EMLSAG00000004159, EMLSAG00000004159-686925 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000004159
Unique NameEMLSAG00000004159-686925
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
G F30 g3796_Proton female
  1. PreAdult2
No visible phenotype
-Missing-
20.12.2012 - 10:57
29.01.2013 - 10:06
Homology
BLAST of EMLSAG00000004159 vs. GO
Match: - (symbol:CG13384 species:7227 "Drosophila melanogaster" [GO:0015171 "amino acid transmembrane transporter activity" evidence=ISS] [GO:0003333 "amino acid transmembrane transport" evidence=ISS] GO:GO:0016021 EMBL:AE014134 InterPro:IPR013057 Pfam:PF01490 GO:GO:0015171 KO:K14209 GeneTree:ENSGT00390000011245 UniGene:Dm.11338 GeneID:34160 KEGG:dme:Dmel_CG13384 FlyBase:FBgn0032036 GenomeRNAi:34160 NextBio:787162 RefSeq:NP_723383.1 ProteinModelPortal:Q9VLM3 EnsemblMetazoa:FBtr0079655 UCSC:CG13384-RC InParanoid:Q9VLM3 OMA:HIVSTHY PhylomeDB:Q9VLM3 PRO:PR:Q9VLM3 Bgee:Q9VLM3 Uniprot:Q9VLM3)

HSP 1 Score: 292.738 bits (748), Expect = 2.984e-91
Identity = 169/439 (38.50%), Postives = 266/439 (60.59%), Query Frame = 0
Query:    7 LVSSEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYP-DFGPFKIKLIVNMCILCFGVVGSITGTFVSI 443
            L +S   +   G + ++ + T  + ++     +N  T +HLLKGN+GTGILAMP+AFKNAG  +G  GT  +  +C + MH+L+ CS +L  +  +  L ++E A  S     +   R    +  + + I+  FL ITQ+GF  VYF+FV++N+K ++D++  +  V IY  ++L P++ L  +RNLK L P    A  + +  +A TF ++ +D+  V  +KP+A  + LPL+FGTA+Y FEGI +VLP+E  M+T +  GG  GVLN  MV V+C Y  +GFFGYL +G+ ++GS++ ++ +   G+ L+  + +S++ ++ LSY LQF+VP  ++   + S     R K L   V+R  LV  T+  A  IP+LG  ++LVGA+SSS LALIAP II  +T Y   +G F   L  ++ IL FG+ G + GT+ S+
Sbjct:   67 LAASGSGDDEIGSTDKSYNPTHHRDLEHP--TSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMGAICTHCMHMLVNCSHELCRRFQQPSLDFSEVAYCSFESGPLGLRR----YSMLARRIVTTFLFITQIGFCCVYFLFVALNIKDVMDHYY-KMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPDVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQ---GDTLSQLVRISMAVAIFLSYTLQFYVPVNIVEPFVRSHFDTTRAKDLSATVLRVVLVTFTFLLATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNWMLWKDVLILIFGLCGFVFGTWASL 495          
BLAST of EMLSAG00000004159 vs. GO
Match: - (symbol:CG1139 species:7227 "Drosophila melanogaster" [GO:0015171 "amino acid transmembrane transporter activity" evidence=ISS] [GO:0040007 "growth" evidence=IMP] [GO:0003333 "amino acid transmembrane transport" evidence=ISS] GO:GO:0016021 EMBL:AE014296 GO:GO:0040007 InterPro:IPR013057 Pfam:PF01490 GO:GO:0015171 eggNOG:COG0814 KO:K14209 GeneTree:ENSGT00390000011245 OrthoDB:EOG7W41BV EMBL:AY119054 RefSeq:NP_647686.1 UniGene:Dm.13590 STRING:7227.FBpp0072724 EnsemblMetazoa:FBtr0072845 GeneID:38264 KEGG:dme:Dmel_CG1139 UCSC:CG1139-RA FlyBase:FBgn0035300 InParanoid:Q9W056 OMA:CMYILCK GenomeRNAi:38264 NextBio:807805 Uniprot:Q9W056)

HSP 1 Score: 241.891 bits (616), Expect = 2.056e-72
Identity = 152/435 (34.94%), Postives = 246/435 (56.55%), Query Frame = 0
Query:   23 NGS----DTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIY-KGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPD-FGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETFS 451
            NGS    D    +  K P  N   TF H LK ++GTG+LAMP AF +AGY  G   T  I  + +Y +H+L++C   L  +    Y+S+++     +      ++R       I    ++ FL     G   VY VF++ ++K ++D ++   DV I+  ++++P+L + SI+NLK+L PF + AN + L       Y++F ++ P+S+  P      LP FFGT L+  E + ++L +E+ M T KS  G  G+LN  M  V   YVL+GFFGY  +G+  +GS++ ++ ++    I A  + V  + +  +SY LQ +V   +++ K L  + +  R+  +E + R  +VLLT+G AV IPDL +F++LVG+   S L LI P ++     Y + +GPF+IKLI+N+ +LCFG+ G + GT+VSILD I  + 
Sbjct:   25 NGSNDDYDPHQHRELKNPTTNFQ-TFAHFLKASVGTGVLAMPSAFAHAGYVNGTLLTLIIGSLALYCLHILIKCMYILCKRQRVPYVSFSQAMNLGLKQGP-PWLRC---LAPIAVPFVDGFLAFYHFGICCVYVVFIAESIKQLVDEYLVVWDVRIHMCIIIVPLLLIYSIKNLKLLAPFSSAANLLLLVGFGIILYYIFEELPPLSERDPFVAAGKLPTFFGTVLFALEAVGVILAIEENMATPKSFVGPCGILNSGMSIVLGLYVLLGFFGYWKYGNESEGSITLNIPQS---EIPAQVVKVFFAITTWISYALQGYVTAHILWDKYLAKRFKETRQTFYELIFRAIIVLLTFGCAVAIPDLSVFLSLVGSFCLSILGLIFPVLLQICVQYTEGYGPFRIKLIINLLLLCFGIFGGVVGTYVSILDIIAVYK 451          
BLAST of EMLSAG00000004159 vs. GO
Match: - (symbol:CG16700 species:7227 "Drosophila melanogaster" [GO:0015495 "gamma-aminobutyric acid:hydrogen symporter activity" evidence=ISS] [GO:0008021 "synaptic vesicle" evidence=ISS] [GO:0003333 "amino acid transmembrane transport" evidence=ISS] [GO:0015171 "amino acid transmembrane transporter activity" evidence=ISS] [GO:0022008 "neurogenesis" evidence=IMP] GO:GO:0016021 GO:GO:0022008 EMBL:AE014298 InterPro:IPR013057 Pfam:PF01490 GO:GO:0015171 KO:K14209 GeneTree:ENSGT00390000011245 FlyBase:FBgn0030816 EMBL:BT133049 RefSeq:NP_573191.1 UniGene:Dm.13463 EnsemblMetazoa:FBtr0074383 GeneID:32694 KEGG:dme:Dmel_CG16700 UCSC:CG16700-RA InParanoid:Q9VX84 OMA:YLETIVH GenomeRNAi:32694 NextBio:779883 Uniprot:Q9VX84)

HSP 1 Score: 236.113 bits (601), Expect = 4.210e-70
Identity = 145/412 (35.19%), Postives = 232/412 (56.31%), Query Frame = 0
Query:   43 TFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLS-YAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPI-APLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPD-RKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYP-DFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETF 450
            T +HL KGN+G G+ AM +AFKN G  +    T  IAVV I+  H+L+ CS K+RD  G S  + YA+T ++           K + + +    +++IF+C+TQLGF  +YFVF+S N+K IL  +  + +V +   L  +P+L  + I NLK L P   FAN   +  +A T Y+   D  P  + + +    S L LFFGTA++ FEGIALV+P++  M+         GVLN+ M  VS  ++  G  GY+ +G+ + GS++ ++       ILA A+ + +S  V L YPLQFFV  ++++   +     + R LL E   R  +VL+T   A ++P LG+F++L+GA+ S+ LAL+ P +I  ++    + GP     + N+ IL   ++G  TG++ S+   ++ F
Sbjct:   59 TIVHLFKGNIGPGLFAMGDAFKNGGLLVAPLLTVVIAVVSIHCQHVLVTCSKKMRDLKGDSVCADYAQTVEQCFENGP----SKLRGWSRTMGRLVDIFICVTQLGFCCIYFVFISTNLKQILQAYDIDMNVHLVMLLAFVPVLLSSLITNLKWLTPVSMFANVCMILGLAITLYYALKDGLPEVEERALWTNGSQLALFFGTAIFAFEGIALVMPLKNAMRKPHQFERPLGVLNVGMFLVSVMFMFAGSVGYMKWGEQVGGSLTLNLGD----TILAQAVKLMVSAGVLLGYPLQFFVAIQIMWPNAKQMCGIEGRSLLGELGFRTFMVLVTLAIAEMVPALGLFISLIGALCSTALALVFPPVIELISRSELNKGPGIWICVKNLVILVLALLGFFTGSYESLKQIVKHF 462          
BLAST of EMLSAG00000004159 vs. GO
Match: - (symbol:CG8785 species:7227 "Drosophila melanogaster" [GO:0003333 "amino acid transmembrane transport" evidence=ISS] [GO:0015171 "amino acid transmembrane transporter activity" evidence=ISS] EMBL:AE013599 GO:GO:0016021 InterPro:IPR013057 Pfam:PF01490 GO:GO:0015171 eggNOG:COG0814 KO:K14209 GeneTree:ENSGT00390000011245 OrthoDB:EOG7W41BV EMBL:AY060621 RefSeq:NP_610804.1 RefSeq:NP_725205.1 UniGene:Dm.586 STRING:7227.FBpp0086994 EnsemblMetazoa:FBtr0087881 EnsemblMetazoa:FBtr0087882 GeneID:36391 KEGG:dme:Dmel_CG8785 UCSC:CG8785-RA FlyBase:FBgn0033760 InParanoid:Q7K2W3 OMA:FLCTHCV GenomeRNAi:36391 NextBio:798296 Uniprot:Q7K2W3)

