EMLSAG00000001263, EMLSAG00000001263-684029 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001263 vs. C. finmarchicus
Match: gi|592898051|gb|GAXK01060324.1| (TSA: Calanus finmarchicus comp3093919_c0_seq1 transcribed RNA sequence) HSP 1 Score: 47.3654 bits (111), Expect = 1.025e-7 Identity = 20/35 (57.14%), Postives = 30/35 (85.71%), Query Frame = 0 Query: 1 MKNIPKVTRCIAMLAKIAHAPEFDDLNIEIPSDDD 35 + +IPKVTRC+AM+AK+A+ EF+DL IE+P D++ Sbjct: 137 LGDIPKVTRCLAMMAKLANIREFEDLCIELPEDEN 241
BLAST of EMLSAG00000001263 vs. C. finmarchicus
Match: gi|592805767|gb|GAXK01148801.1| (TSA: Calanus finmarchicus comp742873_c0_seq4 transcribed RNA sequence) HSP 1 Score: 38.891 bits (89), Expect = 7.655e-5 Identity = 16/34 (47.06%), Postives = 28/34 (82.35%), Query Frame = 0 Query: 1 MKNIPKVTRCIAMLAKIAHAPEFDDLNIEIPSDD 34 + +IPKVTRC+A++AK+A+ EF+D+ ++I +D Sbjct: 51 LGDIPKVTRCLAIMAKMANVKEFEDVIVDILEED 152
BLAST of EMLSAG00000001263 vs. C. finmarchicus
Match: gi|592805770|gb|GAXK01148798.1| (TSA: Calanus finmarchicus comp742873_c0_seq1 transcribed RNA sequence) HSP 1 Score: 38.891 bits (89), Expect = 1.722e-4 Identity = 16/34 (47.06%), Postives = 28/34 (82.35%), Query Frame = 0 Query: 1 MKNIPKVTRCIAMLAKIAHAPEFDDLNIEIPSDD 34 + +IPKVTRC+A++AK+A+ EF+D+ ++I +D Sbjct: 51 LGDIPKVTRCLAIMAKMANVKEFEDVIVDILEED 152
BLAST of EMLSAG00000001263 vs. C. finmarchicus
Match: gi|592805768|gb|GAXK01148800.1| (TSA: Calanus finmarchicus comp742873_c0_seq3 transcribed RNA sequence) HSP 1 Score: 38.891 bits (89), Expect = 1.792e-4 Identity = 16/34 (47.06%), Postives = 28/34 (82.35%), Query Frame = 0 Query: 1 MKNIPKVTRCIAMLAKIAHAPEFDDLNIEIPSDD 34 + +IPKVTRC+A++AK+A+ EF+D+ ++I +D Sbjct: 51 LGDIPKVTRCLAIMAKMANVKEFEDVIVDILEED 152
BLAST of EMLSAG00000001263 vs. C. finmarchicus
Match: gi|592805769|gb|GAXK01148799.1| (TSA: Calanus finmarchicus comp742873_c0_seq2 transcribed RNA sequence) HSP 1 Score: 38.891 bits (89), Expect = 1.955e-4 Identity = 16/34 (47.06%), Postives = 28/34 (82.35%), Query Frame = 0 Query: 1 MKNIPKVTRCIAMLAKIAHAPEFDDLNIEIPSDD 34 + +IPKVTRC+A++AK+A+ EF+D+ ++I +D Sbjct: 51 LGDIPKVTRCLAIMAKMANVKEFEDVIVDILEED 152
BLAST of EMLSAG00000001263 vs. C. finmarchicus
Match: gi|592754825|gb|GAXK01199588.1| (TSA: Calanus finmarchicus comp181122_c0_seq1 transcribed RNA sequence) HSP 1 Score: 31.187 bits (69), Expect = 1.385e-1 Identity = 12/18 (66.67%), Postives = 17/18 (94.44%), Query Frame = 0 Query: 1 MKNIPKVTRCIAMLAKIA 18 +KNIPKVT+C+A L+K+A Sbjct: 736 LKNIPKVTKCLAQLSKLA 789
BLAST of EMLSAG00000001263 vs. C. finmarchicus
Match: gi|592754824|gb|GAXK01199589.1| (TSA: Calanus finmarchicus comp181122_c0_seq2 transcribed RNA sequence) HSP 1 Score: 30.4166 bits (67), Expect = 2.434e-1 Identity = 12/18 (66.67%), Postives = 17/18 (94.44%), Query Frame = 0 Query: 1 MKNIPKVTRCIAMLAKIA 18 +KNIPKVT+C+A L+K+A Sbjct: 643 LKNIPKVTKCLAQLSKLA 696
BLAST of EMLSAG00000001263 vs. C. finmarchicus
Match: gi|592954073|gb|GAXK01004480.1| (TSA: Calanus finmarchicus comp3063598_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 1.082e+0 Identity = 17/42 (40.48%), Postives = 24/42 (57.14%), Query Frame = 0 Query: 2 KNIPKVTRCIAMLAKIAHAPEFDDLNIEIPSDDDLFKSSDDE 43 +++P TRCIAM IA P D+LN+ + +L DDE Sbjct: 73 ESVPLNTRCIAMFNFIAENP--DELNMIDQEELELIGEGDDE 192
BLAST of EMLSAG00000001263 vs. C. finmarchicus
Match: gi|592840656|gb|GAXK01116888.1| (TSA: Calanus finmarchicus comp490031_c0_seq2 transcribed RNA sequence) HSP 1 Score: 25.7942 bits (55), Expect = 6.939e+0 Identity = 11/17 (64.71%), Postives = 13/17 (76.47%), Query Frame = 0 Query: 2 KNIPKVTRCIAMLAKIA 18 KNIPKVTRC+A +A Sbjct: 164 KNIPKVTRCLASCVDLA 214
BLAST of EMLSAG00000001263 vs. C. finmarchicus
Match: gi|592840657|gb|GAXK01116887.1| (TSA: Calanus finmarchicus comp490031_c0_seq1 transcribed RNA sequence) HSP 1 Score: 25.7942 bits (55), Expect = 7.155e+0 Identity = 11/17 (64.71%), Postives = 13/17 (76.47%), Query Frame = 0 Query: 2 KNIPKVTRCIAMLAKIA 18 KNIPKVTRC+A +A Sbjct: 284 KNIPKVTRCLASCVDLA 334
BLAST of EMLSAG00000001263 vs. L. salmonis peptides
Match: EMLSAP00000001263 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1206:30489:30740:-1 gene:EMLSAG00000001263 transcript:EMLSAT00000001263 description:"maker-LSalAtl2s1206-snap-gene-0.27") HSP 1 Score: 91.6633 bits (226), Expect = 1.953e-26 Identity = 45/45 (100.00%), Postives = 45/45 (100.00%), Query Frame = 0 Query: 1 MKNIPKVTRCIAMLAKIAHAPEFDDLNIEIPSDDDLFKSSDDECD 45 MKNIPKVTRCIAMLAKIAHAPEFDDLNIEIPSDDDLFKSSDDECD Sbjct: 1 MKNIPKVTRCIAMLAKIAHAPEFDDLNIEIPSDDDLFKSSDDECD 45 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001263 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000001263 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 10
BLAST of EMLSAG00000001263 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000001263 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000001263 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000001263 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000001263 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1206:30489..30740- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001263-684029 ID=EMLSAG00000001263-684029|Name=EMLSAG00000001263|organism=Lepeophtheirus salmonis|type=gene|length=252bp|location=Sequence derived from alignment at LSalAtl2s1206:30489..30740- (Lepeophtheirus salmonis)back to top Add to Basket
|