EMLSAG00000003422, EMLSAG00000003422-686188 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000003422
Unique NameEMLSAG00000003422-686188
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
RNAi_AA 3422 both
  1. PreAdult1 females
  2. PreAdult2 males
-Missing-
-Missing-
08.09.2015 - 14:26
15.10.2015 - 00:00
RNAi_AA 3422+5667+6012 both
  1. PreAdult1 females
  2. PreAdult2 males
-Missing-
-Missing-
08.09.2015 - 14:33
15.10.2015 - 00:00
Nauplii I 3422 unknown
  1. Nauplius I
-Missing-
-Missing-
01.02.2016 - 14:40
10.02.2016 - 01:41
RNAi_AE 3422 both
  1. preadult II male
  2. preadult I and II female
-Missing-
-Missing-
22.02.2016 - 10:13
Homology
BLAST of EMLSAG00000003422 vs. GO
Match: - (symbol:CG13229 species:7227 "Drosophila melanogaster" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA;ISS] [GO:0016021 "integral component of membrane" evidence=IEA;ISS] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA;ISS] [GO:0008188 "neuropeptide receptor activity" evidence=ISS] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 EMBL:AE013599 GO:GO:0016021 GO:GO:0008188 InterPro:IPR019427 Pfam:PF10324 GeneTree:ENSGT00530000064517 OrthoDB:EOG793B7R eggNOG:NOG147428 EMBL:AY099098 EMBL:AY118700 EMBL:BT081415 RefSeq:NP_001260880.1 RefSeq:NP_001260881.1 RefSeq:NP_610637.1 UniGene:Dm.33758 STRING:7227.FBpp0087301 EnsemblMetazoa:FBtr0088206 EnsemblMetazoa:FBtr0330602 EnsemblMetazoa:FBtr0330603 GeneID:36168 KEGG:dme:Dmel_CG13229 UCSC:CG13229-RA FlyBase:FBgn0033579 InParanoid:Q7JVS8 OMA:CLANIVN GenomeRNAi:36168 NextBio:797153 Uniprot:Q7JVS8)

HSP 1 Score: 240.35 bits (612), Expect = 7.998e-73
Identity = 143/354 (40.40%), Postives = 214/354 (60.45%), Query Frame = 0
Query:   30 NISEEEAMCN--LTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGR-SKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAH-----NKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLR-NGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCR 374
             + E +  C   + ++ + Y ++HG++SL +CIFGTIANILNI+VLTRKEM  +PIN IL  +AVADM VM+EYIP+T ++ +  G   K++ Y+W   L V  H +F+ ++H +SI LT++LAVWR++ IR  +       L   +  + L +++   LC+P Y    + +  +  KV      +  A  H     + +LYR N W+++ ++KL+PC IL +I+  L+  L +   R  RL+ R Y++  K  ++ N N   S       +  DRTT LLV +LVLFL+TEFPQG+LG+LS +    FF  CY P G++MD +ALIN+A+ F+ Y  MSKQFR TF   F  R
Sbjct:   53 QVDECQGYCQGEIYNWLRAYNSIHGYVSLMICIFGTIANILNIMVLTRKEMAKTPINNILKWLAVADMFVMLEYIPYTSYQYIYMGPGEKDLSYTWAVCLLV--HMHFTQILHTISIGLTVTLAVWRYVAIRHPNGGCANFLLAHSREAILLPFILSPILCLPTYFVFQVRETYDVDKV------NSEAMYHVYFDKDSVLYRFNFWIHSVLIKLLPCGILIVISAVLMHVLCEASRR--RLKLRDYNNPAKYAIQLNLNETKSKKPPRCDRRNDRTTLLLVAVLVLFLITEFPQGLLGLLSGVMEKCFFAHCYPPFGELMDLLALINAAVGFVLYGLMSKQFRTTFRSLFMKR 396          
BLAST of EMLSAG00000003422 vs. GO
Match: - (symbol:dmsr-7 "Protein DMSR-7" species:6239 "Caenorhabditis elegans" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0004930 InterPro:IPR019427 Pfam:PF10324 GeneTree:ENSGT00530000064517 OrthoDB:EOG793B7R EMBL:FO080664 PIR:C89048 PIR:T31931 RefSeq:NP_504431.2 UniGene:Cel.4587 ProteinModelPortal:O16548 SMR:O16548 STRING:6239.C35A11.1 PaxDb:O16548 EnsemblMetazoa:C35A11.1 GeneID:178922 KEGG:cel:CELE_C35A11.1 UCSC:C35A11.1 CTD:178922 WormBase:C35A11.1 eggNOG:NOG148155 HOGENOM:HOG000016210 InParanoid:O16548 OMA:ATINNCR NextBio:903134 Uniprot:O16548)

HSP 1 Score: 191.045 bits (484), Expect = 5.265e-54
Identity = 119/400 (29.75%), Postives = 209/400 (52.25%), Query Frame = 0
Query:   32 SEEEAMCNLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINK---------------KTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSK-LRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVE----TFGC------RSLNMSSNQVQMKNGQNNGLAARKRRSSPIPS 405
            S +  +  L  F + Y+ +HG++ + +C+FG   N +++ VL+R  M  S +N ILT +AV D+  M  Y+ + +H  L    S    ++  +  F+  H   S+ +H  S+WL +++A  R + +R  +L+  +        +    Y++   LCIPN +   I +                +N  + +Y    S  AT +N  L++ NIW+   + K+IPCI+L  ++  L+  +   E+   +L S   +++T SK L+  NG           ++DRTT +LVVIL++FL+TEFPQGI+ +L AI+     +  Y  +GDV+D ++L+NS++NF+ YC MS ++R+TF E    ++ C      R      +Q+Q+ N    G   RK+  +P+ +
Sbjct:   16 STQAFLRKLAHFQRWYQPIHGYVCVLICVFGIFTNFVHVAVLSRPNMRNSAVNCILTAVAVCDIGTMASYLIYIIHFVLRRNNSCTPTFTHSWLQFLLWHVVLSITLHTTSLWLAVAMAFIRRMTLRVTALNSQWQRPKFAWKLCLGIYMVVFVLCIPNMLVHEIARVEGNDWRPGKTCQKFASNYSEPVYTFMVSHAATINNCRLFKWNIWMIGILFKIIPCILLIFLSFGLVSKIRDAEKHRRKLTSVPSNASTDSKPLKKKNG-----------TSDRTTLMLVVILLVFLITEFPQGIISILCAIFTTDVHRYLYFYIGDVLDLLSLVNSSVNFVLYCVMSSRYRQTFWEVIIPSWACGLWTTRRGSPTELSQLQLNNSLRLG---RKQSYTPLAT 401          
BLAST of EMLSAG00000003422 vs. GO
Match: - (symbol:dmsr-1 "Protein DMSR-1, isoform a" species:6239 "Caenorhabditis elegans" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0004930 EMBL:Z74037 InterPro:IPR019427 Pfam:PF10324 GeneTree:ENSGT00530000064517 OrthoDB:EOG793B7R CTD:38298 PIR:T22835 RefSeq:NP_741629.1 UniGene:Cel.8974 ProteinModelPortal:Q20929 SMR:Q20929 STRING:6239.F57B7.1a PaxDb:Q20929 PRIDE:Q20929 EnsemblMetazoa:F57B7.1a GeneID:186437 KEGG:cel:CELE_F57B7.1 UCSC:F57B7.1a WormBase:F57B7.1a eggNOG:NOG147428 HOGENOM:HOG000022530 InParanoid:Q20929 OMA:IIKLLPC NextBio:931836 ArrayExpress:Q20929 Uniprot:Q20929)

HSP 1 Score: 177.948 bits (450), Expect = 1.763e-48
Identity = 121/372 (32.53%), Postives = 202/372 (54.30%), Query Frame = 0
Query:   44 YKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGR---SKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFH-SLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT-NQ----------GKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARL--RSRHYDSNTKSKLRNGNGQT-SVIVNS----------RKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETF---GCRSLNMSSNQVQ 384
            Y  Y  +H +LS+ +C+ GTIAN  NI+VLTR+ M  +P+N+ILT +A  D +V+   + +T H + +  +    K   YSW  +LF+ +H++ SLV H+ S+WL++ LA+ R++ +R   ++  +  TL      + +   +   L  PN++   IN++  N+              Y+   +DIA A++ L++R++ W+   + K++PC +L++    L++ L +V E   RL   S+H   N ++  RNG   + SV  N           R +  DRTT +L+ I+ + L+TE PQGI+ +LS +  ++F    Y  LGD++D  +L  S  +FI YC MS QFR  F   F     R L MSS  ++
Sbjct:   27 YNFYHPIHAYLSIFLCVLGTIANFCNIVVLTRRTMR-TPVNMILTAMASCDTVVLFSNLIYTTHYSFVAFKFCHPKHWSYSW--ALFLIAHAHLSLVAHSSSVWLSVMLALVRYVTLRSRGNMGGMQVTLRHSYYAVAVTVSLVAVLNAPNFLNYKINEQPLNETCTDLDPMFWNSPAYLPGIADIAKANSCLVFRLSYWISGMVFKVLPCALLSLFVWLLLRILREVRENRQRLLKNSQHRPPN-QTTTRNGQRLSISVAGNEKLGRNGSLRGRGERVDRTTHMLLAIVAVMLVTELPQGIMAVLSGMCSEEFRIYIYNNLGDILDLFSLCGSCCSFIIYCSMSGQFRNEFHRVFVPAKVRCLRMSSPSIR 394          
BLAST of EMLSAG00000003422 vs. GO
Match: - (symbol:dmsr-1 "Protein DMSR-1, isoform b" species:6239 "Caenorhabditis elegans" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0004930 EMBL:Z74037 InterPro:IPR019427 Pfam:PF10324 GeneTree:ENSGT00530000064517 CTD:38298 UniGene:Cel.8974 GeneID:186437 KEGG:cel:CELE_F57B7.1 UCSC:F57B7.1a HOGENOM:HOG000022530 NextBio:931836 RefSeq:NP_741630.1 ProteinModelPortal:Q8MQ19 SMR:Q8MQ19 EnsemblMetazoa:F57B7.1b WormBase:F57B7.1b ArrayExpress:Q8MQ19 Uniprot:Q8MQ19)

HSP 1 Score: 176.407 bits (446), Expect = 2.053e-48
Identity = 121/372 (32.53%), Postives = 202/372 (54.30%), Query Frame = 0
Query:   44 YKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGR---SKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFH-SLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT-NQ----------GKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARL--RSRHYDSNTKSKLRNGNGQT-SVIVNS----------RKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETF---GCRSLNMSSNQVQ 384
            Y  Y  +H +LS+ +C+ GTIAN  NI+VLTR+ M  +P+N+ILT +A  D +V+   + +T H + +  +    K   YSW  +LF+ +H++ SLV H+ S+WL++ LA+ R++ +R   ++  +  TL      + +   +   L  PN++   IN++  N+              Y+   +DIA A++ L++R++ W+   + K++PC +L++    L++ L +V E   RL   S+H   N ++  RNG   + SV  N           R +  DRTT +L+ I+ + L+TE PQGI+ +LS +  ++F    Y  LGD++D  +L  S  +FI YC MS QFR  F   F     R L MSS  ++
Sbjct:   27 YNFYHPIHAYLSIFLCVLGTIANFCNIVVLTRRTMR-TPVNMILTAMASCDTVVLFSNLIYTTHYSFVAFKFCHPKHWSYSW--ALFLIAHAHLSLVAHSSSVWLSVMLALVRYVTLRSRGNMGGMQVTLRHSYYAVAVTVSLVAVLNAPNFLNYKINEQPLNETCTDLDPMFWNSPAYLPGIADIAKANSCLVFRLSYWISGMVFKVLPCALLSLFVWLLLRILREVRENRQRLLKNSQHRPPN-QTTTRNGQRLSISVAGNEKLGRNGSLRGRGERVDRTTHMLLAIVAVMLVTELPQGIMAVLSGMCSEEFRIYIYNNLGDILDLFSLCGSCCSFIIYCSMSGQFRNEFHRVFVPAKVRCLRMSSPSIR 394          
BLAST of EMLSAG00000003422 vs. GO
Match: - (symbol:dmsr-8 "Protein DMSR-8" species:6239 "Caenorhabditis elegans" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0004930 EMBL:Z71185 InterPro:IPR019427 Pfam:PF10324 GeneTree:ENSGT00530000064517 OrthoDB:EOG793B7R PIR:T19743 RefSeq:NP_505697.2 UniGene:Cel.4589 ProteinModelPortal:Q18475 SMR:Q18475 PRIDE:Q18475 EnsemblMetazoa:C35A5.7 GeneID:183225 KEGG:cel:CELE_C35A5.7 UCSC:C35A5.7 CTD:183225 WormBase:C35A5.7 eggNOG:NOG244561 HOGENOM:HOG000018866 InParanoid:Q18475 OMA:QCKANET NextBio:920374 Uniprot:Q18475)

HSP 1 Score: 166.007 bits (419), Expect = 2.015e-44
Identity = 109/348 (31.32%), Postives = 180/348 (51.72%), Query Frame = 0
Query:   40 LTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTG-RSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWR-FIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTI-------------NKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIY-GDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETF 371
            +T+    Y ++H ++S+ +C+ GT  NI+ +IVLTR  M  S +N +L  IA+ D+LVM   + F  H  L  G R    +Y+  ++ F++ HS  +++ HA SIWLT+ LA  R F + R  S++    T     I+    +++   L +PN +   I             N+      ++Y++  SD    H  LL  I  W    + K++PC++LT     L+  +  V +R                      Q + ++N ++   D TT +LV +L +FL  E PQG+L + +AI+  + F+   Y+ LGDVMD ++L+NSA+NFI YC MS++FR  F++ F
Sbjct:   16 VTNINTAYAHIHPYVSVILCLAGTAMNIVTVIVLTRPSMR-SAVNSLLCAIALCDILVMTSVLVFVTHFLLFAGYRCDPTDYNIYWAYFLYYHSQATVIFHATSIWLTVLLAQIRVFSIRRATSVAGESVTNQMTCIIAVTTFIVVCLLNVPNMLTFEIIETPASLWLQCKANETAEDDMLVYLVAPSD----HCGLL-NIAFWTNGVLFKVVPCLLLTFSIVALVSIIRDVGKR--------------------RKQLAQVMNKKRMPRDHTTPMLVAVLSIFLFAELPQGVLHVFNAIFTKETFYDKIYIHLGDVMDVLSLLNSAVNFIIYCAMSRKFRAVFIQIF 337          
BLAST of EMLSAG00000003422 vs. GO
Match: - (symbol:MsR1 "Myosuppressin receptor 1" species:7227 "Drosophila melanogaster" [GO:0016021 "integral component of membrane" evidence=ISS] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISS] [GO:0004930 "G-protein coupled receptor activity" evidence=ISS] [GO:0008188 "neuropeptide receptor activity" evidence=ISS] [GO:0035013 "myosuppressin receptor activity" evidence=IDA;NAS;IPI] [GO:0007218 "neuropeptide signaling pathway" evidence=IDA] [GO:0045932 "negative regulation of muscle contraction" evidence=NAS] [GO:0005887 "integral component of plasma membrane" evidence=IDA] [GO:0007193 "adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway" evidence=IDA] [GO:0008344 "adult locomotory behavior" evidence=IMP] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 EMBL:AE014296 GO:GO:0005887 GO:GO:0007193 GO:GO:0008344 GO:GO:0008188 InterPro:IPR019427 Pfam:PF10324 GO:GO:0035013 RefSeq:NP_001261324.1 UniGene:Dm.15826 GeneID:38298 KEGG:dme:Dmel_CG8985 CTD:38298 FlyBase:FBgn0035331 OMA:NSIPMTQ Uniprot:M9PEC0)

HSP 1 Score: 155.992 bits (393), Expect = 1.856e-40
Identity = 85/189 (44.97%), Postives = 126/189 (66.67%), Query Frame = 0
Query:   40 LTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTG---RSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPN-YIATTINKKTNQ----GKVI-------YVLDWSD 213
            + +F+  Y+N+HG++SL VCI GTIAN LNIIVLTR+EM  SP N ILTG+AVAD+ VM+EYIP+T+H  +LT    R +++ YSW  + F+  HS F+ V+H +SIWLT++LAVWR+I + +   + ++C +    I +  AYV+ V +  P+ Y+ T I +  +Q    GKVI       YV+D+ +
Sbjct:   17 MDNFHTSYKNMHGYVSLVVCILGTIANTLNIIVLTRREMR-SPTNAILTGLAVADLAVMLEYIPYTIHDYILTDSLPREEKLSYSW--ACFIKFHSIFAQVLHTISIWLTVTLAVWRYIAVGYPQKNRVWCGMRTTIITITTAYVVCVLVVSPSLYLITAITEYVDQLDMNGKVINSIPMTQYVIDYRN 202          

HSP 2 Score: 140.969 bits (354), Expect = 1.802e-35
Identity = 91/209 (43.54%), Postives = 123/209 (58.85%), Query Frame = 0
Query:  206 IYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYD---SNTKSKLRNGNGQTSVIVNSR----KKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQNNGLAARKRRSSPIPSLS 407
            +Y L  SD+A  HN  L      +Y+ ++KLIPCI LTI++  LI AL + + R  +L S+      SN      NG        NS+    +K  DRTTR+L+ +L+LFL+TEFPQGI+G+L+A+ GD F+  CYL L D+MD +ALINS+INFI YC MSKQFR TF   F  + L+       +   Q+   AAR  RS+  P L 
Sbjct:  253 VYRLYHSDLAL-HNASLQNATFLIYSVVIKLIPCIALTILSVRLILALLEAKRRRKKLTSKPATPGASNGTKSPANGKAADRPRKNSKTLEKEKQTDRTTRMLLAVLLLFLITEFPQGIMGLLNAVLGDVFYLQCYLRLSDLMDILALINSSINFILYCSMSKQFRTTFTLLFRPKFLDK-----WLPVAQDEMAAARAERSAVAPVLE 455          
BLAST of EMLSAG00000003422 vs. GO
Match: - (symbol:dmsr-2 "Protein DMSR-2" species:6239 "Caenorhabditis elegans" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0004930 BRENDA:2.7.4.3 InterPro:IPR019427 Pfam:PF10324 GeneTree:ENSGT00530000064517 CTD:38296 EMBL:FO080963 RefSeq:NP_490992.2 UniGene:Cel.20317 ProteinModelPortal:Q9N476 SMR:Q9N476 PaxDb:Q9N476 PRIDE:Q9N476 EnsemblMetazoa:Y23H5B.4 GeneID:189527 KEGG:cel:CELE_Y23H5B.4 UCSC:Y23H5B.4 WormBase:Y23H5B.4 eggNOG:NOG277481 HOGENOM:HOG000017270 InParanoid:Q9N476 OMA:AIFLITE OrthoDB:EOG7Z3F89 NextBio:942726 Uniprot:Q9N476)

HSP 1 Score: 152.525 bits (384), Expect = 4.603e-40
Identity = 116/370 (31.35%), Postives = 177/370 (47.84%), Query Frame = 0
Query:   40 LTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWS-----HSNFSLVIHAVSIWLTLSLAVWRFIMI----RFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYI--------ATTINKKTNQGKVIYVLDW--SDIATAH--------NKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQ 382
            L  F   +   H ++ + +C+ G  ANI  ++VL R  M  SP NL L  IAV D  +M  Y         LT +  E+ + W FS F W+     ++ FS+ +H+ S+WLT+++A+ RF+++    R  +  P     G   + + LA+ I    C+P +I           +     +GK  Y  DW  +D+   +        N    RIN W+   ILKLIPC++LTI    L++ L +  ER +RL            + NGN Q           A+RTT +L  I+ +FL+TE PQG+L   +       F    L + +V D ++LINSA+NF+    MS  FR+ F++TFG      S N 
Sbjct:   22 LLPFTASFTMFHNYIYVFLCVIGVFANISIVVVLLRPAMRKSPFNLFLVVIAVCDASLMATY---------LTYKHVELCHPWYFS-FPWAIYTKFYAIFSVFVHSCSLWLTVNMAILRFLVLYRGSRSETRIPQCNGFGAAFVAIVLAFAIACIGCLPIFIRYRIIEGEVGAVPDLCLEGK--YSTDWQPNDMIQFYGLSQPLWWNCDWERINYWMAALILKLIPCLLLTIFMTLLVRMLIEARERRSRL---------CGGMGNGNSQ-----------AERTTAMLTGIVAIFLITELPQGVLTFAAGANPRLTFLT--LQMNNVFDLLSLINSAVNFVLCALMSHVFRREFLQTFGVCCPQSSENH 357          
BLAST of EMLSAG00000003422 vs. GO
Match: - (symbol:dmsr-6 "Protein DMSR-6" species:6239 "Caenorhabditis elegans" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0004930 EMBL:Z81468 InterPro:IPR019427 Pfam:PF10324 GeneTree:ENSGT00530000064517 EMBL:AL021181 PIR:T19228 RefSeq:NP_497004.1 UniGene:Cel.13905 ProteinModelPortal:G5EGR5 SMR:G5EGR5 EnsemblMetazoa:Y54G11B.1 GeneID:190297 KEGG:cel:CELE_Y54G11B.1 CTD:190297 WormBase:Y54G11B.1 OMA:INCYVAF OrthoDB:EOG793B7R NextBio:945292 Uniprot:G5EGR5)

