EMLSAG00000001220, EMLSAG00000001220-683986 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001220 vs. C. finmarchicus
Match: gi|592930610|gb|GAXK01027935.1| (TSA: Calanus finmarchicus comp301033_c2_seq8 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.403e+0 Identity = 16/48 (33.33%), Postives = 24/48 (50.00%), Query Frame = 0 Query: 20 NERNHVNFQEFHNISTKTHLCIRLSKSFADSQI---PRYKISSEFTIP 64 N+RN ++ + I KT LC +DS I P Y+I + T+P Sbjct: 3032 NDRNSAEMKKENKIENKTQLCESSQDPKSDSSIVEDPYYQIVKQQTLP 3175
BLAST of EMLSAG00000001220 vs. C. finmarchicus
Match: gi|592930625|gb|GAXK01027928.1| (TSA: Calanus finmarchicus comp301033_c2_seq1 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.407e+0 Identity = 16/48 (33.33%), Postives = 24/48 (50.00%), Query Frame = 0 Query: 20 NERNHVNFQEFHNISTKTHLCIRLSKSFADSQI---PRYKISSEFTIP 64 N+RN ++ + I KT LC +DS I P Y+I + T+P Sbjct: 3032 NDRNSAEMKKENKIENKTQLCESSQDPKSDSSIVEDPYYQIVKQQTLP 3175
BLAST of EMLSAG00000001220 vs. C. finmarchicus
Match: gi|592930609|gb|GAXK01027936.1| (TSA: Calanus finmarchicus comp301033_c2_seq9 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.416e+0 Identity = 16/48 (33.33%), Postives = 24/48 (50.00%), Query Frame = 0 Query: 20 NERNHVNFQEFHNISTKTHLCIRLSKSFADSQI---PRYKISSEFTIP 64 N+RN ++ + I KT LC +DS I P Y+I + T+P Sbjct: 3032 NDRNSAEMKKENKIENKTQLCESSQDPKSDSSIVEDPYYQIVKQQTLP 3175
BLAST of EMLSAG00000001220 vs. C. finmarchicus
Match: gi|592930616|gb|GAXK01027929.1| (TSA: Calanus finmarchicus comp301033_c2_seq2 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.419e+0 Identity = 16/48 (33.33%), Postives = 24/48 (50.00%), Query Frame = 0 Query: 20 NERNHVNFQEFHNISTKTHLCIRLSKSFADSQI---PRYKISSEFTIP 64 N+RN ++ + I KT LC +DS I P Y+I + T+P Sbjct: 3032 NDRNSAEMKKENKIENKTQLCESSQDPKSDSSIVEDPYYQIVKQQTLP 3175
BLAST of EMLSAG00000001220 vs. C. finmarchicus
Match: gi|592930601|gb|GAXK01027944.1| (TSA: Calanus finmarchicus comp301033_c2_seq17 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.641e+0 Identity = 16/48 (33.33%), Postives = 24/48 (50.00%), Query Frame = 0 Query: 20 NERNHVNFQEFHNISTKTHLCIRLSKSFADSQI---PRYKISSEFTIP 64 N+RN ++ + I KT LC +DS I P Y+I + T+P Sbjct: 3008 NDRNSAEMKKENKIENKTQLCESSQDPKSDSSIVEDPYYQIVKQQTLP 3151
BLAST of EMLSAG00000001220 vs. C. finmarchicus
Match: gi|592930603|gb|GAXK01027942.1| (TSA: Calanus finmarchicus comp301033_c2_seq15 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.641e+0 Identity = 16/48 (33.33%), Postives = 24/48 (50.00%), Query Frame = 0 Query: 20 NERNHVNFQEFHNISTKTHLCIRLSKSFADSQI---PRYKISSEFTIP 64 N+RN ++ + I KT LC +DS I P Y+I + T+P Sbjct: 3008 NDRNSAEMKKENKIENKTQLCESSQDPKSDSSIVEDPYYQIVKQQTLP 3151
BLAST of EMLSAG00000001220 vs. C. finmarchicus