HSP 1 Score: 234.958 bits (598), Expect = 1.317e-69
Identity = 141/412 (34.22%), Postives = 231/412 (56.07%), Query Frame = 0
Query:   46 HLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILD-----NWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPD-FGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETFS 451
            HLLK +LGTGILAMP AF NAG A G   T  +  +C + +H+L++ S  +      S L +AETA++   Y      +  + +    K  ++I L  T    + VY VF++ +   +++     NW    DV IY  L ++P L +  IR+LK L PF   AN   +   A T Y++F +    SD   IA  + +PLFF T ++  EGI +V+P+E  M+  +   G  GVLNIAMVTV   Y ++GFFGY+ FGD + GS++ ++    +G  L     + ++ ++  ++ LQF+VP E++++ +  K  P++  + + ++R  ++LL+ G A  IP+L  F++LVGA+  S L +  P+ + T+ ++PD  G  K KL+ N+ +  F ++  + G   SI + IE +S
Sbjct:   71 HLLKSSLGTGILAMPMAFHNAGLAFGMAMTLIVGFLCTHCVHILVKTSHDICRDAKVSALGFAETAEKVFEYGP----KGMRPYSNFAKQFVDIGLMATYYAAACVYIVFIATSFHDVINYDLKINW----DVRIYIALTVIPCLLIGQIRDLKWLVPFSMMANIFIVVTFAITLYYMFDEPLVYSDKPLIAKAAHIPLFFATVIFAMEGIGVVMPVENSMRKPQHFLGCPGVLNIAMVTVVSLYAIIGFFGYVRFGDQVRGSITLNLP---EGAWLGDTAKLLMAVAILFTFGLQFYVPNEILWRKISHKFSPEKHNITQILLRSGIILLSGGVAAAIPNLEPFISLVGAVFFSLLGIFVPSFVETVYLWPDRLGVCKWKLVKNIFLGVFSILALVAGAVASINEIIEMYS 471          
BLAST of EMLSAG00000004159 vs. GO
Match: - (symbol:CG7888 species:7227 "Drosophila melanogaster" [GO:0015171 "amino acid transmembrane transporter activity" evidence=ISS] [GO:0003333 "amino acid transmembrane transport" evidence=ISS] GO:GO:0016021 EMBL:AE014296 InterPro:IPR013057 Pfam:PF01490 GO:GO:0015171 KO:K14209 GeneTree:ENSGT00390000011245 UniGene:Dm.924 GeneID:39232 KEGG:dme:Dmel_CG7888 FlyBase:FBgn0036116 GenomeRNAi:39232 NextBio:812620 RefSeq:NP_648425.1 ProteinModelPortal:Q9VTD7 PRIDE:Q9VTD7 EnsemblMetazoa:FBtr0076201 UCSC:CG7888-RB InParanoid:Q9VTD7 OMA:LIQICTH PhylomeDB:Q9VTD7 Bgee:Q9VTD7 Uniprot:Q9VTD7)

HSP 1 Score: 234.572 bits (597), Expect = 1.617e-69
Identity = 152/418 (36.36%), Postives = 242/418 (57.89%), Query Frame = 0
Query:   40 NPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGET--DVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRK--LLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPF-KIKLIV-NMCILCFGVVGSITGTFVSILDAIETFS 451
            N  T  HLLKG+LGTGILAMP AF+N+GY  G  GT  I  +C + +H L++   +L  +     ++Y   A+ +M      F   R F P I  T++N FL I QLG   VY VFV+ N+K I+D  + +T  DV +   ++LLP++ +  +RNLK L PF T ANAI + +     Y++F +             S  PLFFGT L+  E I ++LP+E EMKT +  GG  GVLN++MV +   YV MG FGYL++G ++ GS++ ++    +  +L++ +   L+ ++ +++ L  +V  ++ +    +K    ++  L WEY +R  LVL+T+  AV IP+L +F++L GA+  S L L  PA+I   T + +   F K+ L++ N  ++  G++G + GT+ S+ + + TFS
Sbjct:   55 NSETLFHLLKGSLGTGILAMPNAFRNSGYITGSIGTIVIGFICTFCIHQLVKAQYELCRRKKMPSMNYPMVAETAMGEGPKCF---RVFAPYI-GTVVNTFLLIYQLGTCCVYVVFVASNIKAIVDA-VADTSIDVRLCMIIILLPLILINWVRNLKYLAPFSTLANAITMVSFGIICYYIFREPVTTEGKDAFGKPSNFPLFFGTVLFALEAIGVILPLENEMKTPQKFGGSCGVLNVSMVLIVFLYVGMGLFGYLNYGSAVLGSITLNMP---EHEVLSMCVKGMLAFAIYITHGLACYVAIDITWNDYVAKRLGAQRNALFWEYAVRTGLVLITFLLAVAIPNLELFISLFGALCLSALGLAFPALIQICTHWYNTKGFAKVWLVLSNFVLIIVGILGLVIGTYTSLKEIVLTFS 464          
BLAST of EMLSAG00000004159 vs. GO
Match: - (symbol:Y43F4B.7 species:6239 "Caenorhabditis elegans" [GO:0008340 "determination of adult lifespan" evidence=IMP] GO:GO:0016021 InterPro:IPR013057 Pfam:PF01490 eggNOG:COG0814 KO:K14209 GeneTree:ENSGT00390000011245 EMBL:AL021481 HOGENOM:HOG000006824 PIR:T26845 RefSeq:NP_499743.2 UniGene:Cel.19937 ProteinModelPortal:O45936 STRING:6239.Y43F4B.7 PaxDb:O45936 EnsemblMetazoa:Y43F4B.7.1 EnsemblMetazoa:Y43F4B.7.2 GeneID:259544 KEGG:cel:CELE_Y43F4B.7 UCSC:Y43F4B.7 CTD:259544 WormBase:Y43F4B.7 InParanoid:O45936 OMA:VACIMIS NextBio:952070 Uniprot:O45936)

HSP 1 Score: 229.565 bits (584), Expect = 9.203e-68
Identity = 136/409 (33.25%), Postives = 237/409 (57.95%), Query Frame = 0
Query:   44 FMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIG-ETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETFS 451
            F+H++K  LGTG+L++P AFK++G  LG   T  I ++C+Y M  ++  +  + ++ G+  + YA   + + V     +I++  +F   FK ++N+ + I+QLGF  VYFVF++ N++   +N        +++  LLL+P+L + SIR L IL PF   AN + + A+A   +F   D++P+S +      + LPLFFGT ++ FEG+A+++P+E  M++  +   + GVLN + + V   + + GF+GYLS G+ +  + + ++            I +     + +SYPLQF+VP E I K +  K+  D++ L+ Y+ R+S V+LT   A LIP L +F++L+GA S + +AL+ P  I  LT Y          I N+ +L F  +G  TGT+ ++++  +TF+
Sbjct:   55 FIHMVKAMLGTGLLSLPLAFKHSGLFLGLILTVLICLICLYCMRQVVFAAHFVCNRNGRDLIDYANIMRGA-VEMGPPWIKRNGYF---FKQLVNVNMFISQLGFCCVYFVFMADNLEDFFNNNTSIHLSKAVWMLLLLIPMLSICSIRRLSILAPFAMAANVVYVVAVAVVLFFFLSDLRPISSLPWFGKATDLPLFFGTVMFAFEGVAVIMPIENRMQSPHAFISWNGVLNSSCLVVLAIFSVTGFYGYLSLGNDVKDTATLNLPMTP----FYQTIKLMFVACIMISYPLQFYVPMERIEKWITRKIPVDKQTLYIYIARYSGVILTCAIAELIPHLALFISLIGAFSGASMALLFPPCIELLTSYAKNELSTGLWIKNIVLLTFAFIGFTTGTYSALIEIAKTFA 455          
BLAST of EMLSAG00000004159 vs. GO
Match: - (symbol:CELE_Y43F4B.7 "Protein Y43F4B.7" species:6239 "Caenorhabditis elegans" [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] GO:GO:0016021 InterPro:IPR013057 Pfam:PF01490 eggNOG:COG0814 KO:K14209 GeneTree:ENSGT00390000011245 EMBL:AL021481 HOGENOM:HOG000006824 PIR:T26845 RefSeq:NP_499743.2 UniGene:Cel.19937 ProteinModelPortal:O45936 STRING:6239.Y43F4B.7 PaxDb:O45936 EnsemblMetazoa:Y43F4B.7.1 EnsemblMetazoa:Y43F4B.7.2 GeneID:259544 KEGG:cel:CELE_Y43F4B.7 UCSC:Y43F4B.7 CTD:259544 WormBase:Y43F4B.7 InParanoid:O45936 OMA:VACIMIS NextBio:952070 Uniprot:O45936)