HSP 1 Score: 150.599 bits (379), Expect = 2.052e-39
Identity = 100/367 (27.25%), Postives = 184/367 (50.14%), Query Frame = 0
Query:   47 YRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT-----NQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSR--KKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLN---MSSNQVQMKNGQNNGLAARKRRSSPI 403
            Y NVH +LS  +C+ G  AN ++I VLTR  M  S ++ +L  IA++DM  M  Y+ +      L+ +     YS+ ++LF+  H+  S+ +HA++++L + +A  R   ++  +   +  T      +    +V    +C+P  +A  I++ T     N     Y + +S +   +   L + N+WL    LK IPC++L   T  LI                       ++LR  N +  +++     KK  D TT +L++++ +FL TE PQGI+ +L+A++  +F +  YL L DV+D ++LIN  + F+ Y F S ++R+T         ++   +S+ Q  +K+ Q+ G     +R++ +
Sbjct:   30 YSNVHPFLSFILCVLGLAANAIHITVLTRPRMRHSSVHTVLVCIAISDMGTMTSYLMYISRFEFLSDKEG---YSYFWALFLKCHAMLSIALHAITLYLVVLMAFIRLSAMKLTTSRWLDHTRALTSAIFIALFVF--IMCVPTLLAHQIDETTRGVTMNGMYYKYSVGFSTLMMQNGCSLMKGNLWLTGIFLKAIPCLLLLTFTIALI-----------------------NRLRENNEKRKILIKEERAKKRGDFTTYMLLLMVTVFLFTELPQGIMAILNALFTTQFHQMVYLNLADVLDLLSLINCYVAFLVYSFTSSRYRQTLFSLLPLTKISYSGISTRQGTLKSHQHPGAKTLVQRANSV 368          
BLAST of EMLSAG00000003422 vs. GO
Match: - (symbol:dmsr-5 "Protein DMSR-5" species:6239 "Caenorhabditis elegans" [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR017452 PROSITE:PS50262 GO:GO:0016021 EMBL:AL023844 InterPro:IPR019427 Pfam:PF10324 GeneTree:ENSGT00530000064517 OrthoDB:EOG793B7R HOGENOM:HOG000016210 PIR:T26979 RefSeq:NP_499413.1 UniGene:Cel.9764 ProteinModelPortal:Q9XXD5 EnsemblMetazoa:Y48A6B.1 GeneID:190009 KEGG:cel:CELE_Y48A6B.1 UCSC:Y48A6B.1 CTD:190009 WormBase:Y48A6B.1 eggNOG:NOG257406 InParanoid:Q9XXD5 OMA:VIMAYIR NextBio:944370 Uniprot:Q9XXD5)

HSP 1 Score: 145.206 bits (365), Expect = 1.903e-37
Identity = 116/377 (30.77%), Postives = 189/377 (50.13%), Query Frame = 0
Query:   39 NLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCK-IMLFLAYVIPVFLCIPNYIATTINKKT-----NQGKVIYVLDWSDIATAH---NKL----LYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKL-----------RNGNGQT--SVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQ 389
             L  F + Y  +H +L L VC FG + N L+  VLTRK M    IN +L  +++ D++ M  Y  + L   +    S  I YS+ + +F+ +H   S+ +H  S++L++ +A  R+  +    L   +   G  K I++F A ++ V + IP  +   I   T     N+  ++    +  + T      K+    L+R+N+W+   + K +PC+++   T  LI  L ++ E+   LR    + N + +L           RN        V   SR  S DRTT +L+++LV+FL TE PQG+L +LSAIY        Y+ +G+V+D M+LIN   +FI YC MS  +R T V++  CRS   +S +   KN  
Sbjct:   22 QLIAFNQVYTVLHRYLCLFVCFFGVLLNSLHFYVLTRKAMRVYIINALLCAMSICDIITMTSYFIYILRFRIFDTPSTIIGYSYPWLIFLITHVTSSIALHTTSLYLSVIMAYIRWTAL--DRLDAKWINHGALKQILIFTALIVSV-ISIPTVMVHKIVPVTEVLGMNETDLLEGAKFDGLYTVQLDETKINGCALFRVNLWITGIMFKALPCLLILWFTIALIYKLVQMSEKRKILRGEKRE-NVEFQLLATSATPTTTTRNEASPRLRKVSQCSRNVSIDRTTLMLIIMLVVFLCTEMPQGLLSILSAIYPTHVHTMIYVNVGEVLDLMSLINCLTSFIVYCVMSTTYRAT-VKSVLCRS---TSRRTVFKNTH 390          
BLAST of EMLSAG00000003422 vs. GO
Match: - (symbol:MsR2 "Myosuppressin receptor 2" species:7227 "Drosophila melanogaster" [GO:0004930 "G-protein coupled receptor activity" evidence=ISS] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISS] [GO:0016021 "integral component of membrane" evidence=ISS] [GO:0008188 "neuropeptide receptor activity" evidence=ISS] [GO:0035013 "myosuppressin receptor activity" evidence=IDA;NAS;IPI] [GO:0007218 "neuropeptide signaling pathway" evidence=IDA] [GO:0045932 "negative regulation of muscle contraction" evidence=NAS] [GO:0007193 "adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway" evidence=IDA] [GO:0005887 "integral component of plasma membrane" evidence=IDA] [GO:0008345 "larval locomotory behavior" evidence=IMP] [GO:0002209 "behavioral defense response" evidence=IMP] [GO:0008344 "adult locomotory behavior" evidence=IMP] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 EMBL:AE014296 GO:GO:0005887 GO:GO:0007193 GO:GO:0008344 GO:GO:0008345 GO:GO:0008188 GO:GO:0002209 InterPro:IPR019427 Pfam:PF10324 RefSeq:NP_001261323.1 UniGene:Dm.22163 GeneID:38296 KEGG:dme:Dmel_CG43745 CTD:38296 FlyBase:FBgn0264002 GO:GO:0035013 Uniprot:M9PDT9)

HSP 1 Score: 147.517 bits (371), Expect = 2.320e-37
Identity = 78/164 (47.56%), Postives = 109/164 (66.46%), Query Frame = 0
Query:   39 NLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLT---GRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIP-NYIATTINK 198
             + DF+  Y+  HG+ SL VCI GTIAN LNIIVLTR+EM  SP N ILTG+AVAD+ VM+EYIP+T+H  +L+    R +++ YSW  + F+  HS F  V+H +SIWLT++LAVWR+I + +   + I+C +    I +  AYV+ V +  P  Y+ T I K
Sbjct:   14 GIDDFHTNYKYFHGYFSLIVCILGTIANTLNIIVLTRREMR-SPTNAILTGLAVADLAVMLEYIPYTVHDYILSVRLPREEQLSYSW--ACFIKFHSVFPQVLHTISIWLTVTLAVWRYIAVSYPQRNRIWCGMRTTLITIATAYVVCVLVVSPWLYLVTAIAK 174          

HSP 2 Score: 120.553 bits (301), Expect = 3.706e-28
Identity = 83/216 (38.43%), Postives = 123/216 (56.94%), Query Frame = 0
Query:  170 GRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGK---VIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGN-----GQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLN 377
            G    +L L  VIP+       ++T +   ++ G+    +Y L  S +A   ++        +Y+ ++KLIPC  LTI++  LI AL + + R   L    + +N    + NG         S  +  ++K  DRTTR+L+ +L+LFL+TEFPQGI+G+L+ + GD FF  CYL L D+MD +ALINS+INFI YC MS+QFR TF   F  R L+
Sbjct:  227 GTAVSLLSLTTVIPL-----TTLSTGVTTSSSLGERNVTVYKLYHSALA-LRDRQFRNATFLIYSVLIKLIPCFALTILSVRLIGALLEAKRRRKILAC--HAANDMQPIVNGKVVIPTQPKSCKLLEKEKQTDRTTRMLLAVLLLFLVTEFPQGIMGLLNVLLGDAFFLQCYLKLSDLMDILALINSSINFILYCSMSRQFRSTFALLFRPRWLD 434          
BLAST of EMLSAG00000003422 vs. C. finmarchicus
Match: gi|592886276|gb|GAXK01072099.1| (TSA: Calanus finmarchicus comp2379194_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 330.102 bits (845), Expect = 6.331e-107
Identity = 184/351 (52.42%), Postives = 243/351 (69.23%), Query Frame = 0
Query:   29 DNISEEEAMCNLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIE----YSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKK---TNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRXXXXXXXXXXXTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFG 372
            DN S+   +CN   F   Y  +HG+LS+ VCI GT  NILNI+VL+ K+M  +PINLILTGIAVADML+M+EYIPFT+H  ++  +++E E    Y WG  + V  H NFSL+IH VSIWLTLSLAVWR+IMI+FH+L+  +CTL RCKI+L L YV+P FL +PNY++ ++         G+ I V  W       N+ LYRIN+W Y+  LKLIPCIILT++T  L++A+ +  +R+ RLR+   + + K  L +G G+ +V   SR+K  DRTTRLL+ IL LFLLTEFPQG+LG L+A+  + FF DCY PLG++MD MALIN  INFI YC MS+ FR T  +  G
Sbjct:  119 DNESDI-PLCNFGGFQAAYTPLHGYLSILVCILGTFFNILNIVVLSHKDMRDNPINLILTGIAVADMLMMVEYIPFTVHMYMMDNKNREREERLGYVWG--MVVLFHVNFSLMIHTVSIWLTLSLAVWRYIMIKFHALAVSWCTLRRCKIVLVLGYVVPAFLTLPNYLSLSLTPSPEINTSGENITV--WR--LQMSNEHLYRINVWFYSCFLKLIPCIILTLVTALLVRAMIQAVKRAQRLRNIG-NRSEKRVLIHGEGKRTV---SRQKKTDRTTRLLIAILFLFLLTEFPQGVLGFLAAVLDETFFFDCYTPLGELMDMMALINCTINFILYCLMSRLFRTTGRKILG 1138          
BLAST of EMLSAG00000003422 vs. C. finmarchicus
Match: gi|592763353|gb|GAXK01191214.1| (TSA: Calanus finmarchicus comp691290_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 296.975 bits (759), Expect = 5.204e-95
Identity = 168/355 (47.32%), Postives = 222/355 (62.54%), Query Frame = 0
Query:   32 SEEEAMCNLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLT--GRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT---NQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRXXXXXXXXXXXTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSN 381
            S   A+CNL      Y   HG L++ VC  GT+ N+LNI+VLT K+M  +PINLILTGIAVAD LV IEYIPFT H  L+   GR  E  YS  + +F+  H+NF+++IH VSIWLTLSLA WR IMI+F +L+   CTL RCK +L L + +P+ L IPN ++  +       + G  + +     I    NK ++ +N+WLY+F LKL+PC++LTI+T  LI+ALYKVEE S  LR      N  S                 K+ D+TT+LL +IL+ FL+ E PQGILGMLSAI G +FF +CY P+G++MD MALINSA NFI Y  MS +F+KT     G +     +N
Sbjct:  222 SMGPALCNLESVKDSYLPYHGVLAMVVCGMGTVFNLLNIMVLTHKDMKSNPINLILTGIAVADCLVSIEYIPFTFHMYLMNDEGRDPEEMYSLAWGIFLLFHTNFTIMIHTVSIWLTLSLAFWRLIMIKFSTLAITMCTLSRCKAVLTLGFAVPLLLTIPNLLSIQLGSHQAMKDDGSCVTIYTLQII----NKSVFSLNMWLYSFFLKLLPCLVLTILTTCLIRALYKVEENSHNLRLAGSQLNIHS-----------------KNTDKTTKLLSIILIFFLVAELPQGILGMLSAILGQQFFLECYNPVGEMMDMMALINSAANFILYFIMSCEFKKTLKRICGIKPKQRKTN 1223          
BLAST of EMLSAG00000003422 vs. C. finmarchicus
Match: gi|592763352|gb|GAXK01191215.1| (TSA: Calanus finmarchicus comp691290_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 285.034 bits (728), Expect = 3.359e-91
Identity = 158/322 (49.07%), Postives = 209/322 (64.91%), Query Frame = 0
Query:   56 LCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLT--GRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT---NQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRXXXXXXXXXXXTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFG 372
            + VC  GT+ N+LNI+VLT K+M  +PINLILTGIAVAD LV IEYIPFT H  L+   GR  E  YS  + +F+  H+NF+++IH VSIWLTLSLA WR IMI+F +L+   CTL RCK +L L + +P+ L IPN ++  +       + G  + +     I    NK ++ +N+WLY+F LKL+PC++LTI+T  LI+ALYKVEE S  LR      N  S                 K+ D+TT+LL +IL+ FL+ E PQGILGMLSAI G +FF +CY P+G++MD MALINSA N+I YC MS  FR+T  +  G
Sbjct:  168 MVVCGMGTVFNLLNIMVLTHKDMKSNPINLILTGIAVADCLVSIEYIPFTFHMYLMNDEGRDPEEMYSLAWGIFLLFHTNFTIMIHTVSIWLTLSLAFWRLIMIKFSTLAITMCTLSRCKAVLTLGFAVPLLLTIPNLLSIQLGSHQAMKDDGSCVTIYTLQII----NKSVFSLNMWLYSFFLKLLPCLVLTILTTCLIRALYKVEENSHNLRLAGSQLNIHS-----------------KNTDKTTKLLSIILIFFLVAELPQGILGMLSAILGQQFFLECYNPVGEMMDMMALINSAANYILYCLMSSDFRQTLRKLSG 1070          
BLAST of EMLSAG00000003422 vs. C. finmarchicus
Match: gi|592869846|gb|GAXK01087716.1| (TSA: Calanus finmarchicus comp1849926_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 269.24 bits (687), Expect = 4.185e-85
Identity = 147/308 (47.73%), Postives = 202/308 (65.58%), Query Frame = 0
Query:   97 VMIEYIPFTLHRNLLTGRSKEIE----YSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTI-------NKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRXXXXXXXXXXXTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRS--LNMSSNQVQMKNGQNN 391
            VM+EYIPF +H  L+ G S+ +E    Y+WG  LF+  H NFS+++H VSIW TL LAVWR IMI+FH+++  YCT GRC ++L L YV+P+ L +PN++A ++       +K TNQ   +Y + WS +A ++N+LLY++N+W Y+F LKL+PC +L+IIT  LI+ALY       R RSR+ DS    +           +  RK   DRTTRLL+VIL LFL++EFPQGILG+LS + G++FF  CY PLG++MD MALIN A NFI YC MS QF  T    FG +   L +SS  ++  N Q+ 
Sbjct:    2 VMVEYIPFAIHMYLIQGNSRTLEEKFSYNWG--LFLLFHVNFSMILHTVSIWYTLVLAVWRLIMIKFHTMAVTYCTRGRCSVLLVLGYVLPIILTVPNFMAMSVKGTTTVSSKGTNQ--TLYSITWSPLAESNNRLLYKLNVWFYSFFLKLVPCTLLSIITCLLIRALYMFSSLEDRKRSRNMDSKRMKQ-----------ITIRKIRTDRTTRLLIVILCLFLISEFPQGILGVLSGMLGNEFFISCYTPLGEMMDMMALINGAANFIPYCLMSSQFWNTLCTMFGIQKKLLFLSSQFLRQPNSQSK 880          
BLAST of EMLSAG00000003422 vs. C. finmarchicus
Match: gi|592869847|gb|GAXK01087715.1| (TSA: Calanus finmarchicus comp1849926_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 267.314 bits (682), Expect = 2.001e-84
Identity = 144/305 (47.21%), Postives = 200/305 (65.57%), Query Frame = 0
Query:   97 VMIEYIPFTLHRNLLTGRSKEIE----YSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT-----NQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRXXXXXXXXXXXTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRS--LNMSSNQVQMKNGQN 390
            VM+EYIPF +H  L+ G S+ +E    Y+WG  LF+  H NFS+++H VSIW TL LAVWR IMI+FH+++  YCT+ RC ++L L Y++ + L IPN++A ++N  T     +  + +Y + WS +A +H++LLY+IN+W Y+F LKL+PC +L+IIT  LI+ALY       R RSR+ DS    +           +  RK   DRTTRLL+VIL LFL++EFPQGILG+LS + G++FF  CY PLG++MD MALIN A NFI YC MS QF  T    FG +   L +SS  ++  N Q+
Sbjct:    2 VMVEYIPFAIHMYLIQGNSRTLEEKFSYNWG--LFLLFHVNFSMILHTVSIWYTLVLAVWRLIMIKFHTMAVTYCTMHRCCVLLVLGYIVALVLTIPNFLAMSVNGTTSAVNNSSNQTLYSITWSTLAESHSRLLYKINVWFYSFFLKLVPCTLLSIITCLLIRALYMFSSLEDRKRSRNMDSKRMKQ-----------ITIRKIRTDRTTRLLIVILCLFLISEFPQGILGVLSGMLGNEFFISCYTPLGEMMDMMALINGAANFIPYCLMSSQFWNTLCTMFGIQKKLLFLSSQFLRQPNSQS 877          
BLAST of EMLSAG00000003422 vs. C. finmarchicus
Match: gi|592763350|gb|GAXK01191217.1| (TSA: Calanus finmarchicus comp691290_c0_seq4 transcribed RNA sequence)

