EMLSAG00000001165, EMLSAG00000001165-683931 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001165 vs. C. finmarchicus
Match: gi|592784049|gb|GAXK01170519.1| (TSA: Calanus finmarchicus comp175_c31_seq141 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.067e+0 Identity = 17/48 (35.42%), Postives = 25/48 (52.08%), Query Frame = 0 Query: 9 SPIISTLRSNIFTLSLHPDFWCVEGVEGSSFLESDDALFPSWTSTGTD 56 P + L S I + S+ W ++ S LE +DALF +WTS+ D Sbjct: 473 QPRMRLLNSLILS-SVKTRIWLMKSRICSINLEREDALFMTWTSSAAD 613
BLAST of EMLSAG00000001165 vs. C. finmarchicus
Match: gi|592784062|gb|GAXK01170506.1| (TSA: Calanus finmarchicus comp175_c31_seq128 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.202e+0 Identity = 17/48 (35.42%), Postives = 25/48 (52.08%), Query Frame = 0 Query: 9 SPIISTLRSNIFTLSLHPDFWCVEGVEGSSFLESDDALFPSWTSTGTD 56 P + L S I + S+ W ++ S LE +DALF +WTS+ D Sbjct: 473 QPRMRLLNSLILS-SVKTRIWLMKSRICSINLEREDALFMTWTSSAAD 613
BLAST of EMLSAG00000001165 vs. C. finmarchicus
Match: gi|592780039|gb|GAXK01174529.1| (TSA: Calanus finmarchicus comp437678_c1_seq2 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.045e+0 Identity = 12/21 (57.14%), Postives = 15/21 (71.43%), Query Frame = 0 Query: 10 PIISTLRSNIFTLSLHPDFWC 30 PI+S+L NIF LSL + WC Sbjct: 1670 PIVSSLLRNIFILSLF*EAWC 1732
BLAST of EMLSAG00000001165 vs. C. finmarchicus
Match: gi|592780040|gb|GAXK01174528.1| (TSA: Calanus finmarchicus comp437678_c1_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.051e+0 Identity = 12/21 (57.14%), Postives = 15/21 (71.43%), Query Frame = 0 Query: 10 PIISTLRSNIFTLSLHPDFWC 30 PI+S+L NIF LSL + WC Sbjct: 1748 PIVSSLLRNIFILSLF*EAWC 1810
BLAST of EMLSAG00000001165 vs. C. finmarchicus
Match: gi|592784230|gb|GAXK01170338.1| (TSA: Calanus finmarchicus comp175_c19_seq109 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 5.938e+0 Identity = 13/34 (38.24%), Postives = 19/34 (55.88%), Query Frame = 0 Query: 23 SLHPDFWCVEGVEGSSFLESDDALFPSWTSTGTD 56 S+ W ++ S LE +DALF +WTS+ D Sbjct: 1301 SVKIRIWLMKSRICSINLEREDALFMTWTSSAAD 1402
BLAST of EMLSAG00000001165 vs. C. finmarchicus
Match: gi|592784231|gb|GAXK01170337.1| (TSA: Calanus finmarchicus comp175_c19_seq108 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 5.942e+0 Identity = 13/34 (38.24%), Postives = 19/34 (55.88%), Query Frame = 0 Query: 23 SLHPDFWCVEGVEGSSFLESDDALFPSWTSTGTD 56 S+ W ++ S LE +DALF +WTS+ D Sbjct: 1301 SVKIRIWLMKSRICSINLEREDALFMTWTSSAAD 1402
BLAST of EMLSAG00000001165 vs. C. finmarchicus
Match: gi|592784236|gb|GAXK01170332.1| (TSA: Calanus finmarchicus comp175_c19_seq103 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 5.998e+0 Identity = 13/34 (38.24%), Postives = 19/34 (55.88%), Query Frame = 0 Query: 23 SLHPDFWCVEGVEGSSFLESDDALFPSWTSTGTD 56 S+ W ++ S LE +DALF +WTS+ D Sbjct: 1301 SVKIRIWLMKSRICSINLEREDALFMTWTSSAAD 1402
BLAST of EMLSAG00000001165 vs. C. finmarchicus
Match: gi|592784237|gb|GAXK01170331.1| (TSA: Calanus finmarchicus comp175_c19_seq102 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 6.011e+0 Identity = 13/34 (38.24%), Postives = 19/34 (55.88%), Query Frame = 0 Query: 23 SLHPDFWCVEGVEGSSFLESDDALFPSWTSTGTD 56 S+ W ++ S LE +DALF +WTS+ D Sbjct: 1301 SVKIRIWLMKSRICSINLEREDALFMTWTSSAAD 1402
BLAST of EMLSAG00000001165 vs. C. finmarchicus
Match: gi|592784239|gb|GAXK01170329.1| (TSA: Calanus finmarchicus comp175_c19_seq100 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 6.017e+0 Identity = 13/34 (38.24%), Postives = 19/34 (55.88%), Query Frame = 0 Query: 23 SLHPDFWCVEGVEGSSFLESDDALFPSWTSTGTD 56 S+ W ++ S LE +DALF +WTS+ D Sbjct: 1301 SVKIRIWLMKSRICSINLEREDALFMTWTSSAAD 1402
BLAST of EMLSAG00000001165 vs. C. finmarchicus
Match: gi|592784241|gb|GAXK01170327.1| (TSA: Calanus finmarchicus comp175_c19_seq98 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 6.026e+0 Identity = 13/34 (38.24%), Postives = 19/34 (55.88%), Query Frame = 0 Query: 23 SLHPDFWCVEGVEGSSFLESDDALFPSWTSTGTD 56 S+ W ++ S LE +DALF +WTS+ D Sbjct: 1301 SVKIRIWLMKSRICSINLEREDALFMTWTSSAAD 1402
BLAST of EMLSAG00000001165 vs. L. salmonis peptides
Match: EMLSAP00000001165 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1193:7660:7908:-1 gene:EMLSAG00000001165 transcript:EMLSAT00000001165 description:"maker-LSalAtl2s1193-snap-gene-0.31") HSP 1 Score: 139.813 bits (351), Expect = 1.184e-44 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0 Query: 1 MNNMDINSSPIISTLRSNIFTLSLHPDFWCVEGVEGSSFLESDDALFPSWTSTGTDTFFLSNNDPFRNC 69 MNNMDINSSPIISTLRSNIFTLSLHPDFWCVEGVEGSSFLESDDALFPSWTSTGTDTFFLSNNDPFRNC Sbjct: 1 MNNMDINSSPIISTLRSNIFTLSLHPDFWCVEGVEGSSFLESDDALFPSWTSTGTDTFFLSNNDPFRNC 69 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001165 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000001165 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 19
Pagesback to top
BLAST of EMLSAG00000001165 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000001165 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000001165 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000001165 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000001165 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1193:7660..7908- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001165-683931 ID=EMLSAG00000001165-683931|Name=EMLSAG00000001165|organism=Lepeophtheirus salmonis|type=gene|length=249bp|location=Sequence derived from alignment at LSalAtl2s1193:7660..7908- (Lepeophtheirus salmonis)back to top Add to Basket
|