HSP 1 Score: 229.565 bits (584), Expect = 9.203e-68
Identity = 136/409 (33.25%), Postives = 237/409 (57.95%), Query Frame = 0
Query:   44 FMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIG-ETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETFS 451
            F+H++K  LGTG+L++P AFK++G  LG   T  I ++C+Y M  ++  +  + ++ G+  + YA   + + V     +I++  +F   FK ++N+ + I+QLGF  VYFVF++ N++   +N        +++  LLL+P+L + SIR L IL PF   AN + + A+A   +F   D++P+S +      + LPLFFGT ++ FEG+A+++P+E  M++  +   + GVLN + + V   + + GF+GYLS G+ +  + + ++            I +     + +SYPLQF+VP E I K +  K+  D++ L+ Y+ R+S V+LT   A LIP L +F++L+GA S + +AL+ P  I  LT Y          I N+ +L F  +G  TGT+ ++++  +TF+
Sbjct:   55 FIHMVKAMLGTGLLSLPLAFKHSGLFLGLILTVLICLICLYCMRQVVFAAHFVCNRNGRDLIDYANIMRGA-VEMGPPWIKRNGYF---FKQLVNVNMFISQLGFCCVYFVFMADNLEDFFNNNTSIHLSKAVWMLLLLIPMLSICSIRRLSILAPFAMAANVVYVVAVAVVLFFFLSDLRPISSLPWFGKATDLPLFFGTVMFAFEGVAVIMPIENRMQSPHAFISWNGVLNSSCLVVLAIFSVTGFYGYLSLGNDVKDTATLNLPMTP----FYQTIKLMFVACIMISYPLQFYVPMERIEKWITRKIPVDKQTLYIYIARYSGVILTCAIAELIPHLALFISLIGAFSGASMALLFPPCIELLTSYAKNELSTGLWIKNIVLLTFAFIGFTTGTYSALIEIAKTFA 455          
BLAST of EMLSAG00000004159 vs. GO
Match: - (symbol:slc36a4 "solute carrier family 36 (proton/amino acid symporter), member 4" species:7955 "Danio rerio" [GO:0008150 "biological_process" evidence=ND] [GO:0003674 "molecular_function" evidence=ND] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] ZFIN:ZDB-GENE-050309-239 GO:GO:0016021 InterPro:IPR013057 Pfam:PF01490 KO:K14209 GeneTree:ENSGT00390000011245 TreeFam:TF314873 OrthoDB:EOG73V6KC CTD:120103 EMBL:CU915757 RefSeq:XP_002664741.3 RefSeq:XP_005157856.1 UniGene:Dr.156456 Ensembl:ENSDART00000057972 GeneID:504109 KEGG:dre:504109 OMA:PMNISAT Bgee:E7F8C6 Uniprot:E7F8C6)

HSP 1 Score: 228.794 bits (582), Expect = 3.650e-67
Identity = 145/427 (33.96%), Postives = 233/427 (54.57%), Query Frame = 0
Query:   43 TFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILD----NWIGET------------------DVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAI 447
            T +HLLKGN+GTG+L +P A KNAG  LG      + VVC++ MH+L+ CS +L +++ +S L Y+ET   +M  +  + +R+   F    + ++N FL +TQLGF SVYFVF++ N+K +++    N   ET                  D+ +Y   LL  I+ L  IR+L+ +      AN     ++   F ++  D+     +   +     P FFGTA++ FEGI +VLP+E +M+  K    +   LNI M  +   YV +   GYL F D I GS++ ++   +  N L   + V  S  V +S+ +QFFVP E++   +  ++R   + + +  +R  LV LT   AVLIP L + ++LVGA+SSS LAL+ P ++  L  +P   P  + L+ ++ I   G +G +TGT+V++ + I
Sbjct:   48 TLLHLLKGNIGTGLLGLPLAVKNAGIVLGPVSLVLMGVVCVHCMHILVNCSHQLSERLKRSPLGYSETVAAAMELSSSQCLRRSAHFG---RHLVNFFLVLTQLGFCSVYFVFLAENIKQVMEGTHMNSTAETVLLSSNSSEASVASSVAIDLRLYMVFLLPFIIVLTFIRDLRNMAALSAIANLCMAISLIFIFSYILNDLSDPRRLPYASTWRKFPFFFGTAIFAFEGIGVVLPLENQMREPKR---FPQALNIGMGFIIVLYVTLATLGYLRFRDDIKGSITLNLPHDSWSNQL---VKVLYSFGVFVSFAVQFFVPAEILLPPMCERVRKSWRRVADLSLRALLVCLTCVTAVLIPRLDLVISLVGAVSSSALALVFPPLVE-LIAFPSQPPPPMLLLKDISIAALGFIGFLTGTYVTVEEII 464          
BLAST of EMLSAG00000004159 vs. GO
Match: - (symbol:CELE_T27A1.5 "Protein T27A1.5, isoform a" species:6239 "Caenorhabditis elegans" [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] GO:GO:0016021 InterPro:IPR013057 Pfam:PF01490 GeneTree:ENSGT00390000011245 EMBL:FO081751 RefSeq:NP_001040812.1 UniGene:Cel.14272 ProteinModelPortal:G4SQY7 EnsemblMetazoa:T27A1.5a.1 EnsemblMetazoa:T27A1.5a.2 GeneID:173442 KEGG:cel:CELE_T27A1.5 CTD:173442 WormBase:T27A1.5a OMA:ICLICIY NextBio:879671 PRO:PR:G4SQY7 ArrayExpress:G4SQY7 Uniprot:G4SQY7)

HSP 1 Score: 218.779 bits (556), Expect = 8.337e-64
Identity = 142/435 (32.64%), Postives = 232/435 (53.33%), Query Frame = 0
Query:   29 GKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEI---------EFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSI----YTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETF 450
              +V+ +  I      +H++K  +GTG+L++P AFK++G  LG     FI ++CIY       C+ +L    G+ Y+++ +  ++ M Y  +          +IR   +   +FK ++NI + + Q GF  VYFVF++ N+K   D     + + I    +  LLL+PI  L +IR LK L P    AN + + A+      LF D +P+  +     +  LPLFFGT ++ FEG+A+VLP+E +M          GVLN + + V   Y+ +GFFG+L +G+ I  +++ ++ +         AI V     + +SYPLQF+VP E + K ++ K+   ++    Y IRF  VLLT   A LIP L +F++LVG+++ + L L+ P +I  L  Y      K   I N+ ++ F +VG  TGT+ S++  IE F
Sbjct:   30 ASRVRDSRSITADQALIHMIKVMMGTGMLSLPLAFKHSGIWLGLILLCFICLICIY-------CTRQL--IFGQHYITFIKR-EQRMDYANVMRSAVELGPAWIRGHGY---LFKQMVNINMFVAQFGFCCVYFVFMADNLKQFFDQ---TSSIHISQAGWIALLLIPISALCTIRELKALAPLAAVANFVYIIAVVIVLADLFSDWQPLDSLPAFGAVENLPLFFGTVMFAFEGVAVVLPIENQMNEPIHFITPNGVLNTSCILVLLVYMTVGFFGFLRYGNDIKDTLTLNLPQTP----FYQAIKVMFVLCILVSYPLQFYVPMERVEKWIKRKVVEAKQEPMIYAIRFGGVLLTCAMAQLIPHLALFISLVGSVAGTSLTLVFPPLIELLCSYSKQELTKWVWIRNIGLMAFAMVGFTTGTYASMVQIIEAF 444          
BLAST of EMLSAG00000004159 vs. GO
Match: - (symbol:Slc36a4 "solute carrier family 36 (proton/amino acid symporter), member 4" species:10090 "Mus musculus" [GO:0003674 "molecular_function" evidence=ND] [GO:0005575 "cellular_component" evidence=ND] [GO:0006810 "transport" evidence=IEA] [GO:0006865 "amino acid transport" evidence=IEA] [GO:0015293 "symporter activity" evidence=IEA] [GO:0015808 "L-alanine transport" evidence=ISO] [GO:0015824 "proline transport" evidence=ISO] [GO:0015827 "tryptophan transport" evidence=ISO] [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] MGI:MGI:2442595 GO:GO:0016021 GO:GO:0015827 GO:GO:0055085 GO:GO:0015293 InterPro:IPR013057 Pfam:PF01490 eggNOG:COG0814 KO:K14209 GeneTree:ENSGT00390000011245 GO:GO:0015824 HOVERGEN:HBG057183 TreeFam:TF314873 HOGENOM:HOG000006823 CTD:120103 GO:GO:0015808 EMBL:AF453746 EMBL:AK032074 EMBL:BC115964 RefSeq:NP_758493.2 UniGene:Mm.138815 ProteinModelPortal:Q8CH36 IntAct:Q8CH36 PhosphoSite:Q8CH36 PRIDE:Q8CH36 Ensembl:ENSMUST00000061568 GeneID:234967 KEGG:mmu:234967 UCSC:uc009ogg.1 InParanoid:Q8CH36 NextBio:382452 PRO:PR:Q8CH36 ArrayExpress:Q8CH36 Bgee:Q8CH36 Genevestigator:Q8CH36 Uniprot:Q8CH36)