HSP 1 Score: 201.445 bits (511), Expect = 4.353e-60
Identity = 113/232 (48.71%), Postives = 154/232 (66.38%), Query Frame = 0
Query:  147 LSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGK-----VIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVI-VNSRKKSADRTTRXXXXXXXXXXXTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFG 372
            LSLA+WR +MI+F +++   CTL RCK +L L YV+P  L  PN ++  I  K  + K      +Y+L         N+ ++ +N+WLY+FILKL+PC++LTI+T  LIKALYKV+E S ++R+              N + SV+  NSR KS D+TT+LL VIL+LFL+ EFPQGILGMLSAI G +FF +CY P+G++MD MALINSA N+I YC MS  FR+T  +  G
Sbjct:  168 LSLAIWRLLMIQFPTIASNLCTLSRCKTVLALGYVLPFILTAPNLLSIQIGFKQEKRKDGSCATLYMLQ------IINQSIFSLNMWLYSFILKLVPCVVLTILTACLIKALYKVDENSQKMRT------------GSNSEISVLRQNSRSKSTDKTTKLLAVILILFLVAEFPQGILGMLSAILGQQFFLECYNPVGEMMDMMALINSAANYILYCLMSSDFRQTLRKLSG 809          
BLAST of EMLSAG00000003422 vs. C. finmarchicus
Match: gi|592763351|gb|GAXK01191216.1| (TSA: Calanus finmarchicus comp691290_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 196.823 bits (499), Expect = 4.386e-58
Identity = 114/241 (47.30%), Postives = 156/241 (64.73%), Query Frame = 0
Query:  147 LSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGK-----VIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVI-VNSRKKSADRTTRXXXXXXXXXXXTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSN 381
            LSLA+WR +MI+F +++   CTL RCK +L L YV+P  L  PN ++  I  K  + K      +Y+L         N+ ++ +N+WLY+FILKL+PC++LTI+T  LIKALYKV+E S ++R+              N + SV+  NSR KS D+TT+LL VIL+LFL+ EFPQGILGMLSAI G +FF +CY P+G++MD MALINSA NFI Y  MS +F+KT     G +     +N
Sbjct:  222 LSLAIWRLLMIQFPTIASNLCTLSRCKTVLALGYVLPFILTAPNLLSIQIGFKQEKRKDGSCATLYMLQ------IINQSIFSLNMWLYSFILKLVPCVVLTILTACLIKALYKVDENSQKMRT------------GSNSEISVLRQNSRSKSTDKTTKLLAVILILFLVAEFPQGILGMLSAILGQQFFLECYNPVGEMMDMMALINSAANFILYFIMSCEFKKTLKRICGIKPKQRKTN 890          
BLAST of EMLSAG00000003422 vs. C. finmarchicus
Match: gi|592840835|gb|GAXK01116709.1| (TSA: Calanus finmarchicus comp1076838_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 181.415 bits (459), Expect = 2.093e-52
Identity = 90/183 (49.18%), Postives = 126/183 (68.85%), Query Frame = 0
Query:   36 AMCNLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTG--RSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINK----KTNQGKVIYVLDWS 212
             +C+L D  + Y N+HG L++ VCIFGT+ N+ NI+VLT ++M  +PIN+ILTGIAVAD LVM+EYIPFT+H  LL    R +E E+S  +  F+  H+NFS++IH VSIWLTLSLA+WRFIMI+F + +   CTL RC+ +L L YV+   L +PN++   ++     K   G+ I  L +S
Sbjct:  202 TLCSLEDLKEDYLNIHGQLAMVVCIFGTLFNVANILVLTHRDMKMNPINMILTGIAVADCLVMVEYIPFTIHMYLLKNWDRDQEEEFSLAWGYFLLFHTNFSIMIHTVSIWLTLSLAIWRFIMIKFSTHAVTLCTLSRCRAVLVLGYVVSFVLTVPNFLLFHVHSEDATKEENGECITFLLYS 750          
BLAST of EMLSAG00000003422 vs. C. finmarchicus
Match: gi|592840833|gb|GAXK01116711.1| (TSA: Calanus finmarchicus comp1076838_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 173.711 bits (439), Expect = 5.153e-50
Identity = 88/194 (45.36%), Postives = 132/194 (68.04%), Query Frame = 0
Query:   26 TVGDNISEEEA-MCNLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTG--RSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINK----KTNQGKVIYVLDWS 212
            ++G ++ +++  +C+L      Y  +HG+L+L VC+ GT  N++N++VLT K+M  +PIN+ILTGIAVAD LVM+EYIPF LH  LL    R KE ++S  +++F+  H+NFS++IH VSIWLTLSLA+WRFIMI+F + +   CTL RC+ +L L YV+   L +PN++   ++     K   G+ I  L +S
Sbjct:   51 SLGSHVGQQDGELCSLGRVKAAYLPIHGYLALAVCLLGTAFNMVNMLVLTHKDMRLNPINIILTGIAVADCLVMVEYIPFNLHMYLLDDQMREKEEKFSHTWAIFLLFHTNFSIMIHTVSIWLTLSLAIWRFIMIKFSTHAVTLCTLSRCRAVLVLGYVVSFVLTVPNFLLFHVHSEDATKEENGECITFLLYS 632          
BLAST of EMLSAG00000003422 vs. C. finmarchicus
Match: gi|592840834|gb|GAXK01116710.1| (TSA: Calanus finmarchicus comp1076838_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 171.785 bits (434), Expect = 5.535e-49
Identity = 87/186 (46.77%), Postives = 124/186 (66.67%), Query Frame = 0
Query:   33 EEEAMCNLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTG--RSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINK----KTNQGKVIYVLDWS 212
            E   +C+L      Y ++HG L++ VC+ GT+ N+ NI+VLT ++M  +PIN+ILTGIAVAD LVM+EYIPFT+H  LL    R +E E+S  +  F+  H+NFS++IH VSIWLTLSLA+WRFIMI+F + +   CTL RC+ +L L YV+   L +PN++   ++     K   G+ I  L +S
Sbjct:  174 EVGQLCSLEHIKDDYLHIHGELAMVVCVLGTLFNVANILVLTHRDMKMNPINMILTGIAVADCLVMVEYIPFTIHMYLLKNWDRDQEEEFSLAWGYFLLFHTNFSIMIHTVSIWLTLSLAIWRFIMIKFSTHAVTLCTLSRCRAVLVLGYVVSFVLTVPNFLLFHVHSEDATKEENGECITFLLYS 731          
BLAST of EMLSAG00000003422 vs. L. salmonis peptides
Match: EMLSAP00000003422 (pep:novel supercontig:LSalAtl2s:LSalAtl2s188:1709:12916:1 gene:EMLSAG00000003422 transcript:EMLSAT00000003422 description:"maker-LSalAtl2s188-snap-gene-0.5")

HSP 1 Score: 837.025 bits (2161), Expect = 0.000e+0
Identity = 408/408 (100.00%), Postives = 408/408 (100.00%), Query Frame = 0
Query:    1 MVVPRELNVTTKDLLHLFASSPISPTVGDNISEEEAMCNLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQNNGLAARKRRSSPIPSLSI 408
            MVVPRELNVTTKDLLHLFASSPISPTVGDNISEEEAMCNLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQNNGLAARKRRSSPIPSLSI
Sbjct:    1 MVVPRELNVTTKDLLHLFASSPISPTVGDNISEEEAMCNLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQNNGLAARKRRSSPIPSLSI 408          
BLAST of EMLSAG00000003422 vs. L. salmonis peptides
Match: EMLSAP00000005667 (pep:novel supercontig:LSalAtl2s:LSalAtl2s307:216793:221090:-1 gene:EMLSAG00000005667 transcript:EMLSAT00000005667 description:"maker-LSalAtl2s307-snap-gene-2.6")

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 301/378 (79.63%), Postives = 333/378 (88.10%), Query Frame = 0
Query:   33 EEEAMCNLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSR----HYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQM-KNGQNNGLAARKRRSSPIPS 405
            E EA+CNL +FYKGYR +HGWLSLCVCIFGTIANILNI+VLTRKEMNGSPINLILTGIA+ADMLVMIEYIPFTLHRNLLTGRSKE EYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFH+LSPIYCTL RCK+MLFLAY+IPVFLCIPNYIATTINKKTNQGK+IYVLDWS+IATAHNKLLYRINIWLYTF+LKLIPCI+LTIITGWLIK LYK EERSARL++R      +++TK  + NG+ + +  + SRK+S DRTTRLLVVIL+LFLLTEFPQGILGMLSAIYGD+FFKDCYLPLGDVMDAMAL NSAINFI YC MSKQFRKTFV+TF C+S++    Q  +  N   N     + R + IPS
Sbjct:   47 EPEAICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPGRQTNLIVNKCGNDSTTVRIRGNTIPS 424          
BLAST of EMLSAG00000003422 vs. L. salmonis peptides
Match: EMLSAP00000006012 (pep:novel supercontig:LSalAtl2s:LSalAtl2s326:50134:54814:1 gene:EMLSAG00000006012 transcript:EMLSAT00000006012 description:"maker-LSalAtl2s326-augustus-gene-0.7")

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 287/380 (75.53%), Postives = 330/380 (86.84%), Query Frame = 0
Query:    5 RELNVTTKDLLHLFASSPISPTVGDN-----ISEEEAMCNLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSK----LRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRS 375
            +ELNVTT DL+HLF++ P    +GDN     I E+E MCNLT FYK YR +HGWLS+CVCIFGTIAN+LNI +LTRKEMN SPINLILTGIA+ADMLVMIEYIPFTLHRNLLTGRSKE EYSW FSLFVWSHSNFSLVIHAVSIWLTLSLAVWR IMI+F++LSPIYCT+ RCKI+L LAY+IP+F+C+PNY+ATTINKK N GKVIYVLDWS+IATAHNKLLYRINIWLYTF+LKLIPC+ILTIITGWLIKALY  EERSARL+ + +   +++     + N +G+    + SRK+  DRTTRLLVVIL+LFLLTEFPQGILGMLSA+YGD+FF+DCYLPLGDVMDAMALINS+INFI YC MS+QFRKTF++TF C S
Sbjct:   32 KELNVTTLDLIHLFSNFPDKTYLGDNFSSYYIDEKEYMCNLTGFYKSYRKIHGWLSICVCIFGTIANLLNIAILTRKEMNSSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWEFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRLIMIQFYTLSPIYCTIKRCKILLTLAYIIPIFICVPNYMATTINKKKNDGKVIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCVILTIITGWLIKALYIAEERSARLKEKVHTGGSRNNIIVTILNESGKAKGSLTSRKRDTDRTTRLLVVILILFLLTEFPQGILGMLSAVYGDQFFRDCYLPLGDVMDAMALINSSINFILYCAMSQQFRKTFIQTFNCFS 411          
BLAST of EMLSAG00000003422 vs. L. salmonis peptides
Match: EMLSAP00000003457 (pep:novel supercontig:LSalAtl2s:LSalAtl2s189:199228:350969:1 gene:EMLSAG00000003457 transcript:EMLSAT00000003457 description:"maker-LSalAtl2s189-augustus-gene-3.6")

HSP 1 Score: 114.775 bits (286), Expect = 3.493e-28
Identity = 118/419 (28.16%), Postives = 190/419 (45.35%), Query Frame = 0
Query:   50 VHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLH----RNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKI----MLFLAYV---------------IPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLY-TFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGML----SAIYGDKFFKDCYLPLGDVMDAMALINSAI------NFIFYCFMSKQFRKTFVETF------GCRS------------------LNMSSNQVQMKNGQNNGLAARKRRS-----SPIPS 405
            ++G++   +     ++NIL IIVL++K+M  SP NL+L  +A++D+L +I   P+ L+     N+ T  +KE  Y++   L          + H  SIWLTL+LA+ R+I +   S++ ++CTL + K     + F+A++               I   +C  NYI+          KV +  DW     + N   Y I  W +    + LIPC+ L I+   L + + + E++  RL   H      SK   G  + S     + + ++ TT +L+V++ +FL  E P GI+ +L    S IY        +L  G V   + ++N  I      NF  YC MS+QFR+TF E F      G RS                  +N  + Q Q +  QNNG      ++      P PS
Sbjct:   82 IYGYIMPIILAVTFLSNILIIIVLSKKQMK-SPTNLVLMSMAISDLLTVIFPAPWYLYIYTMGNVETFNNKETGYAYETML-----ETMPQIFHTASIWLTLALALQRYIYVCHASIARVWCTLEKTKKAIAGIFFVAFLHQTTRFFDKKFEDMTIEYPVCSNNYISIC--------KVSFA-DWVVQDVSLNG--YFITFWWFRVLFVHLIPCVSLVILNILLFRTMKEAEKKRERL--XHCKQKAASK---GESKES----KKLRDSNCTTLMLIVVITVFLAVELPLGIITILHTMSSTIYD-------FLDYGFVKSIVLIVNLCICLSYPLNFGIYCGMSRQFRETFKELFMQRVTSGFRSHNNNTNNNNKNHINTANPINQLNRQPQGRTTQNNGAGTEINKTVHSSVKPDPS 467          
BLAST of EMLSAG00000003422 vs. L. salmonis peptides
Match: EMLSAP00000002622 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1528:6379:33986:-1 gene:EMLSAG00000002622 transcript:EMLSAT00000002622 description:"maker-LSalAtl2s1528-augustus-gene-0.6")

HSP 1 Score: 59.6918 bits (143), Expect = 5.098e-10
Identity = 76/345 (22.03%), Postives = 155/345 (44.93%), Query Frame = 0
Query:   50 VHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSL-VIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATA--HNKLLYRINI-WLYTFILKLIPCIILTIITGWLIKALYKVEE-----RSARLRSRHYDSNTKSK----LRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGI--LGMLSAIYGDKFFKDCY-LPLGDVM----DAMALINSAINFIFYCFMSKQFRKTFVETFGCR 374
            V G++   V +FG I  ++ + VL +  +  S  +++L G+A+ D   +   I       L+ G  K  ++    S+++    N  + +    S++LT+S+ + R+  I    + P++    + K +L  +    +   IP ++      +  Q    +  +   +AT+   N++   + + WL    ++LIP +++ I+   ++  + K ++     R  +L S+  +S+  S+    + + N   +    SR++        LV + +LF+  +  + I  L  L     D     CY  P  D +    + +   NSA NF+ Y    K+FR  F+ET+GCR
Sbjct:    9 VDGFVLTIVSLFGLIGTLMAVRVLLKTNLRNS-FSVLLIGLALCDAHFLALAI-------LIFGLPKASDWFSTISIYMSPFCNGLIGIARTGSVYLTMSVTLERYFAI----VRPLHHFYAK-KYLLPASLTFAILYNIPKFL------ELKQAVFPFTNETMIVATSLRENRIYQTVYVFWLKVIFMELIPYLVIIILNTLIVTKIRKSKKFRKSIRQQQLLSKRVESSPNSRNFLRMASQNPAPTAQPYSRQEQEISLAITLVFVSILFISCQSLKIIPDLYELFCQKDDSSNMKCYSTPFIDTIVSLSNVLTCFNSAANFLVYMLRGKKFRDAFLETYGCR 334          
BLAST of EMLSAG00000003422 vs. L. salmonis peptides
Match: EMLSAP00000006807 (pep:novel supercontig:LSalAtl2s:LSalAtl2s382:146876:192943:-1 gene:EMLSAG00000006807 transcript:EMLSAT00000006807 description:"maker-LSalAtl2s382-augustus-gene-2.10")

HSP 1 Score: 59.6918 bits (143), Expect = 5.146e-10
Identity = 92/413 (22.28%), Postives = 169/413 (40.92%), Query Frame = 0
Query:   42 DFYKGYRNVHGWLSLCVC------IFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMI-RFHSL-SPIYCTLGRCKIMLFLA--YVIPVFLCIPNYIATTINKKTNQGKVIYVLD----WSDIATAHNKLLYRINI---WLYTFILKLIPCIILTIITGWLIKALYKVEERSA-------RLRSRHYDSNTKSKL-RNGNGQTSVIVNSRK--------------------------KSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCY-------LPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQ--NNGLA 394
            D Y+ Y +V  + ++ +C      I G I N L  I +T  +   S  N+ +  +A+ADMLVMI  +P T+          ++  +W F   +       +V++   I +++S+    FI   R++++  P+  +  + K  + +A  + I   + IPN I+       +  +    L     + D+++   K    ++     L   +L  +P I ++I    ++K L++    +        R+  R   S T S + RNG+   S I +S +                          ++  +  ++L+ ++++F +  FP   L +   I   K     Y       +  G     M  +NSAIN I Y FMS QF+  +     CR    SS+ +   N    NNG A
Sbjct:   50 DVYQSYISVDKFETVLICLIALVFICGIIGNALVFIAVTTTKSMQSVTNIFIVNLAMADMLVMIFCVPPTV--------IWDVTNTWIFGSLMCR-----IVLYIQDISVSVSVLTLTFIAYDRYYAICRPLQFSSRKTKAAVXIAAIWTISAIIGIPNAISLEAVTPFDDEEQFPCLARDEIFFDLSSCKPKWGENVDFTITLLKAVVLYSLPIIFMSIAYYHIVKTLWRRNNMTGSQVTSDNRINRRTLLSKTASSMHRNGSATASFIESSSRAGTLESPGRIHCKRNISANKNLDNQLRTRRKVAKMLIAVVIIFTINSFPVHCLPIAQYIL-RKQNPTVYERINWFIIQAGIFTHCMFYLNSAINPIIYYFMSAQFKAQYRRILSCRCTGXSSSPIGHSNRTYLNNGNA 448          
BLAST of EMLSAG00000003422 vs. L. salmonis peptides
Match: EMLSAP00000008367 (pep:novel supercontig:LSalAtl2s:LSalAtl2s510:291080:292438:1 gene:EMLSAG00000008367 transcript:EMLSAT00000008367 description:"maker-LSalAtl2s510-snap-gene-1.3")

HSP 1 Score: 59.3066 bits (142), Expect = 6.607e-10
Identity = 78/362 (21.55%), Postives = 153/362 (42.27%), Query Frame = 0
Query:   20 SSPISPTVGDNISEEEAMCNLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLV--IHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIP-NYIATTINKKTNQGKVIYVLDW--SDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVIL----VLFLLTEFPQGILGMLSAI-YGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETF 371
            S+ I  T+  ++++E+   NL          + +++  +   G I NILN++VL+R  + G  + + L G+AV+++  +I  IP     NL+ G+S    Y   +  F  +H    L+    A S+++ + + V R+I I   +      T    +I +  +++    L IP  +    ++  TN   ++    W   D     ++ L+++ +++   +L+  P I L I+                                      ++++ +R +   R  R+LV++L    +LF+    P G L +   I  G+      +       + + L+N A+NF  YC  S + RK FV  F
Sbjct:   11 STQILSTLKTDMAQED---NLQSIEMVNWIAYNFIAYIIVSIGIIGNILNLVVLSRPNLKGV-MYVYLLGLAVSNLAXLISAIPAL--ANLVNGKSDNSNY---YGAFFQAHMEIPLLNSFMASSVYIIICMTVNRYISIYKPTHFQRIHTYKNARIAITCSFLGGTLLHIPLCFEKQVLSNCTNLTGIMEHCTWKSEDNKAVTDEQLFQVYLYISETLLRFGPIITLAIL--------------------------------------NILIITRFRRIARKQRMLVIVLIAIVILFVCCTTPAGFLSIFINIRRGNNL---GFAVFRATANNLELLNFALNFYIYCLCSAEIRKAFVSLF 322          
BLAST of EMLSAG00000003422 vs. L. salmonis peptides
Match: EMLSAP00000001770 (pep:novel supercontig:LSalAtl2s:LSalAtl2s12:909316:1005829:1 gene:EMLSAG00000001770 transcript:EMLSAT00000001770 description:"maker-LSalAtl2s12-augustus-gene-10.6")

HSP 1 Score: 57.7658 bits (138), Expect = 2.503e-9
Identity = 40/137 (29.20%), Postives = 65/137 (47.45%), Query Frame = 0
Query:  242 LTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTS--VIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLP--LGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCR 374
            L + +GW+ + + K  +      S H   NT  +L  G  +    V   + KK   +  + L  IL+ F++T  P  +L +L+A+ G K   D Y+P  L D    +  INS +N + Y   +  FR+T+V    CR
Sbjct:  501 LPLDSGWVGRQMIKRSQSGGSSYSPH---NTLQRLTGGGKKNPGKVKKTNEKKQXRKAAKTLSAILLAFIVTWTPYSVLTVLNAVLG-KETADVYIPPTLWDFAYYLCYINSTVNPVLYALCNAAFRRTYVRILTCR 633          
BLAST of EMLSAG00000003422 vs. L. salmonis peptides
Match: EMLSAP00000012081 (pep:novel supercontig:LSalAtl2s:LSalAtl2s863:198955:217784:-1 gene:EMLSAG00000012081 transcript:EMLSAT00000012081 description:"maker-LSalAtl2s863-augustus-gene-1.25")

