000001150-683916 ID=EMLSAG00000001150-683916|Name=EMLSAG00000001150|organism=Lepeophtheirus salmonis|type=gene|length=1805bp|location=Sequence derived from alignment at LSalAtl2s1190:174024..175828- (Lepeophtheirus salmonis)
TTGACTGTTATATACTACTTCTATAATGGCAAAAACAATAACATATATCC ACCAGGACCTTTTGGATGGCCTCTCATTGGCTCTTTGCATCTTTTAAAAA ATTATGAAAAAATTCCGTTCGAGGCATTCACAAAATTAAGAAAAATATAT GGTGATATATTTTCAATAAGAATTGGTTCGTTTAACTGTGTAGTTGTAAA CGGAAATGAATTAACTAAAGAAGTACTTTTAGCAAAAGCAGATCATTTCT CAGATAGACCTAATTTCCATAGATTTCGTAACATTTTTGGAGGAAACAAG AATAATTGTAAGTTGCAAATAACAATATTTCATAAAAAGGTATAGTCGTG GAAAATCAATTTCGATGGATTCTAAATTACTACATATTCTTTAAAAAATA TATTTAATTTGTTTTTTAAACATAATATTAAATATTTTATTTTAGAAACA TGCAGTTATGCTGCAATTATTAATATTTATAGAATTTTAAAAACGAAACA TTTTATCTTCTAGCAGTAGCATTTTGTGATTCATCATTTCTTCAAGAGGA ACGTCGCAAATTAATAAAAAAATTTACTATTCCAAAATCTCATTCTCTTT CTCTGGATCGACTTGACCGTTTGTGTCAAGAAGAACTGAATCATATGATT TTACAATTTAACATGTTCAAAAATTGGACAAACATTGATTTAAAATCTTG TATAAGTAAGGTATTGATTTTTGAACTTACTTTTTCTATAATAAAATATT GAATTTAATCAGCAATAAATTAATTATAGATTTTTAAATTTGTATAAACA TACACAAAAATTAATAAATTAATTATATCTATTTCTATAGGCAACAGCTA ATGTATTTATCCGATACTTCTGCAGTATACATTCATTTAGTTATGACGAT AAATTATTCAATTCTTTTATTCTATCATATGACGCAATTTTTTGGGAAGT TAATAATGGCCGTCTTATGGACTTTTTTCCTTGGACATCGCTGTTTGCAG GTTTCGTTCAGCAACCTCTCAACTCTCATTGTAAATTCATTAGGAGCTTT GTGGAAAATAAAATACTTTTAAATCAAAAATTTGACGACGATTTTTTAAA TACATATCAAAGGATAGAAAAAAATAAAGAATTAATATTATTCGCCCTTG AAGACTTGATTGGGGGACATTCTGCAGTAACCAATGTTATTTTAAGAATT CTTGTTCATATATTGGAACATGGAGACATCAAAAAGGAATTACAAAAAGA GATACAGCCATTTCAAGCTTTGACTTTTAAGGAAACACGAAATATGGTCT TACTTAATGCATGTTTTTATGAAACAGTTCGACTAACTTGCTCACCAATC ATACCTCACCGATCAAAAAGAGACACAAGCATAGGAAGTATGTATTTATA CATATGTTTTAATATTCTTTTATTAAAGTGGATATTTATTTTTCTAAATT TATTCCAGACTATTGCGTTAAAAATGATACAGTCATTTTCATCAACAACC ATTTCCTGAATTATTCACCCTCCCTATGGTATGAGCCATTAAATTATAAT CCTAAACGGTTCATAGATACTGAAACTGGTTTTTTATCCATTCCAGCACA TTTTCAGCCATTTTCTATTGGTCGTCGATCATGTGTTGGATATAAACTAA CACAGCTTATTTGTACTTTTTCTGTAGCCCATATACTAAAAACACTTGAT TTATCAATTAAAAATATGGAAATATCATTACCTCCAGGAATGTTGGCAAC AAAACCTGGACCTGTTGTTTTTTGTTCAAAAATATTCGCTGATACTGAAA TAATT
back to top
Add to Basket