HSP 1 Score: 217.238 bits (552), Expect = 1.181e-62
Identity = 142/424 (33.49%), Postives = 233/424 (54.95%), Query Frame = 0
Query:   43 TFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGET------------------DVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIV-NMCILCFGVVGSITGTFVSILDAI 447
            T +HLLKGN+GTG+L +P A KNAG  LG     FI ++ ++ MH+L+ CS  L  +  KS L Y++T   +M  +    ++++  +    + +++ FL ITQLGF SVY VF++ N+K + + ++G T                  D+ +Y    L  I+ L  IR LK L      AN     ++   + ++  ++    ++  +A     PLFFGTA++ FEGI +VLP+E +M+  K    +   LNI M  V+  Y+ +   GY+ F D I GS++ ++ +      L  ++ +  S  + ++Y +QF+VP E+I  G+ +++    K + E+ IR  LV +T   A+LIP L I ++ VGA+SSS LALI P ++  LT   D   + I +I+ N+ I   GVVG + GT+V++ + I
Sbjct:   61 TLVHLLKGNIGTGLLGLPLAIKNAGIVLGPISLVFIGIISVHCMHILVRCSHFLCQRFKKSTLGYSDTVSFAMEASPWSCLQRQAAWG---RQVVDFFLVITQLGFCSVYIVFLAENVKQVHEGFLGSTPIVSNGSDLSHACERRSVDLRVYMLCFLPLIILLVFIRELKNLFVLSFLANISMAASLVIIYQYVVRNMPDPHNLPIVAGWKKYPLFFGTAVFAFEGIGVVLPLENQMRESKR---FPQALNIGMAIVTVLYISLATLGYMCFRDEIKGSITLNLPQ---DMWLYQSVKILYSFGIFVTYSIQFYVPAEIIIPGVTARLHAKWKRICEFGIRSLLVSITRAGAILIPRLDIVISFVGAVSSSTLALILPPLVEILTFSKDH--YNIWMILKNISIAFTGVVGFLLGTYVTVEEII 473          
BLAST of EMLSAG00000004159 vs. C. finmarchicus
Match: gi|592845586|gb|GAXK01111958.1| (TSA: Calanus finmarchicus comp53514_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 270.011 bits (689), Expect = 7.917e-83
Identity = 186/450 (41.33%), Postives = 276/450 (61.33%), Query Frame = 0
Query:    9 SSEKDEHHS-------GES-FENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEXXXXXXXXXXXXXXXXXXXLCITQLGXXXXXXXXXXXNMKPILDNWIGETDVSIYTTXXXXXXXXXASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNXXXXXXXXXXXXXXXXXYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETF 450
            SS+KDE  S       G++  E+    Q + V K   I+N  T +H+LKGN+GTGILAMP+A KN+G  +G  G   +A +C++ MH+L+  S +L  +    +L+Y++        +      + + F  I +  I++FLCITQLGF  VYFVFVS N++ +L+++ GE D  +Y  + LLP+L L SIRNLK L P    AN +    +   FY+L  DI  VS+ K  A    LPL+FGTA+Y FEGI +VLP+E  MK    M G+ GVLN +M  VSC Y+ +GFFGYL +G+++ GS++ ++     G ILA  + + +S ++  SY LQF+VP ++I   L++ +     L  EY++R  LVLLT+G A  IP L +F++LVG++SSS LAL+APAII  +T   D   + +    N+ I  FG +G ITG++VS+ + I++F
Sbjct:   46 SSQKDEERSLIRQKSDGDTGLEDSEAQQLQNVGKDHKISNTDTIIHMLKGNIGTGILAMPDAIKNSGLVVGNLGLVLMATICVHCMHILVNSSQELCRRTNVPFLTYSDVMSTCFATSN---SHRIRKFSNIARITIDVFLCITQLGFCCVYFVFVSQNLQQVLNHYFGEVDYRVYMAITLLPMLFLVSIRNLKYLSPVSMLANLLQFVGLGIIFYYLLQDIPLVSERKVFATWGQLPLYFGTAIYAFEGIGIVLPLENSMKNPGDMKGWNGVLNTSMTIVSCLYIAVGFFGYLKYGEAVTGSITLNLPV---GEILATVVKLVMSLAIFFSYALQFYVPVDIINPYLQTWISEHNHLKAEYLLRLFLVLLTFGLAAAIPKLDLFISLVGSVSSSTLALMAPAIIEIVTKGDDCSRWMMA--KNILIFSFGFLGFITGSYVSVKNIIDSF 1371          
BLAST of EMLSAG00000004159 vs. C. finmarchicus
Match: gi|592845587|gb|GAXK01111957.1| (TSA: Calanus finmarchicus comp53514_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 270.011 bits (689), Expect = 9.646e-83
Identity = 186/450 (41.33%), Postives = 276/450 (61.33%), Query Frame = 0
Query:    9 SSEKDEHHS-------GES-FENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEXXXXXXXXXXXXXXXXXXXLCITQLGXXXXXXXXXXXNMKPILDNWIGETDVSIYTTXXXXXXXXXASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNXXXXXXXXXXXXXXXXXYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETF 450
            SS+KDE  S       G++  E+    Q + V K   I+N  T +H+LKGN+GTGILAMP+A KN+G  +G  G   +A +C++ MH+L+  S +L  +    +L+Y++        +      + + F  I +  I++FLCITQLGF  VYFVFVS N++ +L+++ GE D  +Y  + LLP+L L SIRNLK L P    AN +    +   FY+L  DI  VS+ K  A    LPL+FGTA+Y FEGI +VLP+E  MK    M G+ GVLN +M  VSC Y+ +GFFGYL +G+++ GS++ ++     G ILA  + + +S ++  SY LQF+VP ++I   L++ +     L  EY++R  LVLLT+G A  IP L +F++LVG++SSS LAL+APAII  +T   D   + +    N+ I  FG +G ITG++VS+ + I++F
Sbjct:   46 SSQKDEERSLIRQKSDGDTGLEDSEAQQLQNVGKDHKISNTDTIIHMLKGNIGTGILAMPDAIKNSGLVVGNLGLVLMATICVHCMHILVNSSQELCRRTNVPFLTYSDVMSTCFATSN---SHRIRKFSNIARITIDVFLCITQLGFCCVYFVFVSQNLQQVLNHYFGEVDYRVYMAITLLPMLFLVSIRNLKYLSPVSMLANLLQFVGLGIIFYYLLQDIPLVSERKVFATWGQLPLYFGTAIYAFEGIGIVLPLENSMKNPGDMKGWNGVLNTSMTIVSCLYIAVGFFGYLKYGEAVTGSITLNLPV---GEILATVVKLVMSLAIFFSYALQFYVPVDIINPYLQTWISEHNHLKAEYLLRLFLVLLTFGLAAAIPKLDLFISLVGSVSSSTLALMAPAIIEIVTKGDDCSRWMMA--KNILIFSFGFLGFITGSYVSVKNIIDSF 1371          
BLAST of EMLSAG00000004159 vs. C. finmarchicus
Match: gi|592845585|gb|GAXK01111959.1| (TSA: Calanus finmarchicus comp53514_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 268.085 bits (684), Expect = 1.088e-82
Identity = 184/442 (41.63%), Postives = 273/442 (61.76%), Query Frame = 0
Query:   10 SEKDEHHSG-ESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEXXXXXXXXXXXXXXXXXXXLCITQLGXXXXXXXXXXXNMKPILDNWIGETDVSIYTTXXXXXXXXXASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNXXXXXXXXXXXXXXXXXYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETF 450
            S+K +  SG E  E+    Q + V K   I+N  T +H+LKGN+GTGILAMP+A KN+G  +G  G   +A +C++ MH+L+  S +L  +    +L+Y++        +      + + F  I +  I++FLCITQLGF  VYFVFVS N++ +L+++ GE D  +Y  + LLP+L L SIRNLK L P    AN +    +   FY+L  DI  VS+ K  A    LPL+FGTA+Y FEGI +VLP+E  MK    M G+ GVLN +M  VSC Y+ +GFFGYL +G+++ GS++ ++     G ILA  + + +S ++  SY LQF+VP ++I   L++ +     L  EY++R  LVLLT+G A  IP L +F++LVG++SSS LAL+APAII  +T   D    +  +  N+ I  FG +G ITG++VS+ + I++F
Sbjct:   46 SDKPKVPSGAEGLEDSEAQQLQNVGKDHKISNTDTIIHMLKGNIGTGILAMPDAIKNSGLVVGNLGLVLMATICVHCMHILVNSSQELCRRTNVPFLTYSDVMSTCFATSN---SHRIRKFSNIARITIDVFLCITQLGFCCVYFVFVSQNLQQVLNHYFGEVDYRVYMAITLLPMLFLVSIRNLKYLSPVSMLANLLQFVGLGIIFYYLLQDIPLVSERKVFATWGQLPLYFGTAIYAFEGIGIVLPLENSMKNPGDMKGWNGVLNTSMTIVSCLYIAVGFFGYLKYGEAVTGSITLNLPV---GEILATVVKLVMSLAIFFSYALQFYVPVDIINPYLQTWISEHNHLKAEYLLRLFLVLLTFGLAAAIPKLDLFISLVGSVSSSTLALMAPAIIEIVTKGDDCS--RWMMAKNILIFSFGFLGFITGSYVSVKNIIDSF 1347          
BLAST of EMLSAG00000004159 vs. C. finmarchicus
Match: gi|592845582|gb|GAXK01111962.1| (TSA: Calanus finmarchicus comp53514_c6_seq2 transcribed RNA sequence)