HSP 1 Score: 54.299 bits (129), Expect = 2.635e-8
Identity = 82/353 (23.23%), Postives = 152/353 (43.06%), Query Frame = 0
Query:   56 LCVCIFGTIANILNIIVL---TRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEY---SWGFSLFVWSHSNFSLVIHAV-SIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTI-----NKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSA-----------RLRS----------RHYD------SNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVE 369
            +C+ I G   N+  ++V+    RK  N +  NL L  +AVAD+L++    P  L           + Y    +G        + +S V+ AV SI   LS+ + RFI+I F   S   CT+   + +L   + + + L +P     ++            KV Y  D+ D       L +  +I+    +  ++P  I+ I   ++I+ L+K  +R A           R RS          +H+D       N +S+  +GN +    V +++K   +  ++L+ ++VLF L   P+ I+ ++        F      +  ++  +  +++ +N I Y  MSK FR + V+
Sbjct:   68 ICI-ILGVFWNLFTLLVMIKGDRKSRNAT--NLFLISLAVADLLLVTVAAPMEL-----------VHYFAPQFGSGGSGCKIAEYSRVLSAVASILNLLSVTLERFIVIVFPMRSRSLCTMTNSRRVLGAVWGLSLILTLPVLYTKSVYDVYYANNVTIVKVTYCNDYDD------SLGFAFSIYQLVVVF-IVPGNIILICYSFVIRELWKSTKRMASMTNHNSYTANRKRSSAHENSVYINQHHDDGGIGNDNKRSRHFHGNHRKREDVGAQRK---QVIKMLICVVVLFFLCWGPRFIMEIIIKSKTQNLFYPSIYWIRVLLFLLPFVHACVNPIIYIIMSKTFRSSIVK 396          
BLAST of EMLSAG00000003422 vs. L. salmonis peptides
Match: EMLSAP00000001067 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1178:5502:31635:-1 gene:EMLSAG00000001067 transcript:EMLSAT00000001067 description:"maker-LSalAtl2s1178-augustus-gene-0.4")

HSP 1 Score: 53.5286 bits (127), Expect = 3.994e-8
Identity = 86/362 (23.76%), Postives = 156/362 (43.09%), Query Frame = 0
Query:   30 NISEEEAMCNLTDFYKGYRNV--------HGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIM----IRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRI--NIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDC------YLPLGDVMDA------MALINSAINFIFYCFMSKQFRK 365
            N+SE    C   D  + Y NV         G L   V I G +AN+++I+VL+ ++M     N +L  +A+ D+L ++  IP    R L T       +S  +  F++  S  +L     SI++TL++ V R++     I + +L+    +  R  + +    ++ + L IP ++    +   N  ++      SD+      +LY     I+  T    ++P   L ++   +   +     R  +L  R   SN+   L +GN  +S    S   S      +L+ I+++ ++    +  L  L A++  K   DC      Y+P    M A      M +I+ + NF+ YC  SK F+ 
Sbjct:    7 NVSER---CGSMD--EDYFNVWSTWQWWCEGVLFTGVGIIGLVANLVSIVVLSTQDMRKHTFNQLLIALAIFDLLFILVSIPVYAFR-LFTIFVGNQVFSLLYIYFLYPMSPVTL---CASIYMTLAITVERYLAVCKPILYRNLNVTMTSTRRVALYVTPVCIVSICLNIPKFMENQAHSTDNSTEI----QVSDMRINPTFMLYYTISQIFHPTLTTGILPMAALXLLNTSIFLGI-----RKTQLHRRIRASNS---LAHGNSSSSEPRTSLSSSETNLAVILIGIVIMHVICHTLRVFLAAL-ALHFIKDTLDCMQHKGEYVPPLWTMCAESLSSLMIMISFSGNFLIYCSASKHFKA 346          
BLAST of EMLSAG00000003422 vs. SwissProt
Match: gi|75017612|sp|Q8SWR3.1|SPR_DROME (RecName: Full=Sex peptide receptor)

HSP 1 Score: 88.1965 bits (217), Expect = 7.126e-18
Identity = 94/357 (26.33%), Postives = 161/357 (45.10%), Query Frame = 0
Query:   50 VHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKE---IEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCK------IMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLY-TFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALIN------SAINFIFYCFMSKQFRKTFVETFGCRSLNM--SSNQVQMKNG 388
            ++G+    + I   I+N L ++VL++K M  +P N +L G+A+ DML +I   P   +        K    +     +S+F   +     + H +S+WLTL+LAV R+I +    ++  +CT+ R +       +L   + +P F     Y+   I    +  +V ++     +       LY  + +L+    + L+PCIIL  +   L  A+ + +ER   L   +     K KLR  N                TT +L+V++ +FLL E P   + +++A++        +L  G     + L N        INF  YC MS+QFR+TF E F  R +    SS +  + NG
Sbjct:   91 LYGYCMPFLLIITIISNSLIVLVLSKKSM-ATPTNFVLMGMAICDMLTVIFPAPGLWYMYTFGNHYKPLHPVSMCLAYSIF---NEIMPAMCHTISVWLTLALAVQRYIYVCHAPMARTWCTMPRVRRCTAYIALLAFLHQLPRFF-DRTYMPLVIEWNGSPTEVCHLETSMWVHDYIGVDLYYTSYYLFRVLFVHLLPCIILVTLNILLFAAMRQAQERRKLLFRENRKKECK-KLRETNC---------------TTLMLIVVVSVFLLAEIP---IAVVTAMHIVSSLIIEFLDYGLANICIMLTNFFLVFSYPINFGIYCGMSRQFRETFKEIFLGRLMAKKDSSTKYSIVNG 423          
BLAST of EMLSAG00000003422 vs. SwissProt
Match: gi|56749105|sp|Q9VZW5.1|FMAR_DROME (RecName: Full=FMRFamide receptor; Short=DFR; Short=DrmFMRFa-R; AltName: Full=Larval opioid receptor)

HSP 1 Score: 73.559 bits (179), Expect = 7.328e-13
Identity = 87/366 (23.77%), Postives = 163/366 (44.54%), Query Frame = 0
Query:   50 VHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYS---WGFSLFVW---SHSNF--SLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNY--IATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQ----NNGLAARKRRSS 401
            V G L   V + G + NI+++I+L+R +M  S IN +LTG+A  D +++I  I       LL G      Y+   +G+  +V+   S + F   ++    SI++T ++ + R++ +     +   CT GR KI   +     +   +P +  + T    +  +  +++ +  S +  +   +   I+ W Y  +  +IP + L I+   +    Y+  +R+ R R R                   +  S K+     T LL V++V F+L   P  +L +  A Y     K     +  + + +  INS++NF+ Y    ++F++ F+  F  R L  S +Q  + + +    NNG      RSS
Sbjct:  115 VCGVLINIVGVLGILGNIISMIILSRPQMRSS-INYLLTGLARCDTVLIITSI-------LLFGIPSIYPYTGHFFGYYNYVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCVRPSRLRRSETYINIYIH-WCYLIVNYIIPFLTLAILNCLI----YRQVKRANRERQR-------------------LSRSEKREIGLATMLLCVVIVFFMLNFLPL-VLNISEAFYSTIDHK-----ITKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKRRL--SRDQPDLIHYESSISNNGDGTLNHRSS 440          
BLAST of EMLSAG00000003422 vs. SwissProt
Match: gi|2495022|sp|Q28596.1|TRFR_SHEEP (RecName: Full=Thyrotropin-releasing hormone receptor; Short=TRH-R; AltName: Full=Thyroliberin receptor)

HSP 1 Score: 70.4774 bits (171), Expect = 4.610e-12
Identity = 77/335 (22.99%), Postives = 152/335 (45.37%), Query Frame = 0
Query:   47 YRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGF---SLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTF-ILKLIPCIILTIITGWLIKALYKVE-ERSARLRSRHYDSNTKSKLRNGNGQTS-VIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRS 375
            Y+ V   L L +C  G + NI+ ++V+ R +   +P N  L  +AVAD++V++           L   +  I  SW +        ++  + L I+A S  +T +  + R+I I     +   CT  R K ++   +      C+  +    +N  T +  ++    +     + N   Y   I+L  F +  ++P I+ T++ G++ + L+        +  S  + +++  + +N N +TS    NS   S  + T++L V+++LF L   P   L ++++     F ++ +L    +      +NSAIN + Y  MS++FR  F +   C+ 
Sbjct:   24 YQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVA--------AGLPNITDSIYGSWVYGYVGCLCITYLQY-LGINASSCSIT-AFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVVSCGYK---ISRN---YYSPIYLMDFGVFYVVPMILATVLYGFIARILFLSPIPSDPKENSNTWKNDSTHQNKNLNSKTSNRYFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRI---CIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQ 339          
BLAST of EMLSAG00000003422 vs. SwissProt
Match: gi|9910884|sp|O46639.1|TRFR_BOVIN (RecName: Full=Thyrotropin-releasing hormone receptor; Short=TRH-R; AltName: Full=Thyroliberin receptor)

HSP 1 Score: 70.0922 bits (170), Expect = 5.574e-12
Identity = 77/335 (22.99%), Postives = 152/335 (45.37%), Query Frame = 0
Query:   47 YRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGF---SLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTF-ILKLIPCIILTIITGWLIKALY-KVEERSARLRSRHYDSNTKSKLRNGNGQTS-VIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRS 375
            Y+ V   L L +C  G + NI+ ++V+ R +   +P N  L  +AVAD++V++           L   +  I  SW +        ++  + L I+A S  +T +  + R+I I     +   CT  R K ++   +      C+  +    +N  T +  ++    +     + N   Y   I+L  F +  ++P I+ T++ G++ + L+        +  S  + +++  + +N N +TS    NS   S  + T++L V+++LF L   P   L ++++     F ++ +L    +      +NSAIN + Y  MS++FR  F +   C+ 
Sbjct:   24 YQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVA--------AGLPNITDSIYGSWVYGYVGCLCITYLQY-LGINASSCSIT-AFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVVSCGYK---ISRN---YYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSNMWKNDSTHQNKNLNSKTSNRYFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRI---CIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQ 339          
BLAST of EMLSAG00000003422 vs. SwissProt
Match: gi|464921|sp|P34981.1|TRFR_HUMAN (RecName: Full=Thyrotropin-releasing hormone receptor; Short=TRH-R; AltName: Full=Thyroliberin receptor)

HSP 1 Score: 70.0922 bits (170), Expect = 6.678e-12
Identity = 78/339 (23.01%), Postives = 151/339 (44.54%), Query Frame = 0
Query:   47 YRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGF---SLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTF-ILKLIPCIILTIITGWLIKALY------KVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRS 375
            Y+ V   L L +C  G + NI+ ++V+ R +   +P N  L  +AVAD++V++           L   +  I  SW +        ++  + L I+A S  +T +  + R+I I     +   CT  R K ++   +      C+  +    +N  T +  ++    +     + N   Y   I+L  F +  ++P I+ T++ G++ + L+        +E S   ++     NT   +   N   +  V+SRK+     T++L V+++LF L   P   L ++++     F ++ +L    +      +NSAIN + Y  MS++FR  F +   C+ 
Sbjct:   24 YQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVA--------AGLPNITDSIYGSWVYGYVGCLCITYLQY-LGINASSCSIT-AFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSLYCMLWFFLLDLNISTYKDAIVISCGYK---ISRN---YYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQ----VTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRI---CIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQ 339          
BLAST of EMLSAG00000003422 vs. SwissProt
Match: gi|136205|sp|P21761.1|TRFR_MOUSE (RecName: Full=Thyrotropin-releasing hormone receptor; Short=TRH-R; AltName: Full=Thyroliberin receptor)

HSP 1 Score: 67.781 bits (164), Expect = 3.415e-11
Identity = 76/335 (22.69%), Postives = 152/335 (45.37%), Query Frame = 0
Query:   47 YRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGF---SLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTF-ILKLIPCIILTIITGWLIKALY-KVEERSARLRSRHYDSNTKSKLRNGN-GQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRS 375
            Y+ V   L + +C  G + NI+ ++V+ R +   +P N  L  +AVAD++V++           L   +  I  SW +        ++  + L I+A S  +T +  + R+I I     +   CT  R K ++   +      C+  +    +N  T +  V+    +     + N   Y   I+L  F +  ++P I+ T++ G++ + L+        +  S+ + +++  + +N N   T+   NS   S  + T++L V+++LF L   P   L ++++     F ++ +L    +      +NSAIN + Y  MS++FR  F +   C+ 
Sbjct:   24 YQVVTILLVVIICGLGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVA--------AGLPNITDSIYGSWVYGYVGCLCITYLQY-LGINASSCSIT-AFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKNAVVVSCGYK---ISRN---YYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKMWKNDSIHQNKNLNLNATNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRI---CIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQ 339          
BLAST of EMLSAG00000003422 vs. SwissProt
Match: gi|267163|sp|Q01717.1|TRFR_RAT (RecName: Full=Thyrotropin-releasing hormone receptor; Short=TRH-R; AltName: Full=Thyroliberin receptor)

HSP 1 Score: 62.3882 bits (150), Expect = 1.976e-9
Identity = 71/323 (21.98%), Postives = 145/323 (44.89%), Query Frame = 0
Query:   59 CIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGF---SLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTF-ILKLIPCIILTIITGWLIKALY-KVEERSARLRSRHYDSNTKSKLRNGN-GQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRS 375
            C  G + NI+ ++V+ R +   +  N  L  +AVAD++V++           L   +  I  SW +        ++  + L I+A S  +T +  + R+I I     +   CT  R K ++   +      C+  +    +N  T +  ++    +     + N   Y   I+L  F +  ++P I+ T++ G++ + L+        +  S+ + +++  + +N N   T+   NS   S  + T++L V+++LF L   P   L ++++     F ++ +L    +      +NSAIN + Y  MS++FR  F +   C+ 
Sbjct:   36 CGLGIVGNIMVVLVVMRTKHMRTATNCYLVSLAVADLMVLVA--------AGLPNITDSIYGSWVYGYVGCLCITYLQY-LGINASSCSIT-AFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVISCGYK---ISRN---YYSPIYLMDFGVFYVMPMILATVLYGFIARILFLNPIPSDPKENSKTWKNDSTHQNKNMNLNTTNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRI---CIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQ 339          
BLAST of EMLSAG00000003422 vs. SwissProt
Match: gi|1027923717|sp|Q18321.2|DAF37_CAEEL (RecName: Full=G-protein coupled receptor daf-37; AltName: Full=Abnormal dauer formation protein 37)

HSP 1 Score: 62.003 bits (149), Expect = 2.913e-9
Identity = 86/342 (25.15%), Postives = 151/342 (44.15%), Query Frame = 0
Query:   58 VCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFV-W-SHSNFSLVIHAVS----IWLTLSLAVWRFIMIRFHSLSPIYCTLGRCK-IMLFLAYVIPVFLCIPNY-IATTINKKTNQGK--VIYVLDWSDIATAHNKLLYRI-NIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYD-SNTKSKL----------RNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFF----KDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGC 373
            + +FG   N    ++LTR  M  +P NL LT +AV D  ++I           +      IEY+  F L+V W ++  F+  +  +S    +++T+++ + R++ +     S   C  G     +L +     VF C   + +  T+N     G     Y+L  S  A A N +  ++ ++W+  F++   P + L +    +   + +  E+        YD  N KS +          RN  G +S   N  K+ +   T +LV+I+ +FL   F   +L +L  I G +         Y    + ++ +A+INS+INF+ Y    K FRK  V  +GC
Sbjct:   43 IGLFGLFGNATTALILTRPSMR-NPNNLFLTALAVFDSCLLITAF-------FIYAMEYIIEYTAAFDLYVAWLTYLRFAFALSHISQTGSVYITVAVTIERYLAVCHPKSSKNMCGPGGAAWTILGVTTFAVVFNCTKFFELQVTVNPSCPDGSNWQSYILLPS--AMASNPIYQQVYSLWVTNFVMVFFPFLTLLLFNAIIAYTIRQSLEK--------YDFHNQKSVVAALSASVNLPRNIAGISSR--NELKEKSREATLVLVIIVFIFLGCNFWGFVLTLLERIMGQETLMVEHHIFYTFSREAINFLAIINSSINFVIYLLFGKDFRKELVVVYGC 364          
BLAST of EMLSAG00000003422 vs. SwissProt
Match: gi|150387823|sp|Q10904.2|YWO1_CAEEL (RecName: Full=Probable G-protein coupled receptor AH9.1)

HSP 1 Score: 60.4622 bits (145), Expect = 7.651e-9
Identity = 66/322 (20.50%), Postives = 137/322 (42.55%), Query Frame = 0
Query:   62 GTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLV--IHAVSIWLTLSLAVWRFIM----IRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQ--GKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRS 375
            G I   LN+  L       + I L L   A+AD+L ++ +IPF      L   +K I+ SW   +F  +H    L+  + + S    +++ V R++     I+F   +    +  R  +++ + Y I + +  P+     +   T+    K IY +  ++   A    +++  + +   I +  P ++L I+   +++ L K+++R+   R    +S T++  +         + S +    R + LL V    F++   P  ++           F   +  + +++   + +    NF  Y   S ++R  F+  FGCRS
Sbjct:   70 GMINQCLNVCTLLHIR---TSIFLYLKASAIADILSIVAFIPF------LFRHAKLIDPSWELGMFYHAHLELPLINALISASALNIVAMTVDRYVSVCHPIKFFQNNETKPSRRRTMLIIVMIYFIALMIYFPSVFQKKLGVVTDALTNKTIYTIVRNEDVEALQ--VFKFYLIVRECICRWGPVLLLVILNMCVVRGLRKIDKRNWFWRQPSQNSRTETLAQRQ-------LRSPRDDRSRISVLLFVTSATFIICNIPASVISFFVRRVSGSLFWQIFRAIANLLQVTSYL---YNFYLYALCSSEYRHAFLRLFGCRS 370          
BLAST of EMLSAG00000003422 vs. SwissProt
Match: gi|6226254|sp|O93603.1|TRFR_CHICK (RecName: Full=Thyrotropin-releasing hormone receptor; Short=TRH-R; AltName: Full=Thyroliberin receptor)

HSP 1 Score: 58.9214 bits (141), Expect = 2.396e-8
Identity = 74/351 (21.08%), Postives = 156/351 (44.44%), Query Frame = 0
Query:   28 GDNISEEEAMCNLTDFYKG-YRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEY-IPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALY-KVEERSARLRSRHYDSNTKSKLRNGNGQ-TSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCR 374
            GD  +    + +  +F    Y+ V   L L +C  G + NI+ ++V+ R +   +P N  L  +AVAD++V++   +P     N+     K   Y +   L + ++  + L I+A S  +T +  + R+I I     +   CT  R K ++   +      C+  +    +N    +   +    +  ++ ++   +Y ++      I  ++P ++ T++ G + + L+        +  S  + ++   + +  N + T+   NS   S  + T++L V++VLF     P   L ++++     F ++ +L    +      +NSAIN + Y  MS++FR  F +   C 
Sbjct:    6 GDEQNHTGLLLSSQEFVTAEYQVVTILLVLLICGLGIVGNIMVVLVVLRTKHMRTPTNCYLVSLAVADLMVLVAAGLP-----NITESLYKSWVYGYVGCLCI-TYLQY-LGINASSFSIT-AFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWSFASVYCMLWFFLLDLNIAVYKDTTVVSCGY-KVSRSYYSPIYMMDFG----IFYVLPMVLATVLYGLIARILFLNPIPSDPKENSNTWKNDMAQQNKTVNSKMTNKSFNSTIASRRQVTKMLAVVVVLFAFLWMPYRTLVVVNSFLSSPFQENWFLLFCRI---CIYLNSAINPVIYNLMSQKFRAAFRKLCNCH 340          
BLAST of EMLSAG00000003422 vs. Select Arthropod Genomes
Match: EEB14579.1 (class A rhodopsin-like G-protein coupled receptor GPRmys, putative [Pediculus humanus corporis])

HSP 1 Score: 324.709 bits (831), Expect = 3.500e-107
Identity = 174/384 (45.31%), Postives = 253/384 (65.89%), Query Frame = 0
Query:    5 RELNVTTKDLLHLFASSPISPTVGDNISEEEAMC----------NLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNY----IATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLR---SRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETF 371
            + +N+T +DL   F     + T+   I     +C           L  F  GY++VHG+LSL VC+FGTIAN++N+ VLTR+EM  +PIN ILTG+AVAD+LVM+EYIPF+++  L+    +   YSW  ++F+  H +FS +IH +SI LTL+LAVWR+I IR+   S  +CT  RC++ +  ++V+P+ LCIP+Y    I TT   + +    +Y LD SD+A  +++LL  +  W Y  ++KL+PC+ILT+I+  LIKALY++ +R+  L+   S H++ N+  +         VI+   K+  DRTTR+LV IL+LFLLTE PQGILG+LS I G  FF++CY   G++MD +AL+NSAINFI YCFMS+QFR+TF + F
Sbjct:   32 QSMNLTEEDLYRFFKMHFPNDTIRGLILAPREICLYDPDKYCDGTLKAFANGYKDVHGYLSLMVCLFGTIANLINVAVLTRREMATNPINRILTGLAVADVLVMLEYIPFSVYMYLIFPGQRNFPYSW--AVFILFHVHFSQIIHTISICLTLALAVWRYIAIRYPHKSITWCTGPRCRVAIGTSFVLPLILCIPSYFVFYIKTTRITENSAEIYLYHLDLSDVAKENDQLLCNVTFWTYGVLIKLLPCVILTVISIRLIKALYEINKRNKLLKTANSTHHNENSVER--------RVIL--AKERTDRTTRMLVAILILFLLTELPQGILGLLSGILGTCFFRNCYNLFGEIMDILALVNSAINFILYCFMSRQFRQTFEKVF 403          
BLAST of EMLSAG00000003422 vs. Select Arthropod Genomes
Match: XP_396970.5 (PREDICTED: neuromedin-U receptor 1-like isoform X1 [Apis mellifera])