Match: gi|592930605|gb|GAXK01027940.1| (TSA: Calanus finmarchicus comp301033_c2_seq13 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.641e+0 Identity = 16/48 (33.33%), Postives = 24/48 (50.00%), Query Frame = 0 Query: 20 NERNHVNFQEFHNISTKTHLCIRLSKSFADSQI---PRYKISSEFTIP 64 N+RN ++ + I KT LC +DS I P Y+I + T+P Sbjct: 3032 NDRNSAEMKKENKIENKTQLCESSQDPKSDSSIVEDPYYQIVKQQTLP 3175
BLAST of EMLSAG00000001220 vs. C. finmarchicus
Match: gi|592930606|gb|GAXK01027939.1| (TSA: Calanus finmarchicus comp301033_c2_seq12 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.642e+0 Identity = 16/48 (33.33%), Postives = 24/48 (50.00%), Query Frame = 0 Query: 20 NERNHVNFQEFHNISTKTHLCIRLSKSFADSQI---PRYKISSEFTIP 64 N+RN ++ + I KT LC +DS I P Y+I + T+P Sbjct: 3032 NDRNSAEMKKENKIENKTQLCESSQDPKSDSSIVEDPYYQIVKQQTLP 3175
BLAST of EMLSAG00000001220 vs. C. finmarchicus
Match: gi|592829421|gb|GAXK01128123.1| (TSA: Calanus finmarchicus comp1773118_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.061e+0 Identity = 16/29 (55.17%), Postives = 20/29 (68.97%), Query Frame = 0 Query: 15 RRSTTNERNHVNFQEFHNISTKTHLCIRL 43 RR T E NHV ++FHN T+ H+CIRL Sbjct: 532 RRKTVAE-NHV--RKFHNHVTRIHVCIRL 609
BLAST of EMLSAG00000001220 vs. C. finmarchicus
Match: gi|592879861|gb|GAXK01078040.1| (TSA: Calanus finmarchicus comp3136856_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 6.905e+0 Identity = 13/34 (38.24%), Postives = 19/34 (55.88%), Query Frame = 0 Query: 11 PRKMRRSTTNERNHVNFQEFHNISTKTHLCIRLS 44 PRK +T+ N +N FH I++ +LC LS Sbjct: 168 PRKAYFTTSKTHNILNIIAFHGITSWLNLCRGLS 269
BLAST of EMLSAG00000001220 vs. L. salmonis peptides
Match: EMLSAP00000001220 (pep:novel supercontig:LSalAtl2s:LSalAtl2s11:343021:345433:-1 gene:EMLSAG00000001220 transcript:EMLSAT00000001220 description:"snap_masked-LSalAtl2s11-processed-gene-3.6") HSP 1 Score: 133.265 bits (334), Expect = 3.048e-42 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0 Query: 1 MFPNAYLTFNPRKMRRSTTNERNHVNFQEFHNISTKTHLCIRLSKSFADSQIPRYKISSEFTIP 64 MFPNAYLTFNPRKMRRSTTNERNHVNFQEFHNISTKTHLCIRLSKSFADSQIPRYKISSEFTIP Sbjct: 1 MFPNAYLTFNPRKMRRSTTNERNHVNFQEFHNISTKTHLCIRLSKSFADSQIPRYKISSEFTIP 64 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001220 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000001220 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 12
Pagesback to top
BLAST of EMLSAG00000001220 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000001220 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000001220 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000001220 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000001220 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s11:343021..345433- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001220-683986 ID=EMLSAG00000001220-683986|Name=EMLSAG00000001220|organism=Lepeophtheirus salmonis|type=gene|length=2413bp|location=Sequence derived from alignment at LSalAtl2s11:343021..345433- (Lepeophtheirus salmonis)back to top Add to Basket
|