HSP 1 Score: 272.322 bits (695), Expect = 1.153e-82
Identity = 183/449 (40.76%), Postives = 275/449 (61.25%), Query Frame = 0
Query:    7 LVSSEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEXXXXXXXXXXXXXXXXXXXLCITQLGXXXXXXXXXXXNMKPILDNWIGETDVSIYTTXXXXXXXXXASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNXXXXXXXXXXXXXXXXXYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTV-----YPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETF 450
            ++ S+++     E  E  +D +         I+N  T +H+LKGN+GTGILAMP+A KN+G  +G  G  F+A +CI+ MH+L+  S +L  +    +L+Y++ A+     +      + + F    +T+I++FLCITQLGF  VYFVFVS N++ I +++ GE +  IY  ++L+P+L LASIRNLK L P    AN +    +   FY+L  DI    + K  A    LPL+FGTA+Y FEGI +VLP+E +MKT   M G+ GVLN +M+ VSC Y+ +GFFGYL +GDS+ GS++ ++        LA  + V +S +V  +Y LQF+VP +++   ++ ++ P   L  EY +RFSLV+LT+  A  IP L +F++LVGA+SSS LA++APAII T+T      +P    FK     N+ +   G  G ITG++VSI + I+ F
Sbjct:  332 IIPSDEESDLLSEDGEPETDNK---------ISNTDTIIHMLKGNIGTGILAMPDAIKNSGLVVGNIGLVFMATMCIHCMHILVNTSQELCRRTNLPFLTYSDVAETCFATSS---SPRLRAFSSTARTVIDVFLCITQLGFCCVYFVFVSQNLEQIFNHYYGEINYHIYMAIILIPMLLLASIRNLKYLSPISMLANILQFIGLGIIFYYLLQDIPYSWERKTFASWGQLPLYFGTAIYAFEGIGVVLPLENQMKTPADMRGWNGVLNTSMIIVSCLYIAVGFFGYLKYGDSVAGSITLNLPV---NEFLATLVKVMMSLAVFFTYALQFYVPVDLLNPFIQRRIAPQNYLKAEYALRFSLVMLTFALAAAIPKLDLFISLVGAVSSSTLAMMAPAIIDTVTQGERCSWPR--AFK-----NLILFILGFFGFITGSYVSIRNIIKYF 1612          
BLAST of EMLSAG00000004159 vs. C. finmarchicus
Match: gi|592862259|gb|GAXK01095303.1| (TSA: Calanus finmarchicus comp1395846_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 227.254 bits (578), Expect = 5.303e-67
Identity = 164/427 (38.41%), Postives = 256/427 (59.95%), Query Frame = 0
Query:   30 KKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMV-YTEIEXXXXXXXXXXXXXXXXXXXLCITQLGXXXXXXXXXXXNMKPILDNWIG-ETDVSIYTTXXXXXXXXXASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKP-VSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSID-GSVSESVAKANDGNXXXXXXXXXXXXXXXXXYPLQFFVPFEVIYKGLESKMR-PDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETFS 451
            K+ K + LI+  V  +HL+KGN+G G+L+MP A  NAG A+G  G A +AV+ I+ MHLL+  +  L  +    YL Y E  + +++ Y+             I    INIF+C TQLG +SVY +F++ ++K + +N +G +     Y  LL +P++ L  +RNL++L P    A    L+A+A  FY++F D  P V+ +     +S LPLFFGTA++TFEGI +VLP+E  MK    + G  GVLN  MV V+C Y+  GF+GYL +G++   G+V+ ++      N    +  VS+++++ L+YPLQF+V   +I   L      P+R +L+EY++R S+V +++  A L+P L +F++L GA+  S L+LIAPAII T T +   G  +I+L  N  I  FG+VG+ TGT +S+   ++ F 
Sbjct:   66 KEKKASELISANVALVHLMKGNIGIGVLSMPSALVNAGLAVGTAGLAVVAVITIHCMHLLVNATHVLTQRHNSVYLDYGEVVQLALLPYSR--------RLSNIGLKTINIFICTTQLGGNSVYVLFIATSLKQLCENLLGLDWSFYYYILLLWVPLVLLCLLRNLRLLAPVTVIATVCELYALAIVFYYIFRDPLPSVTSVPSTVSISKLPLFFGTAIFTFEGIGIVLPLENRMKNPAHLRGLSGVLNTGMVMVACLYIATGFYGYLKYGEAASIGAVTLNLPDELLAN----SARVSIASAIFLTYPLQFYVLISIIVPNLVVPYSAPERVILYEYILRVSIVTVSFLLASLVPYLNLFISLAGALCMSSLSLIAPAIIDTATNWEQIG--RIRLAKNGFIFVFGMVGTFTGTILSVGAIVKKFQ 1304          
BLAST of EMLSAG00000004159 vs. C. finmarchicus
Match: gi|592772942|gb|GAXK01181626.1| (TSA: Calanus finmarchicus comp128642_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 208.764 bits (530), Expect = 3.732e-59
Identity = 156/440 (35.45%), Postives = 249/440 (56.59%), Query Frame = 0
Query:   22 ENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEXXXXXXXXXXXXXXXXXXXLCITQLGXXXXXXXXXXXNMKPILD-----NWIGETDVSIYTTXXXXXXXXXASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKP--IAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNXXXXXXXXXXXXXXXXXYPLQFFVPFEVIYKGLESKMRPDRKLLW-EYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVY-PDFGP-FKIKLIVNMCILCFGVVGSITGTFVSILDAIETFS 451
            E G D +G+       I+N  T +HLLKGN+G G+L MP A  NAG   G  G  F+A+V I+ MH L+  +  L  K G  +L YA+TA+ +     +E            + +INIFLC++Q+G ++VY +FV+ N+ PI++     NW    +  +Y  +LL+P++ + SI+NLK L P    AN +    +   FY++F    P SD  P   +P    P+FFGTA++ FEGI++VLP+E +M   K M G+ GVLN +MVT++  Y+ MGFFGYL +G     S++ ++ +   G+ILA +     S ++  SY LQF+V  ++I   +      DR   + E++ R  L ++T G A  +P L + ++L+GA+  S L+L+APA++ +   +  D  P F  + I N+ I   G +  I GT++S ++ ++ F 
Sbjct:  509 EGGEDREGENT-----ISNAETIIHLLKGNIGIGVLTMPIAISNAGLVGGVLGMVFVAIVTIHCMHTLVIAAQGLMAKRGVQFLDYADTAEAAF----LEAGGGWASKSHHMRRLINIFLCMSQIGSNAVYILFVAQNIMPIVETHLTLNW----NYRLYIAVLLIPVILICSIKNLKYLSPCSILANILEFVGLGIIFYYIFATPIPSSDSVPWFTSP-EKFPIFFGTAIFAFEGISVVLPIENQMSKPKDMLGWNGVLNTSMVTIAALYIGMGFFGYLKYGADTAASITLNLPQ---GDILAQSALCMFSLAIFFSYALQFYVVMDIIGPNIIKPNVSDRMYPFVEWMTRVLLNVITLGMAATVPWLDLLVSLLGAIKMSTLSLMAPALVDSAAHWNSDSKPVFVYRCIKNIVIFTIGFLACIIGTYISTVEIVKKFQ 1777          
BLAST of EMLSAG00000004159 vs. C. finmarchicus
Match: gi|592862258|gb|GAXK01095304.1| (TSA: Calanus finmarchicus comp1395846_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 201.445 bits (511), Expect = 3.917e-58
Identity = 152/400 (38.00%), Postives = 237/400 (59.25%), Query Frame = 0
Query:   57 LAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMV-YTEIEXXXXXXXXXXXXXXXXXXXLCITQLGXXXXXXXXXXXNMKPILDNWIG-ETDVSIYTTXXXXXXXXXASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKP-VSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSID-GSVSESVAKANDGNXXXXXXXXXXXXXXXXXYPLQFFVPFEVIYKGLESKMR-PDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETFS 451
            L+MP A  NAG A+G  G A +AV+ I+ MHLL+  +  L  +    YL Y E  + +++ Y+             I    INIF+C TQLG +SVY +F++ ++K + +N +G +     Y  LL +P++ L  +RNL++L P    A    L+A+A  FY++F D  P V+ +     +S LPLFFGTA++TFEGI +VLP+E  MK    + G  GVLN  MV V+C Y+  GF+GYL +G++   G+V+ ++      N    +  VS+++++ L+YPLQF+V   +I   L      P+R +L+EY++R S+V +++  A L+P L +F++L GA+  S L+LIAPAII T T +   G  +I+L  N  I  FG+VG+ TGT +S+   ++ F 
Sbjct:   66 LSMPSALVNAGLAVGTAGLAVVAVITIHCMHLLVNATHVLTQRHNSVYLDYGEVVQLALLPYSR--------RLSNIGLKTINIFICTTQLGGNSVYVLFIATSLKQLCENLLGLDWSFYYYILLLWVPLVLLCLLRNLRLLAPVTVIATVCELYALAIVFYYIFRDPLPSVTSVPSTVSISKLPLFFGTAIFTFEGIGIVLPLENRMKNPAHLRGLSGVLNTGMVMVACLYIATGFYGYLKYGEAASIGAVTLNLPDELLAN----SARVSIASAIFLTYPLQFYVLISIIVPNLVVPYSAPERVILYEYILRVSIVTVSFLLASLVPYLNLFISLAGALCMSSLSLIAPAIIDTATNWEQIG--RIRLAKNGFIFVFGMVGTFTGTILSVGAIVKKFQ 1223          
BLAST of EMLSAG00000004159 vs. C. finmarchicus
Match: gi|592845583|gb|GAXK01111961.1| (TSA: Calanus finmarchicus comp53514_c6_seq1 transcribed RNA sequence)