HSP 1 Score: 294.664 bits (753), Expect = 1.806e-95
Identity = 166/394 (42.13%), Postives = 256/394 (64.97%), Query Frame = 0
Query:    6 ELNVTTKDLLHL--FASSPISPTVGDNISEE-EAMCNLT--DFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT-NQG---KVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQN 390
             LN+T +D+ ++  F  + +S +  +N  ++ +  CN T  D    Y+N HG+++L VC+FGT+AN+LNI+VLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCK+ L+ +++ P   C P+Y+   I K+T N+    ++ Y++D +D  + H    Y++N W+   ++KL+PC+ILT+I+ WLIKALY+ + R   L+S +   N       GNG      +  ++ ADRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL+N AINFI YC MS+QFR TF + F  R +       Q  + Q+
Sbjct:   40 SLNITDEDIDYVNKFMDN-LSISCNENCEQQIDCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIVVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKMALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVD-ADY-SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALKSYNQCKNISVM---GNGLIPKRPSKSERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFKPRIMKKWQPATQQTDVQS 424          
BLAST of EMLSAG00000003422 vs. Select Arthropod Genomes
Match: XP_016767544.1 (PREDICTED: neuromedin-U receptor 1-like isoform X1 [Apis mellifera])

HSP 1 Score: 294.664 bits (753), Expect = 1.806e-95
Identity = 166/394 (42.13%), Postives = 256/394 (64.97%), Query Frame = 0
Query:    6 ELNVTTKDLLHL--FASSPISPTVGDNISEE-EAMCNLT--DFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT-NQG---KVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQN 390
             LN+T +D+ ++  F  + +S +  +N  ++ +  CN T  D    Y+N HG+++L VC+FGT+AN+LNI+VLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCK+ L+ +++ P   C P+Y+   I K+T N+    ++ Y++D +D  + H    Y++N W+   ++KL+PC+ILT+I+ WLIKALY+ + R   L+S +   N       GNG      +  ++ ADRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL+N AINFI YC MS+QFR TF + F  R +       Q  + Q+
Sbjct:   40 SLNITDEDIDYVNKFMDN-LSISCNENCEQQIDCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIVVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKMALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVD-ADY-SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALKSYNQCKNISVM---GNGLIPKRPSKSERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFKPRIMKKWQPATQQTDVQS 424          
BLAST of EMLSAG00000003422 vs. Select Arthropod Genomes
Match: XP_016767543.1 (PREDICTED: neuromedin-U receptor 1-like isoform X1 [Apis mellifera])

HSP 1 Score: 294.664 bits (753), Expect = 1.806e-95
Identity = 166/394 (42.13%), Postives = 256/394 (64.97%), Query Frame = 0
Query:    6 ELNVTTKDLLHL--FASSPISPTVGDNISEE-EAMCNLT--DFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT-NQG---KVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQN 390
             LN+T +D+ ++  F  + +S +  +N  ++ +  CN T  D    Y+N HG+++L VC+FGT+AN+LNI+VLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCK+ L+ +++ P   C P+Y+   I K+T N+    ++ Y++D +D  + H    Y++N W+   ++KL+PC+ILT+I+ WLIKALY+ + R   L+S +   N       GNG      +  ++ ADRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL+N AINFI YC MS+QFR TF + F  R +       Q  + Q+
Sbjct:   40 SLNITDEDIDYVNKFMDN-LSISCNENCEQQIDCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIVVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKMALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVD-ADY-SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALKSYNQCKNISVM---GNGLIPKRPSKSERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFKPRIMKKWQPATQQTDVQS 424          
BLAST of EMLSAG00000003422 vs. Select Arthropod Genomes
Match: XP_016767542.1 (PREDICTED: neuromedin-U receptor 1-like isoform X1 [Apis mellifera])

HSP 1 Score: 294.664 bits (753), Expect = 1.806e-95
Identity = 166/394 (42.13%), Postives = 256/394 (64.97%), Query Frame = 0
Query:    6 ELNVTTKDLLHL--FASSPISPTVGDNISEE-EAMCNLT--DFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT-NQG---KVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQN 390
             LN+T +D+ ++  F  + +S +  +N  ++ +  CN T  D    Y+N HG+++L VC+FGT+AN+LNI+VLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCK+ L+ +++ P   C P+Y+   I K+T N+    ++ Y++D +D  + H    Y++N W+   ++KL+PC+ILT+I+ WLIKALY+ + R   L+S +   N       GNG      +  ++ ADRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL+N AINFI YC MS+QFR TF + F  R +       Q  + Q+
Sbjct:   40 SLNITDEDIDYVNKFMDN-LSISCNENCEQQIDCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIVVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKMALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVD-ADY-SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALKSYNQCKNISVM---GNGLIPKRPSKSERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFKPRIMKKWQPATQQTDVQS 424          
BLAST of EMLSAG00000003422 vs. Select Arthropod Genomes
Match: XP_016767541.1 (PREDICTED: neuromedin-U receptor 1-like isoform X1 [Apis mellifera])

HSP 1 Score: 294.664 bits (753), Expect = 1.806e-95
Identity = 166/394 (42.13%), Postives = 256/394 (64.97%), Query Frame = 0
Query:    6 ELNVTTKDLLHL--FASSPISPTVGDNISEE-EAMCNLT--DFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT-NQG---KVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQN 390
             LN+T +D+ ++  F  + +S +  +N  ++ +  CN T  D    Y+N HG+++L VC+FGT+AN+LNI+VLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCK+ L+ +++ P   C P+Y+   I K+T N+    ++ Y++D +D  + H    Y++N W+   ++KL+PC+ILT+I+ WLIKALY+ + R   L+S +   N       GNG      +  ++ ADRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL+N AINFI YC MS+QFR TF + F  R +       Q  + Q+
Sbjct:   40 SLNITDEDIDYVNKFMDN-LSISCNENCEQQIDCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIVVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKMALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVD-ADY-SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALKSYNQCKNISVM---GNGLIPKRPSKSERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFKPRIMKKWQPATQQTDVQS 424          
BLAST of EMLSAG00000003422 vs. Select Arthropod Genomes
Match: XP_016767540.1 (PREDICTED: neuromedin-U receptor 1-like isoform X1 [Apis mellifera])

HSP 1 Score: 294.664 bits (753), Expect = 1.806e-95
Identity = 166/394 (42.13%), Postives = 256/394 (64.97%), Query Frame = 0
Query:    6 ELNVTTKDLLHL--FASSPISPTVGDNISEE-EAMCNLT--DFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT-NQG---KVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQN 390
             LN+T +D+ ++  F  + +S +  +N  ++ +  CN T  D    Y+N HG+++L VC+FGT+AN+LNI+VLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCK+ L+ +++ P   C P+Y+   I K+T N+    ++ Y++D +D  + H    Y++N W+   ++KL+PC+ILT+I+ WLIKALY+ + R   L+S +   N       GNG      +  ++ ADRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL+N AINFI YC MS+QFR TF + F  R +       Q  + Q+
Sbjct:   40 SLNITDEDIDYVNKFMDN-LSISCNENCEQQIDCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIVVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKMALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVD-ADY-SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALKSYNQCKNISVM---GNGLIPKRPSKSERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFKPRIMKKWQPATQQTDVQS 424          
BLAST of EMLSAG00000003422 vs. Select Arthropod Genomes
Match: XP_016767539.1 (PREDICTED: neuromedin-U receptor 1-like isoform X1 [Apis mellifera])

HSP 1 Score: 294.664 bits (753), Expect = 1.806e-95
Identity = 166/394 (42.13%), Postives = 256/394 (64.97%), Query Frame = 0
Query:    6 ELNVTTKDLLHL--FASSPISPTVGDNISEE-EAMCNLT--DFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT-NQG---KVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQN 390
             LN+T +D+ ++  F  + +S +  +N  ++ +  CN T  D    Y+N HG+++L VC+FGT+AN+LNI+VLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCK+ L+ +++ P   C P+Y+   I K+T N+    ++ Y++D +D  + H    Y++N W+   ++KL+PC+ILT+I+ WLIKALY+ + R   L+S +   N       GNG      +  ++ ADRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL+N AINFI YC MS+QFR TF + F  R +       Q  + Q+
Sbjct:   40 SLNITDEDIDYVNKFMDN-LSISCNENCEQQIDCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIVVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKMALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVD-ADY-SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALKSYNQCKNISVM---GNGLIPKRPSKSERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFKPRIMKKWQPATQQTDVQS 424          
BLAST of EMLSAG00000003422 vs. Select Arthropod Genomes
Match: XP_006562236.1 (PREDICTED: neuromedin-U receptor 1-like isoform X1 [Apis mellifera])

HSP 1 Score: 294.664 bits (753), Expect = 1.806e-95
Identity = 166/394 (42.13%), Postives = 256/394 (64.97%), Query Frame = 0
Query:    6 ELNVTTKDLLHL--FASSPISPTVGDNISEE-EAMCNLT--DFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT-NQG---KVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQN 390
             LN+T +D+ ++  F  + +S +  +N  ++ +  CN T  D    Y+N HG+++L VC+FGT+AN+LNI+VLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCK+ L+ +++ P   C P+Y+   I K+T N+    ++ Y++D +D  + H    Y++N W+   ++KL+PC+ILT+I+ WLIKALY+ + R   L+S +   N       GNG      +  ++ ADRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL+N AINFI YC MS+QFR TF + F  R +       Q  + Q+
Sbjct:   40 SLNITDEDIDYVNKFMDN-LSISCNENCEQQIDCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIVVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKMALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVD-ADY-SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALKSYNQCKNISVM---GNGLIPKRPSKSERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFKPRIMKKWQPATQQTDVQS 424          
BLAST of EMLSAG00000003422 vs. Select Arthropod Genomes
Match: NP_001276370.1 (neuromedin-U receptor 1-like [Apis mellifera])

HSP 1 Score: 294.664 bits (753), Expect = 1.806e-95
Identity = 166/394 (42.13%), Postives = 256/394 (64.97%), Query Frame = 0
Query:    6 ELNVTTKDLLHL--FASSPISPTVGDNISEE-EAMCNLT--DFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT-NQG---KVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQN 390
             LN+T +D+ ++  F  + +S +  +N  ++ +  CN T  D    Y+N HG+++L VC+FGT+AN+LNI+VLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCK+ L+ +++ P   C P+Y+   I K+T N+    ++ Y++D +D  + H    Y++N W+   ++KL+PC+ILT+I+ WLIKALY+ + R   L+S +   N       GNG      +  ++ ADRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL+N AINFI YC MS+QFR TF + F  R +       Q  + Q+
Sbjct:   40 SLNITDEDIDYVNKFMDN-LSISCNENCEQQIDCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIVVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKMALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVD-ADY-SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALKSYNQCKNISVM---GNGLIPKRPSKSERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFKPRIMKKWQPATQQTDVQS 424          
BLAST of EMLSAG00000003422 vs. nr
Match: gi|242013230|ref|XP_002427317.1| (class A rhodopsin-like G-protein coupled receptor GPRmys, putative [Pediculus humanus corporis] >gi|212511662|gb|EEB14579.1| class A rhodopsin-like G-protein coupled receptor GPRmys, putative [Pediculus humanus corporis])

HSP 1 Score: 324.709 bits (831), Expect = 1.712e-104
Identity = 174/384 (45.31%), Postives = 253/384 (65.89%), Query Frame = 0
Query:    5 RELNVTTKDLLHLFASSPISPTVGDNISEEEAMC----------NLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNY----IATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLR---SRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETF 371
            + +N+T +DL   F     + T+   I     +C           L  F  GY++VHG+LSL VC+FGTIAN++N+ VLTR+EM  +PIN ILTG+AVAD+LVM+EYIPF+++  L+    +   YSW  ++F+  H +FS +IH +SI LTL+LAVWR+I IR+   S  +CT  RC++ +  ++V+P+ LCIP+Y    I TT   + +    +Y LD SD+A  +++LL  +  W Y  ++KL+PC+ILT+I+  LIKALY++ +R+  L+   S H++ N+  +         VI+   K+  DRTTR+LV IL+LFLLTE PQGILG+LS I G  FF++CY   G++MD +AL+NSAINFI YCFMS+QFR+TF + F
Sbjct:   32 QSMNLTEEDLYRFFKMHFPNDTIRGLILAPREICLYDPDKYCDGTLKAFANGYKDVHGYLSLMVCLFGTIANLINVAVLTRREMATNPINRILTGLAVADVLVMLEYIPFSVYMYLIFPGQRNFPYSW--AVFILFHVHFSQIIHTISICLTLALAVWRYIAIRYPHKSITWCTGPRCRVAIGTSFVLPLILCIPSYFVFYIKTTRITENSAEIYLYHLDLSDVAKENDQLLCNVTFWTYGVLIKLLPCVILTVISIRLIKALYEINKRNKLLKTANSTHHNENSVER--------RVIL--AKERTDRTTRMLVAILILFLLTELPQGILGLLSGILGTCFFRNCYNLFGEIMDILALVNSAINFILYCFMSRQFRQTFEKVF 403          
BLAST of EMLSAG00000003422 vs. nr
Match: gi|998500008|ref|XP_015509921.1| (PREDICTED: sex peptide receptor [Neodiprion lecontei])

HSP 1 Score: 322.398 bits (825), Expect = 7.264e-104
Identity = 166/396 (41.92%), Postives = 253/396 (63.89%), Query Frame = 0
Query:    5 RELNVTTKDLLHL----FASSPISPTVGDNISEEEAMCN--LTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKK--TNQGKV--IYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQN 390
            ++LN+T +D+ +L    F + P + T   +  E+   CN  + D    Y+  HG+++L VCIFG++AN+LNI+VLTRK+M  +PIN ILTG+A ADMLVM EY+PF +++ L+    K   Y W  ++FV  H +F+  +H +SI LTL+LAVWR+I IRF   +  +CT  RC++ L+ +++ P   C P+Y+   I ++     G+V  +Y +D  D  T     L ++N W+   ++KL+PC+ILT+I+ WLIKALYK + R   LR   Y+    + ++NG  + +   +  ++  DRTTR++V +L+LFL+TEFPQGILG+LS + GD FF++CY  LG++MD +AL+N AINFI YC MS+QFR TF + F  R +       Q  + Q+
Sbjct:   13 KKLNITEEDIDYLNNFSFPNLPTTRTTISSTEEKYCYCNGVVRDLALSYKVYHGYVALIVCIFGSVANMLNIVVLTRKDMASAPINRILTGLATADMLVMFEYVPFAVYKYLILPGHKVFPYGW--AVFVLFHMHFAQALHTISIGLTLTLAVWRYIAIRFPQHNHAWCTAARCRVALWSSFLAPFIACAPSYLVFGIREERLEENGRVEILYYVDAMDADTTGKGFLIQLNFWVLAVVVKLLPCLILTVISCWLIKALYKAKGRKQALRD--YNPCAINTMKNGGSRRA---SKSERRTDRTTRMMVAVLLLFLVTEFPQGILGLLSGVLGDCFFRNCYHNLGEIMDILALLNGAINFILYCSMSRQFRTTFGQLFKPRIMKKWHPATQQTDIQS 401          
BLAST of EMLSAG00000003422 vs. nr
Match: gi|1058158370|gb|JAS82833.1| (hypothetical protein g.12391 [Homalodisca liturata])

HSP 1 Score: 315.849 bits (808), Expect = 4.425e-101
Identity = 165/372 (44.35%), Postives = 235/372 (63.17%), Query Frame = 0
Query:    8 NVTTKDLLHLFASS----PISPTVGDNISEEEAMCNLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINK----KTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETF 371
            N T  DL  LF +S    P+ P   +    E A         GYR +HG+ SL VC+FGTIAN+LNIIVLTRKE+ G+PIN ILTGIAVADMLVM+EYIPF+ +  +L       + +   ++F+  H +FS ++H VSI LTL+LA+WR++ I+F   S   C+  RC + +  A+ +PV +CIP+Y+  ++      + NQ   +Y LD SD+A   ++ LY  + WLY  ++KL+PC +LT+++ WL+  L++V ER  RLR   + +    +               +K  DRTT++LV +L+LFL+TE PQG+LG+LS I G  FFK+CY  LG++MD +ALIN AINFI YC MS+QFR+TF + F
Sbjct:   52 NFTEADLEFLFNTSRDPEPVVPAYCEGTLREVA--------AGYRQIHGYASLLVCVFGTIANLLNIIVLTRKELAGTPINRILTGIAVADMLVMLEYIPFSTYMYVLMPPGVR-QLTHAEAVFILVHMHFSQLMHTVSICLTLTLALWRYLAIQFPHRSHTMCSDKRCTLAIMGAFTLPVLICIPSYLVFSVRATQVTENNQVVTLYHLDLSDLAKRDDEFLYIASFWLYAVVVKLLPCAVLTVVSYWLVALLWQVNERKQRLRCDVFPTPDAPR-----------TYKPEKRVDRTTKMLVAVLLLFLITEIPQGVLGLLSGILGRCFFKNCYHQLGEMMDILALINGAINFILYCSMSRQFRETFGKMF 403          
BLAST of EMLSAG00000003422 vs. nr
Match: gi|817073375|ref|XP_012258823.1| (PREDICTED: probable G-protein coupled receptor 139 [Athalia rosae] >gi|817073377|ref|XP_012258825.1| PREDICTED: probable G-protein coupled receptor 139 [Athalia rosae])

HSP 1 Score: 308.531 bits (789), Expect = 4.397e-98
Identity = 168/399 (42.11%), Postives = 254/399 (63.66%), Query Frame = 0
Query:    5 RELNVTTKDLLHLFASS-PISPTVG------DNISEEEAMCN--LTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKK----TNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQN 390
            ++LN+T +D+ ++   S P  PT+       DN  E+   CN  + DF   Y+  HG+++L VCIFGTIAN+LNI+VLTRK+M  +PIN ILTG+A ADMLVM EY+PF ++  L+    +   Y W  ++FV  H +F+  +H +SI LTL+LAVWR+I IRF   +  +CT  RC++ L+ + + P+  C P+Y+   I ++      Q +++Y +D  D  +     LY++N W+   ++KL+PC+ILT+I+ WLIKALY+ + R   LR   Y+    + ++NG  + +   +  ++  DRTTR+LV +L+LFL+TEFPQGILG+LS + GD FF++CY   G++MD +AL+N AINFI YC MS+QFR TF + F  R +       Q  + Q+
Sbjct:   42 KKLNITEEDIDYMNNFSFPNLPTIHTTSSSVDNNPEKFCYCNGVVRDFALSYKVYHGYVALIVCIFGTIANMLNIVVLTRKDMVSAPINRILTGLATADMLVMFEYVPFAVYEYLILPEKQVFPYGW--AVFVLFHMHFAQALHTISIGLTLTLAVWRYIAIRFPQHNHSWCTAARCRVALWSSLLAPLVACAPSYLVFGIREERFEENGQVEILYYVDAMDANSTGKGFLYQLNFWVLAVVVKLLPCLILTVISCWLIKALYRAKGRKQALRD--YNPCAVNSMKNGGSRRA---SKSERRTDRTTRMLVAVLLLFLVTEFPQGILGLLSGVLGDCFFRNCYHNFGEIMDILALLNGAINFILYCSMSRQFRTTFGQLFKPRIMKKWHPATQQTDIQS 433          
BLAST of EMLSAG00000003422 vs. nr
Match: gi|383863701|ref|XP_003707318.1| (PREDICTED: probable G-protein coupled receptor 139 [Megachile rotundata])

HSP 1 Score: 305.064 bits (780), Expect = 8.541e-97
Identity = 165/394 (41.88%), Postives = 250/394 (63.45%), Query Frame = 0
Query:    5 RELNVTTKDLLHLFASSPISPTVGDNISEEEAMCNLT--DFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT-NQGKVIYVL-----DWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQN 390
            R LN+T  D+ +++  +  + T   N  +    CN+T  D    Y+N HG+++L VC+FGT+AN++NIIVLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  +++V  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RC+I L+ +++ P  +C P+Y    I K+T N+   + +      D+SD    H    Y++N W+   ++K++PC+ILT+I+ WLIKALYK + R   L+S    +  KS +  GNG      +   K ADRTT++LV +L+LFL+TE PQG+LG+ S + GD FF++CY   G+VMD +AL+N AINFI YC MS+QFR TF + F  R +       Q  + Q+
Sbjct:   43 RSLNITDDDVDYVYKYTLDNLTAPRNNEQASCYCNITFRDLATEYKNYHGYVALIVCLFGTLANMMNIIVLTRKDMVATPINRILTGLASADMLVMLEYIPFAIYNYIVLPKRQTFPYGW--AVYVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYNS-WCTAARCRIALWSSFLAPFVVCAPSYPVFGIKKQTVNENGTLEIAYTVDADYSD----HKGFFYQLNFWVLAVVVKILPCVILTVISCWLIKALYKAKGRKQALKSY---NQCKSTVPMGNGLVPRRPSKSDKRADRTTKMLVAVLLLFLVTEIPQGVLGLFSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFKPRIMKKWQPATQQTDVQS 426          
BLAST of EMLSAG00000003422 vs. nr
Match: gi|549137403|dbj|BAO01052.1| (neuropeptide GPCR A3 [Nilaparvata lugens])

HSP 1 Score: 302.368 bits (773), Expect = 4.123e-96
Identity = 151/334 (45.21%), Postives = 219/334 (65.57%), Query Frame = 0
Query:   42 DFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGK----VIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETF 371
            D  K YR+VHG++SL VC FGTIAN+LN+IVLTRKE+   PIN ILTGIA+ADMLVM+EY+PF  +  L      E  Y+   ++F+  H++FS V+H +SI LTL+LA+WR++ IR+   S I C+  RC+  L  A+++P+ +C P+Y+  +I       K    V+Y +D S +A   + LLY +N+W+Y  ++K+ PC++LT+I+ WLI  LY+V  +   L+S  ++        +G       ++   K  DR  R+LV + +LFL+T+FPQGILG+LS I G  FFK+CY   G++MD +AL+N AINFI YC MS+QFR TF + F
Sbjct:   54 DLAKSYRSVHGYVSLIVCAFGTIANLLNVIVLTRKELCSVPINRILTGIAIADMLVMLEYVPFACYMYLRPSILSEFTYTG--AVFILFHTHFSQVLHTISICLTLTLAIWRYVAIRYPQQSHILCSEQRCQQALSAAFLLPLLICAPSYLNFSIRSTKVLEKSGVVVLYHIDLSQVAKEDDGLLYIVNLWVYAVLIKIFPCLLLTVISYWLINVLYRVNRKKQELKSNTFNMTGAGAEASGGKPK---LDRAGKRIDRGARMLVGVFLLFLITDFPQGILGLLSGILGRCFFKNCYHLFGEIMDILALLNGAINFILYCSMSRQFRTTFNQLF 382          
BLAST of EMLSAG00000003422 vs. nr
Match: gi|913313756|ref|XP_013187671.1| (PREDICTED: sex peptide receptor-like [Amyelois transitella])

HSP 1 Score: 302.368 bits (773), Expect = 8.978e-96
Identity = 149/344 (43.31%), Postives = 227/344 (65.99%), Query Frame = 0
Query:   34 EEAMCNLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINK------KTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNG----QTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTF 367
            E     + D    Y  +HG++SL VC+FG++ANILN+ VLTR+++  +PIN +L  +AVAD+ VMIEY+PF ++R LL    ++  YSW  ++++  H +F+ ++H  SI+LTLSLA+WR+I I++ S SP  CT  RC + +  ++++P  LCIP+Y   TI+K      + N    +Y +D     + ++  LY++N W++  ++KL+PC+ILT+I+ WLI+ALY+   R   L+   Y +     + NGNG    + S   +  ++  DRTT++LV +L+LFL+TEFPQGILG+LS I G  FFK CY   G++MDA+AL+N AINF+ YC MS+QFR TF
Sbjct:   72 EYCAGEIRDLILAYNGIHGYVSLLVCLFGSLANILNVAVLTRRDLAAAPINRLLKWLAVADVFVMIEYVPFAIYRYLLLPGQEDWPYSW--AVYMLFHMHFTQILHTASIFLTLSLAIWRYIAIKYPSYSPALCTDRRCSLAILFSFMLPPILCIPSYFVFTIHKDFTVDRRGNIPTKVYYVD-----SDYDGTLYQVNFWVHAVLIKLLPCLILTLISAWLIRALYRANSRKKALKG--YSACPADTVVNGNGNIFTRKSTKRSKAERRTDRTTKMLVAVLLLFLMTEFPQGILGLLSGILGRCFFKRCYDLFGELMDALALLNGAINFVLYCSMSRQFRTTF 406          
BLAST of EMLSAG00000003422 vs. nr
Match: gi|1061106396|ref|XP_017879493.1| (PREDICTED: sex peptide receptor [Ceratina calcarata])

HSP 1 Score: 300.827 bits (769), Expect = 3.408e-95
Identity = 174/395 (44.05%), Postives = 255/395 (64.56%), Query Frame = 0
Query:    5 RELNVTTKDLLHLFASSPISPTVGDNISEEEAMC----NLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT-NQG---KVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSR----KKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKN 387
            R LN+T +DL   +A + I        ++E+  C     + DF   Y+N HG+++L VC+FGTIAN+LNIIVLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RC+  L+ ++V  +  C P+Y    I K+T N+    ++ Y +D +D  + H   LY++N W+ + ++KL+PCIILT+I+ WLIKALY+ + R   L+S  Y+  T   + NG      +V  R    +K ADRTT++LV +L+LFL+TE PQG+LG+LS I GD FF++CY   G+VMD +AL+N AINFI YC MS+QFR TF + F  R +N     VQ  +
Sbjct:   38 RSLNITDEDLD--YAHNFIDNLTVQMSNDEQVCCYCNGTIKDFASEYKNYHGYVALIVCLFGTIANMLNIIVLTRKDMAVAPINTILTGLATADMLVMLEYIPFAIYVYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYNT-WCTASRCRTALWCSFVASIIACAPSYAVFGIIKRTVNENGTLEIAYTVD-ADY-SQHKDFLYQLNFWVLSVVVKLLPCIILTVISCWLIKALYRAKGRKQALKS--YNQYTSGGVVNG------LVARRPSKSEKRADRTTKMLVAVLLLFLVTEIPQGVLGLLSGILGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFKPRLMNKWQPAVQQTD 417          
BLAST of EMLSAG00000003422 vs. nr
Match: gi|1000716210|ref|XP_015587435.1| (PREDICTED: sex peptide receptor isoform X1 [Cephus cinctus] >gi|1000716212|ref|XP_015587443.1| PREDICTED: sex peptide receptor isoform X1 [Cephus cinctus] >gi|1000716214|ref|XP_015587452.1| PREDICTED: sex peptide receptor isoform X1 [Cephus cinctus] >gi|1000716216|ref|XP_015587462.1| PREDICTED: sex peptide receptor isoform X1 [Cephus cinctus] >gi|1000716218|ref|XP_015587471.1| PREDICTED: sex peptide receptor isoform X1 [Cephus cinctus] >gi|1000716220|ref|XP_015587477.1| PREDICTED: sex peptide receptor isoform X1 [Cephus cinctus])

HSP 1 Score: 298.516 bits (763), Expect = 2.354e-94
Identity = 166/393 (42.24%), Postives = 253/393 (64.38%), Query Frame = 0
Query:    5 RELNVTTKDLLHLFASS-PISPTVGDNISEEEAMCN--LTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKK----TNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQN 390
            R+LN+T +D+ ++   S  + PTV          CN  + D    Y+  HG+++L VCIFGT+AN+LNI+VLTRK+M  +PIN ILTG+A+ADMLVM+EY+PF  +R + +   K   + W  ++F+  H +F+ V+H +SI LTL+LAVWR+I IRF   +  +C+  RC+I L+ +++ P   C P+Y+   IN++        +++Y +D +   +    +LY++N W+   ++KL+PC+ILT+I+ WLIKALY+ + R   LR   Y+  T +     NG+ S   +  ++ ADRTTR+LV +L+LFL+TEFPQGILG+LS + GD FF++CY   G++MD +AL+N AINFI YC MS+QFR TF + F  R +       Q  + Q+
Sbjct:   42 RKLNITEEDIDYVNNFSFAVLPTVHS--VPVPCYCNGVVRDLALSYKVYHGYVALMVCIFGTVANMLNIVVLTRKDMATAPINRILTGLAMADMLVMVEYVPFAAYRYIASQDHKIFPFRW--AVFILFHMHFTQVLHTISIGLTLTLAVWRYIAIRFPQHNHSWCSASRCRIALWCSFLAPFIACAPSYLVFGINQRKVYENGTEEILYHVDAN--PSDSKGVLYQLNFWVLGVVVKLLPCLILTVISCWLIKALYRAKSRKQALRG--YNPCTMAN----NGECSRRASKSERRADRTTRMLVAVLLLFLVTEFPQGILGLLSGVLGDCFFRNCYHNFGEIMDILALLNGAINFILYCSMSRQFRTTFGQLFKPRIIKKWHPPTQQTDVQS 422          
BLAST of EMLSAG00000003422 vs. nr
Match: gi|572272227|ref|XP_006614027.1| (PREDICTED: probable G-protein coupled receptor 139-like [Apis dorsata])

HSP 1 Score: 297.745 bits (761), Expect = 5.935e-94
Identity = 169/394 (42.89%), Postives = 256/394 (64.97%), Query Frame = 0
Query:    6 ELNVTTKDLLHL--FASSPISPTVGDNISEE-EAMCNLT--DFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT-NQG---KVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQN 390
             LN+T +D+ ++  F  + +S +  DN  ++ +  CN T  D    Y+N HG+++L VC+FGT+AN+LNIIVLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCKI L+ +++ P   C P+Y+   I K+T N+    ++ Y++D +D  + H    Y++N W+   ++KL+PC+ILT+I+ WLIKALY+ + R   L+S +   N       GNG      +  ++ ADRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL+N AINFI YC MS+QFR TF + F  R +       Q  + Q+
Sbjct:   40 SLNITDEDIDYVNKFMDN-LSISCNDNCEQQTDCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIIVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKIALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVD-ADY-SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALKSYNQCKNIAVM---GNGLIPKRPSKSERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFKPRIMKKWQPATQQTDVQS 424          
BLAST of EMLSAG00000003422 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold101_size371023-snap-gene-1.11 (protein:Tk03063 transcript:maker-scaffold101_size371023-snap-gene-1.11-mRNA-1 annotation:"class a rhodopsin-like g-protein coupled receptor")

HSP 1 Score: 216.083 bits (549), Expect = 3.238e-68
Identity = 121/235 (51.49%), Postives = 159/235 (67.66%), Query Frame = 0
Query:  192 IATTINKKTNQGK--VIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLR--------------------SRHYDSNTKSKLRNG---NGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCR---SLNMSSNQVQMKNGQNNGLAARKR 398
            +A TI    ++G     Y+++WSD+A A++KLLYR NIWLY+FILKL+PCI+LT+ITG+LI+ LYK EERSARL+                    +  +D +   +L NG     ++    +SRK+S DRTTRLL+ IL+LFL TEFPQGILG+LSA++G ++F DCY+PLGDV DAMALINSAINFI YC MSKQFR+TFVETF       L+  +  VQ    ++   AAR+R
Sbjct:    1 LAMTIKSSVHKGSNATTYLINWSDLANANDKLLYRTNIWLYSFILKLVPCIVLTVITGFLIRVLYKAEERSARLKNGGGGNNPNYRRPSEMPPSTATKHDPHGSVRLPNGYKGAQKSGPATSSRKRSIDRTTRLLIAILILFLATEFPQGILGLLSAVHGVQYFHDCYIPLGDVWDAMALINSAINFILYCIMSKQFRRTFVETFHLEWSSKLDFPTLTVQTHLPRSKASAARRR 235          
BLAST of EMLSAG00000003422 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold206_size259025-processed-gene-1.14 (protein:Tk10932 transcript:snap_masked-scaffold206_size259025-processed-gene-1.14-mRNA-1 annotation:"fmrfamide receptor")

HSP 1 Score: 85.5001 bits (210), Expect = 3.213e-18
Identity = 88/366 (24.04%), Postives = 159/366 (43.44%), Query Frame = 0
Query:   50 VHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYI---PFTLHRNLLTGRSKEIEYSWGFSLFVWS-HSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATT-----INKKTNQGKVIYVLDWSDIATAHNKLLYRINI-WLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKNGQNNGLAARKRRSSPIPS 405
            VHG LS C+ + G   NI++II+L+R +M  S IN IL G+   D +V++  +    FT+ R   TG +    Y W    +V        ++    SI++TLS+ + R++++ +   +   CT GR K+ +F   +  V   IP +   T     +        VI V D+   A     L  ++ I W+Y   + +IP + L ++   +                         ++R  N   S++ N  KK  +    LLVV+ + F+    P  IL ++      + F      +  V + +  INS++N + YC    +F+  F++ F  R  ++   +      +N   +A  R ++ I +
Sbjct:   74 VHGVLSCCIGMGGLFGNIISIIILSRPQMKSS-INTILIGLVTCDSIVIVTSVFMFSFTVFR--YTGSAVFQFYYWQIYPYVLCVVYPIGMIAQTGSIYMTLSVTIERYLVVCWPLKARSICTNGRAKLSVFFFALFAVIYNIPRFFEVTWETQYLEDFGENRTVIAVTDFRKSA-----LYIKLYISWMYLVFMYIIPFVSLAVLNLLIFL-----------------------EIRKANVTRSILSNQEKKEHNLAVMLLVVVFIFFICNILPL-ILNII------ELFHKPNPQVIQVSNLLVTINSSVNILIYCIFGNKFKTIFLQIFCGRKPHIQQMRTCRDFRRNQYESASMRSTTMIEA 401          
BLAST of EMLSAG00000003422 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold138_size318692-processed-gene-2.1 (protein:Tk02753 transcript:snap_masked-scaffold138_size318692-processed-gene-2.1-mRNA-1 annotation:"hypothetical protein CAPTEDRAFT_228436")

HSP 1 Score: 75.0998 bits (183), Expect = 5.192e-15
Identity = 82/342 (23.98%), Postives = 151/342 (44.15%), Query Frame = 0
Query:   50 VHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADM-LVMIEYIPFTL-------HRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRIN--------IWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRS 375
            VHG L L + +FG I NI+ ++VL +++M  + IN +L G+A+AD+ L+   ++ F+L        R L T  +   ++S  F   V       ++    S+ LT+++ + R++++     S   CT GR K  + L   I +   I  +       K+   +V+  +D +   T       R N         W+Y   + +IP +IL     +++     +E RSAR +                      + + ++       +L+VI+  F+L   P     M+S I  D  ++   + L  V + + +INS++N I Y    K+FR   +  F C++
Sbjct:   54 VHGLLILSIGLFGIIGNIVCLVVLCQRKMRNT-INCLLIGLAIADISLITTAWLMFSLPAFQIYFERRLFTKVTDIYQHSTPFVYPV------GMIAQTASVCLTVTITMERYLVVCMPFASRRICTYGRAKRCVMLIMTIAIVFNISRF----FEYKSETFQVLLPMDGNVTLTFLKSTPLRDNPLYISLYMTWMYMIFMYIIPFVIL-----FVLNVKIALEIRSARRKRSQ-------------------MTTAQEVEQSLALMLLVIVCTFMLCNAP----AMVSNIIEDLDYQA--IKLTQVSNLLIVINSSLNIIVYPIFCKKFRIILINMFHCQT 354          
BLAST of EMLSAG00000003422 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold261_size233860-processed-gene-1.1 (protein:Tk10682 transcript:snap_masked-scaffold261_size233860-processed-gene-1.1-mRNA-1 annotation:"AGAP001862-PA")

HSP 1 Score: 71.2478 bits (173), Expect = 1.183e-13
Identity = 81/334 (24.25%), Postives = 147/334 (44.01%), Query Frame = 0
Query:   50 VHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIP-FTLHRNLL-----TGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT----NQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGC 373
            VHG+L L V I G   NIL ++VL R  M  S IN +L G+A+ DM+++   +  F+L    L      G S E    + F+  ++     +++    S++LT+++A  R+I++    LS   CT GR +  + +     +   IP +    +  +T        ++Y L  +D+      +   +N W+Y   + L+P  IL     + +     +E R ARL   H                   + S +K+ +    +L++++V+F+L   P     M S I     ++   + L  + + + + NS+I    Y   S++FRK       C
Sbjct:   41 VHGFLILIVSIVGITGNILCLMVLGRPTMRNS-INCLLMGVAIIDMVLITSAVALFSLPTLQLFLEENYGISTEALNLYQFTPILYP---MAMIAQTASVYLTVAIAFERYIVVCRPFLSRSLCTFGRSQRFVGVVIFFAILYNIPRFFEYELRSQTVDLAGTTTLVY-LQSTDLRDDPLYIALYMN-WMYMIFMYLLPFSIL-----FYLNLRIGLELRRARLARIH-------------------MTSAQKNEEGCAIMLIIVVVIFILANSP----AMASNIVESLGYEA--IELTQISNLLVVFNSSIYIFVYNIFSQKFRKICYRVLTC 338          
BLAST of EMLSAG00000003422 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold138_size318692-processed-gene-2.2 (protein:Tk02754 transcript:snap_masked-scaffold138_size318692-processed-gene-2.2-mRNA-1 annotation:"fmrfamide receptor")

HSP 1 Score: 65.0846 bits (157), Expect = 1.288e-11
Identity = 79/338 (23.37%), Postives = 148/338 (43.79%), Query Frame = 0
Query:   50 VHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADM-LVMIEYIPFTL-------HRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIP---NYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINI-WLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRS 375
            VHG L L +   G I N+L +IVL + +M  + IN +L G+A+ D+ L++  ++ F+L        R LLT  S   +Y+  F   V       ++    S++LT+++ + R++++     S   CT GR K  + L     +   I     Y   T       G+ + +          N +   + + W+Y   + +IP  IL     +++ A   +E RSAR +                 Q ++     +++ +    +L+VI+  F+L   P  +  ++ A+          + L  V + + +INS++N I Y    K+FR   V+ F  ++
Sbjct:   73 VHGLLILFIGFLGIIGNVLCLIVLCQPQMRNT-INCLLIGLAIIDISLIVSAWLMFSLPAFQIYFERRLLTKVSDVYQYTTPFVYPV------GMIAQTASVYLTVTITMERYLVVCMPLKSRSICTYGRAKRCVVLIMTSAIVYNISRFFEYKFETFQVLLPIGRNVTLTFLQSTHLRDNPMYISLYMTWMYMIFMYVIPFAIL-----FVLNAKIALEIRSARQK---------------RSQMTI----AQQAEEGLAIMLLVIVCTFMLCNAPAMVSNIMEALAYQA------VKLTQVSNLLIVINSSLNIIVYVIFCKKFRTILVKMFQGKT 373          
BLAST of EMLSAG00000003422 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold1352_size45999-processed-gene-0.2 (protein:Tk11994 transcript:snap_masked-scaffold1352_size45999-processed-gene-0.2-mRNA-1 annotation:"fmrfamide receptor")