HSP 1 Score: 163.696 bits (413), Expect = 5.549e-43
Identity = 111/276 (40.22%), Postives = 166/276 (60.14%), Query Frame = 0
Query:    7 LVSSEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEXXXXXXXXXXXXXXXXXXXLCITQLGXXXXXXXXXXXNMKPILDNWIGETDVSIYTTXXXXXXXXXASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVS 282
            ++ S+++     E  E  +D +         I+N  T +H+LKGN+GTGILAMP+A KN+G  +G  G  F+A +CI+ MH+L+  S +L  +    +L+Y++ A+     +      + + F    +T+I++FLCITQLGF  VYFVFVS N++ I +++ GE +  IY  ++L+P+L LASIRNLK L P    AN +    +   FY+L  DI    + K  A    LPL+FGTA+Y FEGI +VLP+E +MKT   M  +  VLN +M+ VS
Sbjct: 1112 IIPSDEESDLLSEDGEPETDNK---------ISNTDTIIHMLKGNIGTGILAMPDAIKNSGLVVGNIGLVFMATMCIHCMHILVNTSQELCRRTNLPFLTYSDVAETCFATSS---SPRLRAFSSTARTVIDVFLCITQLGFCCVYFVFVSQNLEQIFNHYYGEINYHIYMAIILIPMLLLASIRNLKYLSPISMLANILQFIGLGIIFYYLLQDIPYSWERKTFASWGQLPLYFGTAIYAFEGIGVVLPLENQMKTPADMKDWNVVLNTSMIIVS 1903          

HSP 2 Score: 87.0409 bits (214), Expect = 2.753e-17
Identity = 51/119 (42.86%), Postives = 75/119 (63.03%), Query Frame = 0
Query:  333 YPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFG-PFKIKLIVNMCILCFGVVGSITGTFVSILDAIETF 450
            Y LQF+VP +++   ++ ++ P   L  EY +RFSLV+LT+  A  IP L +F++LVGA+SSS LA++APAII T+T       P   K   N+ +   G  G ITG++VSI + I+ F
Sbjct:  332 YALQFYVPVDLLNPFIQRRIAPQNYLKAEYALRFSLVMLTFALAAAIPKLDLFISLVGAVSSSTLAMMAPAIIDTVTQGERCSWPRAFK---NLILFILGFFGFITGSYVSIRNIIKYF 679          
BLAST of EMLSAG00000004159 vs. C. finmarchicus
Match: gi|592943227|gb|GAXK01015326.1| (TSA: Calanus finmarchicus comp631523_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 153.68 bits (387), Expect = 7.373e-40
Identity = 135/413 (32.69%), Postives = 219/413 (53.03%), Query Frame = 0
Query:   46 HLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEXXXXXXXXXXXXXXXXXXXLCITQLGXXXXXXXXXXXNMKPILD-NWIGETDVSIYTTXXXXXXXXXASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPI----APLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNXXXXXXXXXXXXXXXXXYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFK--IKLIVNMCILCFGVVGSITGTFVSILDAIETF 450
            H++K  LG GIL +P AF  AG   G  G     ++ +   ++L   + KL      + + YA TA+ +     +E   +        K IIN FL + Q+G +SVY +FV+ N+ PI++ N+    +  +Y   L LPI+ + SIRNLK L P   FAN + L  +A  FYF+F    P+ +I+ +    +PL   P+FFGTA++ F GIA+VLP++ +M   + M G  G + I++V    FY+ MGF GY+ +G +   S+S ++     GN LA       + +V  SY LQF+V  ++I          DR  L  EY + F L +  +G A  IP + + ++L+  ++ S L+++ PA+I T   +      K  ++L+ N  I   G++  I G+++S+ D I+ F
Sbjct:  265 HIVKSYLGIGILTLPIAFTYAGIVGGSIGLLMTMLISVNCANVLANAAQKLVTARDIASMDYANTAEIAF----LEAGGRWANVSLHLKYIINSFLLLVQVGNNSVYILFVAQNLMPIVETNFNLGWNYKLYLAALFLPIILICSIRNLKYLSPLAIFANLLELVGLAFIFYFIFAT--PIDNIEKVPLFESPLK-FPIFFGTAMFAFGGIAVVLPVQNQMTKPEEMLGAKGAITISIVFCGVFYLAMGFCGYIKYGLNTQPSISLNLP---SGNRLAQTCQAMFALAVYFSYALQFYVVMDIIRHSFIKTYVCDRWSLCAEYAVMFLLNVFIFGLAATIPWMDLLVSLISCLTISTLSIMVPAMIDTALYWKTESGIKSGLRLVKNTLIFSAGLLAFIVGSYISLSDIIKKF 1473          
BLAST of EMLSAG00000004159 vs. C. finmarchicus
Match: gi|592876128|gb|GAXK01081449.1| (TSA: Calanus finmarchicus comp1098095_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 125.176 bits (313), Expect = 2.686e-30
Identity = 133/416 (31.97%), Postives = 214/416 (51.44%), Query Frame = 0
Query:   43 TFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEXXXXXXXXXXXXXXXXXXXLCITQLGXXXXXXXXXXXNMKPILDNWIGETDVSI------YTTXXXXXXXXXASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPL----SXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNXXXXXXXXXXXXXXXXXYPLQFFVPFEVIYKGL-ESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGP--FKIKLIVNMCILCFGVVGSITGTFVSILD 445
            + +HL+KG LG GI A+P AF NAG   G  G  FI  + I+ +++L   S KL       ++ YA+ A+ S     IE         +I + ++N F  ++Q+G ++VY +FV+ N+ P++     E ++S+      Y  +L +P + + SIR LK + P    AN + +  IA  FY +F    P+ D+  + PL    S LP+ FG   + F GI++VLP++ +M   K M G+FG LNI++ +     ++MG FGYL FG  I  S++ ++   +    L     V L+ +V LSY LQ++V  E+    L E  +     L  EY+ R  L +L  G A L+P + + + LV  ++   + +I P II T   +       F ++   N+ I   G    + G +VSILD
Sbjct:  118 SIIHLMKGYLGIGIFALPYAFNNAGLIGGILGVIFILGIIIHCVNMLSSASQKLIIINDLLFIDYADAAEISF----IEAGGNWAKSAEIVRHVLNFFRFLSQVGNNAVYIMFVAQNIMPMV-----EVNLSLGWNYRDYLLILCIPTILICSIRQLKYIAPLTIVANILQIGGIALVFYQIFSS--PLRDVGSV-PLFGQASSLPVCFGIIFFAFGGISVVLPIQNQMTNPKKMLGFFGTLNISISSCGILALVMGIFGYLKFGSDIKTSITLNLPIEDP---LTQCCQVMLALAVFLSYALQYYVVMEIAGPNLIEPFISRSLYLFTEYLFRAILNVLIIGLAALVPWMDLLITLVSCLTIIPIIVIIPTIIDTAVNWETDTRLVFYLRSAKNLAIFLIGASAMVLGAYVSILD 1320          
BLAST of EMLSAG00000004159 vs. L. salmonis peptides
Match: EMLSAP00000004159 (pep:novel supercontig:LSalAtl2s:LSalAtl2s21:158842:160854:-1 gene:EMLSAG00000004159 transcript:EMLSAT00000004159 description:"maker-LSalAtl2s21-augustus-gene-1.7")

HSP 1 Score: 900.968 bits (2327), Expect = 0.000e+0
Identity = 451/451 (100.00%), Postives = 451/451 (100.00%), Query Frame = 0
Query:    1 MSSTLDLVSSEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETFS 451
            MSSTLDLVSSEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETFS
Sbjct:    1 MSSTLDLVSSEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETFS 451          
BLAST of EMLSAG00000004159 vs. L. salmonis peptides
Match: EMLSAP00000001373 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1230:20904:23616:1 gene:EMLSAG00000001373 transcript:EMLSAT00000001373 description:"maker-LSalAtl2s1230-augustus-gene-0.23")