HSP 1 Score: 64.3142 bits (155), Expect = 1.773e-11
Identity = 83/349 (23.78%), Postives = 150/349 (42.98%), Query Frame = 0
Query:   50 VHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADM-LVMIEYIPFTL-------HRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCK--IMLFLA----YVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINI-WLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQV 383
            VHG L L +   G I N+L + VL +++M  + IN +L G+A+AD+ L+   ++ F+L        R L T  +   +Y+  F   V       ++    S+ LT+++ + R++++     +   CT GR K  +ML +     Y I  F     Y   T       G  + +          + L   + + W+Y   + +IP +IL     +++     +E RSAR +                      + + ++       +L+VI+  F+L   P     M+S I  D  ++   + L  + +   +INS++N I Y    K+FR    + F C +   S+NQV
Sbjct:   39 VHGLLILSIGFLGIIGNVLCLTVLCQRQMRNT-INCLLIGLAIADISLITTAWLMFSLPAFQIYFERRLFTKVTDIYQYTTPFVYPV------GMIAQTASVLLTVTITMERYLVVCMPLEARSICTYGRAKRCVMLIMTSAVLYNISRFF---EYKFETFEVILPIGDNVTLTFLLSTDLRDDPLYISLYMTWMYMIFMYIIPFVIL-----FVLNVKIALEIRSARRKRSQ-------------------MTTAQEVEQSLALMLLVIVCTFMLCNAP----AMVSNIIEDLAYQA--IKLTQLSNLFVVINSSLNIIVYPIFCKKFRTILTKMFHCHA---STNQV 344          
BLAST of EMLSAG00000003422 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold273_size229271-processed-gene-1.12 (protein:Tk00754 transcript:snap_masked-scaffold273_size229271-processed-gene-1.12-mRNA-1 annotation:"fmrfamide receptor")

HSP 1 Score: 59.3066 bits (142), Expect = 9.072e-10
Identity = 93/401 (23.19%), Postives = 172/401 (42.89%), Query Frame = 0
Query:    8 NVTTKDLLHLFASSPISPTVGDNISEEEAMCNLTDFYKGYRNVHGWLSLCVCIFGTI---ANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLA------VWRFIMIRFHSLSPIYCTLGRCKIM----LFLAYVIPVFLC-----IPNY------IATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITG---WLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKF----FKDC------YLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETF 371
            NV+   L   +A++       D ++EEE      +FY   R    W  L   + GTI   AN L + +L  K+MN S  N +L  +AV D + ++  +   + ++  +G ++  EY++G+ L+      F   +   SI++TL+LA      VWR   + +H+         RCK          Y+IPVF+      IP +      +   I+  TN      +   +D+    + +++ +N      +  +IP ++L+I+     W+IK   ++  R A +            +R+ + Q       +K +  +   +L +I++LF +   P+ +L +   +  +       +DC       L    V   +  +NS++NF  YCFM   FR+     F
Sbjct:   45 NVSEATLNLTWAANTSGAASCDPLTEEE-----IEFYT--RVSWWWEGLLQTLVGTIGFLANGLAVPILCSKDMN-SIFNRLLVFLAVFDNIYIVCSVLEGIRKH--SGFNQMHEYAFGYVLY-----QFHNFVLCCSIYITLTLALERYRAVWR--PVEYHN---------RCKGANPWKRIAGYIIPVFIFSAIFNIPKFFEVEFVVRQEIDPVTNNTINQTLASPTDLRLNDSYVIFYVNA-ARLLVQGIIPFVLLSILNYRIYWVIKRRREMINRPASI---------SQNVRSASAQ-------KKANETQQAVVLFIIVLLFFICHTPRFVLNVHEFLTLESLRISIEQDCNGVSLWALIWASVSHFLMTLNSSVNFFIYCFMCATFRRILFSYF 402          
BLAST of EMLSAG00000003422 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold152_size304267-processed-gene-0.11 (protein:Tk10103 transcript:snap_masked-scaffold152_size304267-processed-gene-0.11-mRNA-1 annotation:"somatostatin receptor type 2")

HSP 1 Score: 56.225 bits (134), Expect = 7.579e-9
Identity = 79/341 (23.17%), Postives = 150/341 (43.99%), Query Frame = 0
Query:   58 VCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYI-ATTINKK--TNQGKVIYVLDWSDIATAHNKLLY-RINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSRHYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALI-------NSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQMKN 387
            VCI G   N L I V+ R     +  NL +  +A+AD   ++  IPF      L   S + ++ +G ++     +  S+     SI+LT+ ++  R+I +     SP Y T    +++   A+     L +P ++ A TI K        + +  D  D A     +L  +     Y+F+L     I L +I  + I  ++K++    + +SR                       +KKS  + TRL++ ++ +++L   P  I   L+ I+ +           +VM A+ L+       NSA+N + Y F+S+ F+K+F++   C +   ++  + ++N
Sbjct:   85 VCIVGLCGNTLVIYVVLRYSKMQTVTNLYILNLALADECFLVG-IPF------LIVTSAKGDWIFGMTMCKIYLTTTSINQFTSSIFLTV-MSADRYIAVCHPISSPRYRTSVIARVVSLTAWATSALLMVPVFMYAATITKPLGGQNCNIFWPFDEEDTANGTLGVLNGQTAFTFYSFVLGF--AIPLLLILVFYILVIFKLKTVGPKNKSRE----------------------KKKSHRKVTRLVLTVITVYILCWLPYWIT-QLALIFTEPGHTQ-----DNVMVAVMLLAGCLSYSNSAMNPVLYAFLSENFKKSFMKACTCATGRDANAALHVEN 387          
BLAST of EMLSAG00000003422 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold117_size339417-snap-gene-2.23 (protein:Tk06395 transcript:maker-scaffold117_size339417-snap-gene-2.23-mRNA-1 annotation:"uroporphyrinogen decarboxylase")

HSP 1 Score: 51.6026 bits (122), Expect = 3.210e-7
Identity = 61/274 (22.26%), Postives = 119/274 (43.43%), Query Frame = 0
Query:   50 VHGWLSLCVCIFGTIANILNIIVLTRKEMN-GSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRF-HSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKT------NQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEE---RSARLRSRHYDSNTKS---------KLRNGNGQTSVIV--NSRKKSADRTTRLL 301
            V G+ +  V I G + N L+++VL++KEM   +  N +L  +  +D+L +   I  +   +  +   + +       +F W H  F  +    SI++ + +A+ R+  + F H    +     R    +  A     F+ IP ++ T   ++T      N  +V+ V + +D+      ++  +N W++     ++P + L I+   +   L KV+    R  RL  R  +   ++         KL NG+ +   +V  NSR+ S  R    L
Sbjct:   61 VGGYCNCIVGIIGLMGNFLSLVVLSQKEMQRNNCFNKLLIALVTSDILHICFGIMESFRNSFPSLYPQTL-----LRVFPWFHYPFYRITLCASIYMVIGVAIERYFAVCFPHDYQSMSTQKHRGLYYILPALFTAFFVNIPRFLETQSIERTYFYEDCNDIQVVEV-EPTDLRLDRTYIIVYVN-WVWCISTGILPFVALLILNYKIFVGLKKVQRNLNRHQRLAKRDEELEQQAARDDRVRGKKLANGDCEAMPLVEKNSREASHSRQPEDL 327          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000003422 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-7.998e-7340.40symbol:CG13229 species:7227 "Drosophila melanogast... [more]
-5.265e-5429.75symbol:dmsr-7 "Protein DMSR-7" species:6239 "Caeno... [more]
-1.763e-4832.53symbol:dmsr-1 "Protein DMSR-1, isoform a" species:... [more]
-2.053e-4832.53symbol:dmsr-1 "Protein DMSR-1, isoform b" species:... [more]
-2.015e-4431.32symbol:dmsr-8 "Protein DMSR-8" species:6239 "Caeno... [more]
-1.856e-4044.97symbol:MsR1 "Myosuppressin receptor 1" species:722... [more]
-4.603e-4031.35symbol:dmsr-2 "Protein DMSR-2" species:6239 "Caeno... [more]
-2.052e-3927.25symbol:dmsr-6 "Protein DMSR-6" species:6239 "Caeno... [more]
-1.903e-3730.77symbol:dmsr-5 "Protein DMSR-5" species:6239 "Caeno... [more]
-2.320e-3747.56symbol:MsR2 "Myosuppressin receptor 2" species:722... [more]

Pages

back to top
BLAST of EMLSAG00000003422 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592886276|gb|GAXK01072099.1|6.331e-10752.42TSA: Calanus finmarchicus comp2379194_c0_seq1 tran... [more]
gi|592763353|gb|GAXK01191214.1|5.204e-9547.32TSA: Calanus finmarchicus comp691290_c0_seq1 trans... [more]
gi|592763352|gb|GAXK01191215.1|3.359e-9149.07TSA: Calanus finmarchicus comp691290_c0_seq2 trans... [more]
gi|592869846|gb|GAXK01087716.1|4.185e-8547.73TSA: Calanus finmarchicus comp1849926_c0_seq2 tran... [more]
gi|592869847|gb|GAXK01087715.1|2.001e-8447.21TSA: Calanus finmarchicus comp1849926_c0_seq1 tran... [more]
gi|592763350|gb|GAXK01191217.1|4.353e-6048.71TSA: Calanus finmarchicus comp691290_c0_seq4 trans... [more]
gi|592763351|gb|GAXK01191216.1|4.386e-5847.30TSA: Calanus finmarchicus comp691290_c0_seq3 trans... [more]
gi|592840835|gb|GAXK01116709.1|2.093e-5249.18TSA: Calanus finmarchicus comp1076838_c0_seq1 tran... [more]
gi|592840833|gb|GAXK01116711.1|5.153e-5045.36TSA: Calanus finmarchicus comp1076838_c0_seq3 tran... [more]
gi|592840834|gb|GAXK01116710.1|5.535e-4946.77TSA: Calanus finmarchicus comp1076838_c0_seq2 tran... [more]

Pages

back to top
BLAST of EMLSAG00000003422 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 12
Match NameE-valueIdentityDescription
EMLSAP000000034220.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s188:1709:... [more]
EMLSAP000000056670.000e+079.63pep:novel supercontig:LSalAtl2s:LSalAtl2s307:21679... [more]
EMLSAP000000060120.000e+075.53pep:novel supercontig:LSalAtl2s:LSalAtl2s326:50134... [more]
EMLSAP000000034573.493e-2828.16pep:novel supercontig:LSalAtl2s:LSalAtl2s189:19922... [more]
EMLSAP000000026225.098e-1022.03pep:novel supercontig:LSalAtl2s:LSalAtl2s1528:6379... [more]
EMLSAP000000068075.146e-1022.28pep:novel supercontig:LSalAtl2s:LSalAtl2s382:14687... [more]
EMLSAP000000083676.607e-1021.55pep:novel supercontig:LSalAtl2s:LSalAtl2s510:29108... [more]
EMLSAP000000017702.503e-929.20pep:novel supercontig:LSalAtl2s:LSalAtl2s12:909316... [more]
EMLSAP000000120812.635e-823.23pep:novel supercontig:LSalAtl2s:LSalAtl2s863:19895... [more]
EMLSAP000000010673.994e-823.76pep:novel supercontig:LSalAtl2s:LSalAtl2s1178:5502... [more]

Pages

back to top
BLAST of EMLSAG00000003422 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
gi|75017612|sp|Q8SWR3.1|SPR_DROME7.126e-1826.33RecName: Full=Sex peptide receptor[more]
gi|56749105|sp|Q9VZW5.1|FMAR_DROME7.328e-1323.77RecName: Full=FMRFamide receptor; Short=DFR; Short... [more]
gi|2495022|sp|Q28596.1|TRFR_SHEEP4.610e-1222.99RecName: Full=Thyrotropin-releasing hormone recept... [more]
gi|9910884|sp|O46639.1|TRFR_BOVIN5.574e-1222.99RecName: Full=Thyrotropin-releasing hormone recept... [more]
gi|464921|sp|P34981.1|TRFR_HUMAN6.678e-1223.01RecName: Full=Thyrotropin-releasing hormone recept... [more]
gi|136205|sp|P21761.1|TRFR_MOUSE3.415e-1122.69RecName: Full=Thyrotropin-releasing hormone recept... [more]
gi|267163|sp|Q01717.1|TRFR_RAT1.976e-921.98RecName: Full=Thyrotropin-releasing hormone recept... [more]
gi|1027923717|sp|Q18321.2|DAF37_CAEEL2.913e-925.15RecName: Full=G-protein coupled receptor daf-37; A... [more]
gi|150387823|sp|Q10904.2|YWO1_CAEEL7.651e-920.50RecName: Full=Probable G-protein coupled receptor ... [more]
gi|6226254|sp|O93603.1|TRFR_CHICK2.396e-821.08RecName: Full=Thyrotropin-releasing hormone recept... [more]

Pages

back to top
BLAST of EMLSAG00000003422 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EEB14579.13.500e-10745.31class A rhodopsin-like G-protein coupled receptor ... [more]
XP_396970.51.806e-9542.13PREDICTED: neuromedin-U receptor 1-like isoform X1... [more]
XP_016767544.11.806e-9542.13PREDICTED: neuromedin-U receptor 1-like isoform X1... [more]
XP_016767543.11.806e-9542.13PREDICTED: neuromedin-U receptor 1-like isoform X1... [more]
XP_016767542.11.806e-9542.13PREDICTED: neuromedin-U receptor 1-like isoform X1... [more]
XP_016767541.11.806e-9542.13PREDICTED: neuromedin-U receptor 1-like isoform X1... [more]
XP_016767540.11.806e-9542.13PREDICTED: neuromedin-U receptor 1-like isoform X1... [more]
XP_016767539.11.806e-9542.13PREDICTED: neuromedin-U receptor 1-like isoform X1... [more]
XP_006562236.11.806e-9542.13PREDICTED: neuromedin-U receptor 1-like isoform X1... [more]
NP_001276370.11.806e-9542.13neuromedin-U receptor 1-like [Apis mellifera][more]

Pages

back to top
BLAST of EMLSAG00000003422 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|242013230|ref|XP_002427317.1|1.712e-10445.31class A rhodopsin-like G-protein coupled receptor ... [more]
gi|998500008|ref|XP_015509921.1|7.264e-10441.92PREDICTED: sex peptide receptor [Neodiprion lecont... [more]
gi|1058158370|gb|JAS82833.1|4.425e-10144.35hypothetical protein g.12391 [Homalodisca liturata... [more]
gi|817073375|ref|XP_012258823.1|4.397e-9842.11PREDICTED: probable G-protein coupled receptor 139... [more]
gi|383863701|ref|XP_003707318.1|8.541e-9741.88PREDICTED: probable G-protein coupled receptor 139... [more]
gi|549137403|dbj|BAO01052.1|4.123e-9645.21neuropeptide GPCR A3 [Nilaparvata lugens][more]
gi|913313756|ref|XP_013187671.1|8.978e-9643.31PREDICTED: sex peptide receptor-like [Amyelois tra... [more]
gi|1061106396|ref|XP_017879493.1|3.408e-9544.05PREDICTED: sex peptide receptor [Ceratina calcarat... [more]
gi|1000716210|ref|XP_015587435.1|2.354e-9442.24PREDICTED: sex peptide receptor isoform X1 [Cephus... [more]
gi|572272227|ref|XP_006614027.1|5.935e-9442.89PREDICTED: probable G-protein coupled receptor 139... [more]