HSP 1 Score: 214.542 bits (545), Expect = 4.998e-64
Identity = 120/300 (40.00%), Postives = 174/300 (58.00%), Query Frame = 0
Query:  168 IGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPL------------------------SXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSI 443
            +G+  +  Y   LL+P   L S+RNLK L P   FAN +    +A +F+  F     +     I PL                          +PL+FGTA+Y FEGI +VLP+E +M+T + + G+ GVLN +M  VSC Y+ +GFFGYL  G+ +DG ++    K  +G  LA  I  S+  ++  SY LQF+VP + I   +   +  +R LL EYV+R++LVL T+  A  IP L + ++LVGA+SSS LAL+APAII T+T +P+ GP+KI+ + N+ I   G +G ITGT+VSI
Sbjct:  116 LGDIXILWYLATLLIPTCALCSVRNLKYLSPISMFANFLQFVGLALSFFIYFKTYLTIGMEITIFPLGMVLFNKLYLILFYSKLILFMYYRKQIPLYFGTAIYAFEGIGVVLPLENQMRTPQELRGWNGVLNTSMTIVSCLYIAVGFFGYLRXGNHLDGXIT---LKFPEGEWLAQIIFFSMCLAIFFSYALQFYVPLKTILPFVHKCVPEERHLLAEYVLRYTLVLFTFCCAAAIPQLDLLISLVGAVSSSTLALMAPAIIDTITFWPNMGPYKIRFLANLLIFSLGFIGFITGTYVSI 412          
BLAST of EMLSAG00000004159 vs. L. salmonis peptides
Match: EMLSAP00000004746 (pep:novel supercontig:LSalAtl2s:LSalAtl2s24:1444704:1447294:1 gene:EMLSAG00000004746 transcript:EMLSAT00000004746 description:"maker-LSalAtl2s24-augustus-gene-13.29")

HSP 1 Score: 93.2041 bits (230), Expect = 8.144e-21
Identity = 94/367 (25.61%), Postives = 159/367 (43.32%), Query Frame = 0
Query:   52 LGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKL---RDKVGKSYLSYAETAKES-----MVYTEIEFIR-KRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIK-PVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKT--RKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIH 406
            LG G+L +P AFK +G   G     F++++ +  M L+++    +   R +  +  L   E + E      ++  EI +       F    +  I+  L ++QLGF   Y +F+S      L ++      +    L+L P+ GL  I++L  L PF       N  A A  F+F F  +    +  +    LS  P FF  A+Y FEG  ++L +E  +    + +    F +  IA+VT    Y+  G  G LS+G      ++ ++   +     A  + V L  S+  +YP+  F   E++ K            +   +IR  +V +T     ++P     MAL+GA   + LA I PA  H
Sbjct:   29 LGAGVLGLPYAFKESGLLEGAIVMTFVSIISVKAMLLIVDXKYLILAGRKRAQELPLLKNEDSVEDGLIKEVINDEISYSDVGDAAFGHAGRLTIDTALLVSQLGFCCAYLIFIS----ETLSSYFTVISKTQCLFLMLPPLFGLTLIKDLSQLAPFSLIGQIFNFLAFAVVFWFDFDHLHLAANQHRKEFSLSGFPFFFAVAIYCFEGAGMILSLENSVDDGYKPNFKKTF-IKTIAVVTF--IYISFGASGXLSYGHETKDIITLNLPHVDGTIDFATLVKVCLCFSLFCTYPVMIFPVSELLEKKFLVSSS--SSPVSGLLIRGGIVTMTGVVVKVVPRFADLMALIGASCCTLLAFIIPASCH 386          
BLAST of EMLSAG00000004159 vs. L. salmonis peptides
Match: EMLSAP00000011924 (pep:novel supercontig:LSalAtl2s:LSalAtl2s841:55690:57081:-1 gene:EMLSAG00000011924 transcript:EMLSAT00000011924 description:"augustus_masked-LSalAtl2s841-processed-gene-0.7")

HSP 1 Score: 56.9954 bits (136), Expect = 4.455e-9
Identity = 94/425 (22.12%), Postives = 168/425 (39.53%), Query Frame = 0
Query:    1 MSSTLDLVSSEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGY----ALGGGGTAFIAVVCIYGMHLLLEC--SAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFY-FLFLDIKPVSDIKPIAPLSXL--PLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVI----YKGLESKMRP-----DRKL-LWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIH 406
            + S+ D V     E  +G+  ++    + ++ KK   I       ++     G  I+++P    + GY    A+ G     IA +C +   +L+EC      R ++ K   SY E A+E              F  K    IIN    I  L    +Y V     +        G  D   Y  +  L +L  A ++NL  +   ++F N I    I      +    I      K    +  L  P+  G  ++++     +  +E  M  +     +  +LN + V  + F  L G+ G+L++ +     V  ++        L   +++ L     LSYPL ++   E++    ++G  + + P     D  L +W    R  ++ +T  FAV+IP   I M  +G+ +  FL+ I P+I H
Sbjct:   21 LKSSADDVKRFAREK-TGKKDDDDPTGKMEEYKKTGKITEWEAAWNVTNAIQGMFIVSLPYGVYHGGYWAILAMVG-----IAHICCHTGKILVECLYEPDERGELVKVRFSYNEIAQEC-------------FGKKYGGKIINAAQLIELLMTCILYVVLCGDLLIGAFPK--GSIDTRSYMMICGLLLLPCAFLKNLTHVS-HLSFWNGIVHTVINIVILGYCLTRIGSWGWSKVTMEIDILSFPIALGVIVFSYTSQIFLPTLEGNMIDKSK---FECMLNWSHVAAAIFKGLFGYIGFLTWQEDTQEEVVNNLEPT-----LKTLVNIILVVKALLSYPLPYYAACEMLEKELFQGKPATVFPTIWALDGDLKVWGLAFRVIVICVTIVFAVVIPHFTILMGFIGSFTGCFLSFIWPSIFH 415          
BLAST of EMLSAG00000004159 vs. SwissProt
Match: gi|74871976|sp|Q9W056.1|C1139_DROME (RecName: Full=Proton-coupled amino acid transporter-like protein CG1139)

HSP 1 Score: 241.891 bits (616), Expect = 8.288e-74
Identity = 152/435 (34.94%), Postives = 246/435 (56.55%), Query Frame = 0
Query:   23 NGS----DTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIY-KGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPD-FGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETFS 451
            NGS    D    +  K P  N   TF H LK ++GTG+LAMP AF +AGY  G   T  I  + +Y +H+L++C   L  +    Y+S+++     +      ++R       I    ++ FL     G   VY VF++ ++K ++D ++   DV I+  ++++P+L + SI+NLK+L PF + AN + L       Y++F ++ P+S+  P      LP FFGT L+  E + ++L +E+ M T KS  G  G+LN  M  V   YVL+GFFGY  +G+  +GS++ ++ ++    I A  + V  + +  +SY LQ +V   +++ K L  + +  R+  +E + R  +VLLT+G AV IPDL +F++LVG+   S L LI P ++     Y + +GPF+IKLI+N+ +LCFG+ G + GT+VSILD I  + 
Sbjct:   25 NGSNDDYDPHQHRELKNPTTNFQ-TFAHFLKASVGTGVLAMPSAFAHAGYVNGTLLTLIIGSLALYCLHILIKCMYILCKRQRVPYVSFSQAMNLGLKQGP-PWLRC---LAPIAVPFVDGFLAFYHFGICCVYVVFIAESIKQLVDEYLVVWDVRIHMCIIIVPLLLIYSIKNLKLLAPFSSAANLLLLVGFGIILYYIFEELPPLSERDPFVAAGKLPTFFGTVLFALEAVGVILAIEENMATPKSFVGPCGILNSGMSIVLGLYVLLGFFGYWKYGNESEGSITLNIPQS---EIPAQVVKVFFAITTWISYALQGYVTAHILWDKYLAKRFKETRQTFYELIFRAIIVLLTFGCAVAIPDLSVFLSLVGSFCLSILGLIFPVLLQICVQYTEGYGPFRIKLIINLLLLCFGIFGGVVGTYVSILDIIAVYK 451          
BLAST of EMLSAG00000004159 vs. SwissProt
Match: gi|123904452|sp|Q4KL91.1|S36A4_XENLA (RecName: Full=Proton-coupled amino acid transporter 4; Short=Proton/amino acid transporter 4; AltName: Full=Solute carrier family 36 member 4)