Pages

back to top
BLAST of EMLSAG00000003422 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 9
Match NameE-valueIdentityDescription
maker-scaffold101_size371023-snap-gene-1.113.238e-6851.49protein:Tk03063 transcript:maker-scaffold101_size3... [more]
snap_masked-scaffold206_size259025-processed-gene-1.143.213e-1824.04protein:Tk10932 transcript:snap_masked-scaffold206... [more]
snap_masked-scaffold138_size318692-processed-gene-2.15.192e-1523.98protein:Tk02753 transcript:snap_masked-scaffold138... [more]
snap_masked-scaffold261_size233860-processed-gene-1.11.183e-1324.25protein:Tk10682 transcript:snap_masked-scaffold261... [more]
snap_masked-scaffold138_size318692-processed-gene-2.21.288e-1123.37protein:Tk02754 transcript:snap_masked-scaffold138... [more]
snap_masked-scaffold1352_size45999-processed-gene-0.21.773e-1123.78protein:Tk11994 transcript:snap_masked-scaffold135... [more]
snap_masked-scaffold273_size229271-processed-gene-1.129.072e-1023.19protein:Tk00754 transcript:snap_masked-scaffold273... [more]
snap_masked-scaffold152_size304267-processed-gene-0.117.579e-923.17protein:Tk10103 transcript:snap_masked-scaffold152... [more]
maker-scaffold117_size339417-snap-gene-2.233.210e-722.26protein:Tk06395 transcript:maker-scaffold117_size3... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s188supercontigLSalAtl2s188:1709..12916 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s188-snap-gene-0.5
Biotypeprotein_coding
EvidenceIEA
NoteSex peptide receptor
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000003422 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000003422EMLSAT00000003422-699269Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s188:1709..12916+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000003422-686188 ID=EMLSAG00000003422-686188|Name=EMLSAG00000003422|organism=Lepeophtheirus salmonis|type=gene|length=11208bp|location=Sequence derived from alignment at LSalAtl2s188:1709..12916+ (Lepeophtheirus salmonis)
TGTGATGGTTGTTCCACGTGTATGTGAAATTGCTGTAATACTATAATAAA TCGAAATACTCTTCTTTTCAAGTGCAATTGACATCACTGTGAAACATATA TTCAATCTATCTATAAAAAATCCCCAATTATGTATATTTTCTTTATAAAT TGATCTGAAGAAGTAAAAAAGGAACAATAAAAGTTCATTGGTTTATTACA GTAAAAACTAAATCATCATTTAGGGCTTTACAACATATTTCAATCAATTT ATAAATTAATAAATTTGAACGCTATCTAAAAATTTATATTTCCTAACTCA TTAATGCAAAAGCAAGAAAAAAAAAAGTTTTTGATTGAAAAAACTACTTT ACATCAGAGTAATGATATTTTTCAGATATATATTTTACAACAATATAACG TTCTAAATAAGCTCTAATTTCTAGGAATTGAATGTGACTACCAAAGACTT GCTACATTTATTTGCAAGTTCTCCAATCTCTCCAACTGTGGGTGACAACA TATCAGAGGAGGAAGCAATGTGTAATCTGACAGATTTTTACAAGGGATAT CGCAATGTTCATGGTTGGCTAAGTCTTTGTGTTTGTATATTTGGTACCAT TGCAAACATTTTAAATATTATTGTATTGACAAGGAAGGAAATGAACGGAT CCCCAATTAATCTCATTCTTACGGGTAAGATTCTGGTGTGTTTTTTTTTC CAGATATGTACGAATAAAGATTATTTTTTGCAATATTTGAAGATCAATAG AGTAATATTTGGAATAAAATAGTAAAAAAAAATTAAAAACAACACAAATA CACTCAATAGTAATTTTAATTAATTTATTTATTGTGGACATTCACACAAA ACAAGGTAAAATTTTTTTTCTCAAACTTGAATCTGGATTACATTTGTAGT TTTCGCTAAATTATCATACATTTCTCTCAACAAATAATTATTACAATCTT TTGGAAGTACTGCAAATTGGAGTTAATATAGAGAAAGTTCATTTTCCCAA TAAAAAAATATNNNNNNTATGATTAAAAGTCCATATTGGGGATAATTTAG TATCGTATATTAAAAAAAGCTCATAAATTATAGTCAATTCTTCATTTTAT GATATTGTAGTTTCGCTTTTATGAATTTATTTTACTTGCTGTTGAGAAGC AAAGAAAATAAAAGTTGTCATGATTTTTTTTAAATGGAAAACGAAAGCGA TGGCTTTTTTTTTGTATCCAGTAATAAACAATTTAAAGAAATAATATAAT GGGAAAAAAATTATTTTTAGAAATTTTCTTTTAATTACTAATTACCTGCT TAGTGTTTTTATTGTATGGAAAATCATACCATATTTATCCACACTTACCA ATAGGATTATTTCAGAAAAAAAAAAGAAGTTTCGATTTCACACATTTTGT TCTATATTATTTTAAAAAATTTGGCTTATTTTGTCTCTTGCATATGTGTA ACAAATAAAATGTAAGGTCTTAATTATTTTAAATGATTCTTAATAAACTT AAGCATTCAAAATGATCTTCACTTATTTAAACAACTATTAAAGGTGTTAA AAATCTTGGTCATATATGTTAGACCATGCAGTTAAGGGTAAACATTAGTG AGTATCTTAAGCCATTCTTAACAATTTGAACACAAAACCTATAATTGACA AAAATATGTCGAAGAAATAATAAGTTGTACCAAGTGGCCCATTAAAATAT GAACACTTTAAACTTCCAAAAGATATAATTTATTAATAAACAAAATAATT CCAACAAAATTTTTACAATAATTATTTATATGTCTGAGCTCTCCTAATCA TTAATATAACCACCCATAGCGGCAAAAATGGCTTCCAGGAAGGGCGGAAG GCATGGAACTCACTGCAGATGTAGTCATCTGTCAATGCGTACCAGTGCCC GCTGACAATAATTTTGAGGGTCTTGGTGTTTGGATGCAGAAACTGAACTC AAAGGGTCAAAAAGAGTTCTAAAATTGGCTCTCCATCCTCACAAAGTACT TTCCACCCACTTTTTTGTTAGCAGTCTGGTGTGAAACACCAAGATATATT ACATATGACCTTATAGCCTTGAAGAGATTGCCCTGATTTTGTTCTTGAAC TCCTCTTGGTCCAGTTTGGCCTTTTTGACAGAGCCCTTCCTACTCTTTAA CGTTGATGACTTTCTGACGGCAATGAAAGGGGCTTAGATGCACCCAGCTA CTTGGAGTGCACGCTTGGGAATTCGCAATCACCTTCAAGTGTCATGTTCT CCACTTGTACGTGAGCCAACAAGCTCGTTTTTCTTGTAACTAATTATTTA TGCTTTAATATATTAAAATATTAATTGACTGCAAGCGCTCAACTTTCATT AATTATTTGAATTAGTAAGTGTTCAGATTTCAATGGACCACTCGGTTTAT ACATTATACAGGTTGTTAAGATCAAATCGGCCACATTTTTCAGTATCTTT AAACTGTCACTGAGGTGACATTTTTTGGTTGATTGACTTGAAAGTTAGCT TGAATTGTACATATGAATATTGAAATATTAACTTTTGCCAAGTCATTTCA TTAATCTTCATTCGTTAATAAAAACAAACAAGTTGCTGAACTAGTTTATT ACTAACTTAACCTCTTTAGCCTAACAAAATATGTAACATAATATGAAAGG TATATCATTCTCATTTTCAAATTGGTATTGAAAAAAATATTTACAAATAA GGAATTGTGGCAATTGGAGAATTTTTCGAAAATATTAATTTGTTTTTCGC AAAAAATGGCTTTATATATGAAAAAATAACATTGACAGAATGTTTATCTT ACCTTCATTGTACTGGGCAATCTTGATACTTAGATAATAAAATACAAAAA AGTGTTATTCCAAAATGATTATATTATAGTTTAATGTATTTTTTTGTCAT TCAATGGCCTTTTTTATCTATACTTTTGTCCGAAAATCACGCAAAATCAT ATGAAATCGCCATAGCTCATGGACAGCACGCTCGGGAGTTATTCTCTTGA ACTTGATGTGTGTACGTTTGCATCCAGGTGATTTCTAGAAAAACCAATAT ACCTCATGTATATGGATTTCACCGAAAGATTCCTAGGTTAAATAGAATAC TTGTAATACTATAATGCTTGTTTGTACTTAATTAGTGCAACTCCATCTAA CCAATTAAAAAACATTTAAAAAAATCATCAAAAAAGGCATTTTGGAAAAA CTATAAGGCCGATGAGGCAGGGTATAGGACATACTTAGATCTTTAAAAAA ATGATGTTTGAGCTTCTCACACTTTAAAGCATGGGAAAAATGCAGGAATA TATCAAAACTCAAAAAAGTATATTTTTCAATAGGTAACTCTAGATATTAC CTATGTAAAAAATTAATTGATCGGTTCTCTTAGTTTTAACTTTTGATACA TATTCTTTAAAGTGTTAGCTCAACCCAACTCTGAGCACTTTTGTTTGCAT ATAATAAAAAGGGCTGTAATCTTCTCACGTAACTAATCTAAATATTTTGG AAATTATGTCATTAACAACTTAAGCCTAAACTTTTTTTTTTTTTTGTTTA TGTATACACACTATATATATAAAATAAACTTTTCTTTCAATACTTTTTAA AGCTAACTATACCTCTTAACTTATATAAAACACATACATACATTAATACA TCAATGTATTGTATATATTAATAATCTTTGCTCAAATACTTATAAATACA ATTGCAATTAATCACATAAAGTCATTAATCATTATTTATTAACAAATTAA CGAAGAGGTAGTTAGTTAGTTGGGTATGGTATAATGGATTCTCATAATGA TTTGTGTATGTAATTTTGAACTTTATAATAGTAAAACAGCCCACTCATGC ATTGAGTGAACATAAATATGTCTGATAAAGAAAATAAAAAATCAATGGAG TGGCCTAGCTCAGTGTATTACGTGCTCAGGCGAGATTAACATTAGTAATG AGAAGATTTCCAACAAATCCCTGTGCCGATTCCAATGCAATTCTAGTAAA AGTTTCCTGTGCAGATCCTGATTCTTTATTTTTTTAAATAATAGGATTTT AAAAAATAATCCAAAAACCAAGACCCCTCACAAAATAAAAAAATATATAT ATTCATATAATCATGCTAACACCCTGTTAATAACTATATGGGGTAAGCCG GTGCTACATACTCGTTATAACAAATTGGAGTTAATATGTATATTTATTTT GCTCATGCCTTATTCTTTAATAGTAAATTAGTGAAGTTGCGAGAGTGGAA AATAAAAAAGCCTGTTCAGATTACCAATTTTAAAAAGTATTTAAAATTCC AATACGAAGTGGTCCATTAAAATCTGACCACTTTGAGNCTTTAAAACTTC AATTAGATATAATTTATTAATAAACCATAGAATATCAACAAAAATTAATA CAATCAATAGATGTACGTCTCTCTCTTAGCAGCAGCAATGATGACTTCCA AGCAACGGCAGAAGACCTGATACCCACTGTGGATGMATTACTCTATCATG GTGTCACGTTGCTGGCAGACAGTGGCTTTGATAGTCTTGGTGTTTGAATG GAGTGCTATGCAGGCCTTACCCTCGACACAGACCTAAAAGATGTAGTTAA GAGGGCTGGCATCATGACTGTAGGTGCCCAAAAGAGTAAAAAAAGAGTTC AAACGAACTCAAAATACTCATTCAAAAGAGTATTGCAATAAGGAATATAG TTTTTTATCATTTCTATCATCAAGAGTTGCCTGGTCACTCTCACAAGTAT CTTTTTACCCACTTTTTGATAGCACTCTGGAGAGTTTGGTTTGAAACCCC GATATTTCTTGAATGAGCCCTCATGTACTTGACGGAATTGGCCTGGGCAG TTTTCTTTAATGGCTCAATTTGTCCTATTTGACAGAACATTTCAGACTTG CTGACGGCGTAGACAGTGGCCCTGAAGACGCCCGCCCAAAGGTTTGGATT GCGGAAATTTGTCGATCACATTCAAATGTTATTTTCTCGCCTTGTACATA AGCTAGAGAACTCAGATTTTTTTATTTTTGTTTACTAATTGCCTATACTT TAAGATATTGAAATATAAATTAATTTCAATCACTCAACCTTCATTAGTTA TTAAAATTAATAAGTGTTCAGATTTCAATTGACTACCCTATATATTGAAT ATAATTCTGATATATAGATATCGATGTCCCTGCTAGACACTGAGGGTATT TGTGTTTATTACCTTTATCTCAGAAATGCATGTAGATAATCTATGAAGAA AATTTGATATCCTTACGTCATAGTTGACAATCTTTATTGAATTAGCAATT GTATAAATATATATTTATTTAAACAAAGGATGTTTTTCTTTTTTTTTACA TTATTTAAACTCCTAAATAACAATAACCAGACATGTATAAAATATGTCCT AGAAAGTGAGAGCGACTTCTTATAATTGGTAATATGAACAAGTTTTTTAT TTTAAATATCTGTTTACATTATAATATAATTCTTGTGAAGAGAAGATCTA AGTATAAATATTAACTAGACCGTGTGTTTATCAAAGATGGAGAGTCACAA TAAGGGCCTGCTGGTGTATTTTGAGTTTAAGTCCTTCTTACACTCGAGTA GAACATATAAACTTCCTTCCTCTCACGGCTCCTTGCAGCTAATCTAATTA AATGTCATGTTGGTCCTTATTTATTCGGTGCAGTCCAGTTCAGTCTTAGA ACTTGTCGTATAGGTCCTTAGGATTTTCGTTCCTTGGTATCGGTCCTTTG GACTAGTCCTTATCTGTTGGCCATGGAATTTTCTATTAAAATGTCGATGC CAAATAAGAAATATCATATACAAGGCGCGGCAAAAAATTATTTACGCTCT CAATCTAGAACTTTATAAAGCTGTATTTCAGCAACTAGTTCTAATAGGGA ATATGAATAAAATGAAAATAACTAATATGATGTCTTGGGTACCCTAACGA TCAATGTAGCCCCCCTTGGTGCAATGATGAGGTGGATGTAGTCCTCAGAC ATGGCATCCCAGTACTGGTTGACAGTTTCCTTGAGGTTGTTGATATTTGG ATGACGGACGGTACAGACTTCGTACTCCACATGCACAAAAAAAGTAAGTT TGCATCTTGTGAGTAAGGGCCCATATTTTCTTTGGCCAGAAAAGCAACTT GTTCTTCAACTACATGTGGGCCTTTTTGGACGTGTGTGTGCAGGCGCACC ATCTTGCTGGAACACCAGATTCCTTTCTGAGTAATTGGTCGGTAACAACT TTTCCTCAGTTGGTTTCTTGCCACCGTACAAAAATGGCCGAAACGAAATT CATTGGTCACGTTAAGATGGCATTTTCTTGGATTTTAACTCACTTAGGAA GATCTAGGTTTTTTTCATTTTTTGTTTCTTTTTAGTATTTGACTGCATTC ACAAAACCTTGATATGTCTAAGAAAACATAGTTTTAAAGATTTTTTGCTA CACCCGATATGTATTAAAAGCATTGCACATATCCAGCAAAAATTATAAAT ATTTTCATTATTATTTTCAATAAAATATGAACAGTATAAATTTTTACTTA GTTAAATAATTTACTCTTTTATATAATTAAATAATTAAAATAAGAAAAAG TACCCATAATCACGTCATAATGAATCGATTTTACCTTTTTTAAGGACGGA CAAGTGGGGTTGGATTTGATTGCATTCTTACAAAAGGACCAACAAATAAC TAATGACACCTAATCTGCTCTCCTCCCAAAACAAAAATTTAATCGTCAGG ATAACATATTTATTTTGATACTTTTTTTATTTTTACATACCGGCCGACTT GTTTTATGGATCACTGACTAAAATTAATAATTTTAATTGAGAGGAGTTTA AAAATAAACAATTGAAAAACAAAGCAAGCAATTTTTTTTTTTCATGATTT CTTTCCTACAAAATAAAATGTATACATATTTAATGATTACTTATTGTAAT TAACAGGAATAGCTGTTGCGGATATGCTTGTTATGATCGAGTATATTCCT TTTACTCTTCACCGAAATCTTCTCACTGGTCGATCAAAAGAAATAGAATA TTCATGGGGATTTAGTCTCTTTGTTTGGTCCCATTCCAACTTTAGTCTCG TCATACATGCTGTTTCAATCTGGTTAACTCTCTCTCTCGCTGTCTGGAGA TTCATCATGATTCGATTTCATAGTCTTAGTCCAATTTATTGTACGCTTGG AAGATGCAAAATAATGTTGTTCTTAGCATACGGTAAGATTGTTTATATTA TAATGTATTTTACAATATGTATTACATATATCTACATGATATTCTCTATA AGGAATGAATGAAGGACAAGTCTCTAATACTATGCATGATTTTTTAAGGA ACTTTTTAATGAAATATTTTAATGGAAAAACTATCATACCTCAAACAAAA TAAAGATACTATTTCCCTCAGGAATATTTGATCAAATATCATCAATAATG ATAGTTTTACATGTGTTTTATCACACACCAGTATTTATATCTACAAGTAG AGAATCTTTAACAATTTTAAGATTATTGTACCTATAAGCAAAGATGTGGA AATTTGGAATTCGGCATTATCATCGATGGAAAATATACTGTAGATTTATA TGCTTTCAATCACGTTGAAATAAGAATGGCTCTTCTGCACTTGGTTGGAA TAAATTTCAATATATTCATATTAGCAAAGAGCCTTGGTCAGGCAATTATT ATTATTTTTTTTAATTCAGTGTTAAGTGTTTTTTTCTATACAGATTTTTT GTGCTTCAAATTATTAAAATATTTTGGTTCCTTCCTTCTTCTTCTGTATA TTAACTTGTAAGAAGAAGATTAAATTTAAACTTTTTATCACTATTTAAGA TCATTTTTGTTGGATTTATTCGTAATCTTGACCTTTGAATCACTTACGTT CCCAATAAGTTCATAAGCTAAAAATTTTAAACATTATGGAATTACAATAT CAATTATAGAAGATAAATAAGAGAATGTAGGACTATGATGGCAACAGTTA TAAACAGACCAAAAACTTTTAATCAATTCAACTTCAGGGGATACAAGTTT CCCATAAATTCAATATTGCTAGATTTTATACGTAATTAACTTTCCTTTCC TTTGTTTGATAGCTTTCATAATGATGAATCAAAAAGTTAATTTGGTAAAC TTCTAAATATCATCATTTTTCAATAGCTGAAATAACCACCTGTATGTTTT GTATGTATATTGAGGAATCTATACTCAAAATATTATTCAGTTCTTATGTA CACATCAGAATTTATTTATGTTTGAATTGTTGTGTACAATGGTAACCCTC TGAGTACGACTCGAGTACTCGGTCAATATTTGAACTGGTATAGTATGGGT TTCTTTGCATAATATGCTTAATCGTAACAAAGATGTTTAAATATATTCAA TGGAATTATATATAGGTCATAAAAAACAAAGCGCATGAGCTATATTTCAA ATAAATGGTGGTTTTAAAACAATTTGACTATAAGCCCTGACGAAATATGT ATATTGTACGGGAGAAGATAAGTAAAATATAACTTTGGTTGTATCTATGG CTCGTGATGGACCTTTATATTTACAAAATTATAGAAATTGTCTCTAAGAA TATCAATAGTAAATTTTTTCAAGAATTTAATAGAGAAAATAAAAAATATT TGGATGCTTATCACAAATTACTCCTAAATTGTATGCAATAATATAATTTA AATCAAATATGAAATAAAAGTACTTGAAATGAAGAATAAATATGAAAAAG TGAATAATTGAAATTAGATTTGCTACGAATAAAAAAAACTCCCTTCACAC CCAGGGAGACAACACTGCCTCATATTTTCCTTGACAAATAGGATGAAACA GACTTTCTATTTATTTGATAGTTAGCATGATCCTATAGACCTACAAAATC ATCATTCATCAAAGAATAGTCATCTGATACCTTATAATACTAAACTCCTC GTTATTTAGACGTTTAACATCATATTTATAATAAATCAAGACAATTATCT AAGGTTCAGAAGTTTTAAAAGATAATTTTCCAACATTTGAGTACATTTTG GATTGTTTTATCTGGTCCCATTATATTTTCACCTTATCTTTTATTCTCCA TTGAACAACAAAAATGGTCTTGAATAGTCTTATTAGTATAAATTTCAACT TTTAGAACTGCATAAAGCAAGTAGATACTTTTTTTTTTTTGACAATGACA CAAGAAAAAATAAATAAAAGCATTGTTAAAACAAGGGCTCTCTTTTTATC GATGCCTAATAACTTGAGCAATGCCGGTTACTACCATTACTAGTAAAAAC TTCTATTATTTTCTTATGATTAAATTTTGGTATTTGGCACTTTTTCAACA AAAATGCATTTGTTTTTCATTTGTTCTTAAGTCAAATGAACTTATTTCAA GGTCAAAATCAAAGGAGAGTATTATTTTTAGTAGGCCTAGTTCAACAGGA CAAAGTTTATATAATAATAGATAAGAAGTCATTGTTTATTTGTTTAATTT TGGGGGGTTTTCTTTTCTTTTGCAATACAACAAAATTCAATATATCATAT AAATGGGTGAAAAAATAGACACTTTCCCCCATACCTAAGAAACTTGACAT TTATATATATATATATATTTGATCTCATAGCGTATTTCTTATCAAACGTC TTCTGTTTATTATAGTTTCACAATTTATACCTACCTCAACGAAGTTTTTG CATCGGTTTGTTTGTAAGTTAAAAAACGGAAAAAGTTACTGACCGATTTT GATAAAACTTTGTAGCAAGATTTTATATGTTAACAGTAAGAGGACACTAA ATATGAGGGGTCAAGGTAATTGTTAAAACCCCATTATCTACCATAGATTA TGAACAAATTGAAATTTATGTTTCATTTCTCCTGTTTTATAAAGGAACTT AAATTAAATTGCAATGTTAAAAAAAGGCTGAACATTGCAAACTTTTGACT AATAACATACAGTAGAAATGAATGTTATTTTTTAGGGGAAACTGATTGAA AATTATAGTTGATATTATTATACACCTATATACTTTGCTACACAAAACAT CACTGCATAAAAAACAACTTGAATANTTAGGGGATAGTTGGGAGCATTTT TTTAAGATTACTGCATACATTAGTTTTATCGTTCATTCTATTAAATTGTT ACTTTGCAATGTAATTTTCATGTTATTGCAATACTTTTTAAACTTATTTA CTAATACAAAGGCGTAGTCATAAACAGTTTTAATGTACTTTTTTTATATT TAAAGTTATTCCTGTGTTTCTCTGCATTCCAAATTACATTGCAACAACAA TCAATAAGAAAACAAATCAGGGGAAAGTTATTTACGTCTTGGACTGGAGT GACATTGCAACGGCTCATAACAAACTTCTCTATCGAATCAACATTTGGCT CTACACATTTATCCTTAAGCTCATTCCTTGTATCATACTAACAATTATTA CTGGATGGCTTATTAAAGCCTTGTATAAGGTTGAAGAACGCTCAGCCCGA CTTAGAAGCCGTCACTATGATAGCAATACCAAAAGCAAATTAAGAAATGG CAATGGACAGACCTCGGTCATAGTTAATTCTAGAAAAAAAAGTGCAGATA GAACCACAAGACTATTAGTTGTGATTTTAGTTCTTTTTCTCCTCACAGAA TTTCCACAGGTAGGGAAACATTTTAGTATTCTTCTTTTTTTAAAACTCAA ATATACCTAATACATATTTAGGGTATACTTGGAATGCTCTCTGCCATTTA TGGGGATAAATTCTTCAAGGATTGTTACCTTCCTCTTGGAGATGTTATGG ATGCAATGGCACTCATCAACTCGGCTATTAACTTCATTTTCTATTGTTTC ATGTCCAAACAATTTAGGAAAACTTTTGTTGAGACTTTTGGATGTAGATC GTTAAATATGTCTTCAAATCAGGTTCAAATGAAAAACGGTCAAAATAATG GTTTAGCAGCTCGCAAACGAAGGTCTTCTCCCATTCCATCACGTAGAAGA TCCGTCCTTCGAATGAGAAAATGCCAGTTACCAGAGGAAATCCCAATRAT AATAAACAAAAAACTAGACAAACCGATCAAAAACGAGCTACAAGTTGAAG AATCAAAACCAGAGGGTGGAAATTGATGGTTCCAGTATGTGTTGTATGCT GTTATTACAAATTATAAAATTTATATTTTAATTTTCTATATATTTTTTAG TGTCTATT
back to top
Add to Basket