HSP 1 Score: 226.868 bits (577), Expect = 2.208e-67
Identity = 153/469 (32.62%), Postives = 257/469 (54.80%), Query Frame = 0
Query:    9 SSEKDEHHSGESFENGSDTQG-----KKVKKAPLINNP------VTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPI----LDNWIGETDVSIYTT----------LLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPL----SXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPD-FGPFKIKLIVNMCILCFGVVGSITGTFVSILDAI 447
             ++KDE       EN  D+ G     + +++ P ++N        T +HLLKGN+GTG+L +P A KNAG  LG     F  ++ I+ M++L+ CS  L  +  K+ L Y++T   ++        R   F     + +++ FL +TQLGF SVYFVF++ N+K +    L+  + ++++ I++            L++P++ +  ++NL +L  F   + AI+L  +          I+ +SD + + PL       PLFFGTA++ FEGI +VLP+E  M+ +K    +   LNI M  V+  Y+ +   GY  FGD I GS++ ++ +    + L   + +  S  + ++Y +Q++VP E+I   + S+++  RKLL E+ +RF LV LT   AVLIP L + ++ VGA+SSS LALI P ++  +T + +   P+ I   V + ++  G VG I GT+V+I + I
Sbjct:   47 DNKKDEEVMKPLIENEDDSDGTCDEHQYLQRHPDLDNKDGLTFFQTLIHLLKGNIGTGLLGLPLAMKNAGVLLGPISLLFFGIISIHCMNILVRCSHFLCQRYKKANLGYSDTVGLALEVGPGVLQRHASFG----RNLVDWFLVVTQLGFCSVYFVFLAENIKQVFEVFLETKLQQSEIGIWSLDLRIYMFSFLPLIIPLVFIRDLKNLSLLSFFANVSMAISLLIVYQYV------IRNLSDPRTL-PLGTSWKTYPLFFGTAIFAFEGIGVVLPLENRMRDKKD---FSKALNIGMAIVTTLYISLATLGYFCFGDQIKGSITLNLPQ---DSWLYQLVKILYSFGIYVTYAIQYYVPAEIILPAVTSRVQKTRKLLCEFTMRFFLVCLTCAVAVLIPRLDLVISFVGAVSSSTLALILPPLVEIITYHKENLSPWVIMKDVGIAVI--GFVGFIAGTYVTIEEMI 496          
BLAST of EMLSAG00000004159 vs. SwissProt
Match: gi|81871266|sp|Q8CH36.1|S36A4_MOUSE (RecName: Full=Proton-coupled amino acid transporter 4; Short=Proton/amino acid transporter 4; AltName: Full=Solute carrier family 36 member 4)

HSP 1 Score: 217.238 bits (552), Expect = 6.696e-64
Identity = 142/424 (33.49%), Postives = 233/424 (54.95%), Query Frame = 0
Query:   43 TFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGET------------------DVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIV-NMCILCFGVVGSITGTFVSILDAI 447
            T +HLLKGN+GTG+L +P A KNAG  LG     FI ++ ++ MH+L+ CS  L  +  KS L Y++T   +M  +    ++++  +    + +++ FL ITQLGF SVY VF++ N+K + + ++G T                  D+ +Y    L  I+ L  IR LK L      AN     ++   + ++  ++    ++  +A     PLFFGTA++ FEGI +VLP+E +M+  K    +   LNI M  V+  Y+ +   GY+ F D I GS++ ++ +      L  ++ +  S  + ++Y +QF+VP E+I  G+ +++    K + E+ IR  LV +T   A+LIP L I ++ VGA+SSS LALI P ++  LT   D   + I +I+ N+ I   GVVG + GT+V++ + I
Sbjct:   61 TLVHLLKGNIGTGLLGLPLAIKNAGIVLGPISLVFIGIISVHCMHILVRCSHFLCQRFKKSTLGYSDTVSFAMEASPWSCLQRQAAWG---RQVVDFFLVITQLGFCSVYIVFLAENVKQVHEGFLGSTPIVSNGSDLSHACERRSVDLRVYMLCFLPLIILLVFIRELKNLFVLSFLANISMAASLVIIYQYVVRNMPDPHNLPIVAGWKKYPLFFGTAVFAFEGIGVVLPLENQMRESKR---FPQALNIGMAIVTVLYISLATLGYMCFRDEIKGSITLNLPQ---DMWLYQSVKILYSFGIFVTYSIQFYVPAEIIIPGVTARLHAKWKRICEFGIRSLLVSITRAGAILIPRLDIVISFVGAVSSSTLALILPPLVEILTFSKDH--YNIWMILKNISIAFTGVVGFLLGTYVTVEEII 473          
BLAST of EMLSAG00000004159 vs. SwissProt
Match: gi|74749514|sp|Q6YBV0.1|S36A4_HUMAN (RecName: Full=Proton-coupled amino acid transporter 4; Short=Proton/amino acid transporter 4; AltName: Full=Solute carrier family 36 member 4)

HSP 1 Score: 214.927 bits (546), Expect = 5.759e-63
Identity = 149/454 (32.82%), Postives = 238/454 (52.42%), Query Frame = 0
Query:   13 DEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWI------------------GETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIV-NMCILCFGVVGSITGTFVSILDAI 447
            DE H  E        Q    +    +    T MHLLKGN+GTG+L +P A KNAG  LG     FI ++ ++ MH+L+ CS  L  +  KS L Y++T   +M  +    ++K+  +    +++++ FL ITQLGF SVY VF++ N+K + + ++                     D+ IY    L  I+ L  IR LK L      AN     ++   + ++  ++    ++  +A     PLFFGTA++ FEGI +VLP+E +MK  K    +   LNI M  V+  YV +   GY+ F D I GS++ ++ +      L  ++ +  S  + ++Y +QF+VP E+I  G+ SK     K + E+ IR  LV +T   A+LIP L I ++ VGA+SSS LALI P ++  LT   +   + I +++ N+ I   GVVG + GT++++ + I
Sbjct:   37 DEEHEQELLPVQKHYQLDDQEGISFVQ---TLMHLLKGNIGTGLLGLPLAIKNAGIVLGPISLVFIGIISVHCMHILVRCSHFLCLRFKKSTLGYSDTVSFAMEVSPWSCLQKQAAWG---RSVVDFFLVITQLGFCSVYIVFLAENVKQVHEGFLESKVFISNSTNSSNPCERRSVDLRIYMLCFLPFIILLVFIRELKNLFVLSFLANVSMAVSLVIIYQYVVRNMPDPHNLPIVAGWKKYPLFFGTAVFAFEGIGVVLPLENQMKESKR---FPQALNIGMGIVTTLYVTLATLGYMCFHDEIKGSITLNLPQ---DVWLYQSVKILYSFGIFVTYSIQFYVPAEIIIPGITSKFHTKWKQICEFGIRSFLVSITCAGAILIPRLDIVISFVGAVSSSTLALILPPLVEILTFSKEH--YNIWMVLKNISIAFTGVVGFLLGTYITVEEII 476          
BLAST of EMLSAG00000004159 vs. SwissProt
Match: gi|51316800|sp|Q7Z2H8.1|S36A1_HUMAN (RecName: Full=Proton-coupled amino acid transporter 1; Short=Proton/amino acid transporter 1; Short=hPAT1; AltName: Full=Solute carrier family 36 member 1)

HSP 1 Score: 210.305 bits (534), Expect = 1.535e-61
Identity = 136/421 (32.30%), Postives = 227/421 (53.92%), Query Frame = 0
Query:   43 TFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETD-VSIYTTLLLLPILG--------------LASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIE 448
            T +HLLKGN+GTG+L +P A KNAG  +G      I +V ++ M +L++C+     ++ KS++ Y +T    +  +   ++R    + +    +++ FL +TQLGF  VYFVF++ N K +++   G T+      T++L P +               L  IRNL+ L  F   AN   L ++   + F+   I   S +  +AP    PLFFGTA+++FEGI +VLP+E +MK  +    +  +L + MV V+  Y+ +G  GYL FG +I GS++ ++        L  ++ +  S  +  +Y LQF+VP E+I     S+     +L+ +  +R  LV LT   A+LIP L + ++LVG++SSS LALI P ++   T Y + G   + +  +  I   G VG + GT+ ++ + I+
Sbjct:   52 TLIHLLKGNIGTGLLGLPLAVKNAGIVMGPISLLIIGIVAVHCMGILVKCAHHFCRRLNKSFVDYGDTVMYGLESSPCSWLRNHAHWGR---RVVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTNNCHNNETVILTPTMDSRLYMLSFLPFLVLLVFIRNLRALSIFSLLANITMLVSLVMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLENKMKDPRK---FPLILYLGMVIVTILYISLGCLGYLQFGANIQGSITLNLPNC----WLYQSVKLLYSIGIFFTYALQFYVPAEIIIPFFVSRAPEHCELVVDLFVRTVLVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLEVTTFYSE-GMSPLTIFKDALISILGFVGFVVGTYEALYELIQ 461          
BLAST of EMLSAG00000004159 vs. SwissProt
Match: gi|51316868|sp|Q8K4D3.1|S36A1_MOUSE (RecName: Full=Proton-coupled amino acid transporter 1; Short=Proton/amino acid transporter 1; AltName: Full=Solute carrier family 36 member 1)

HSP 1 Score: 201.06 bits (510), Expect = 5.346e-58
Identity = 137/422 (32.46%), Postives = 228/422 (54.03%), Query Frame = 0
Query:   43 TFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIG---------------ETDVSIYTTLLLLPILGLAS-IRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIE 448
            T +HLLKGN+GTG+L +P A KNAG  LG      I +V ++ M +L++C+  L  ++ K +L Y +T    +  +   ++R    + +    I++ FL +TQLGF  VYFVF++ N K +++   G                 D  +Y  L  LP L L S IRNL++L  F   AN     ++   + F+   I   S +  +AP    PLFFGTA++ FEGI +VLP+E +MK  +    +  +L + M  ++  Y+ +G  GYL FG +I GS++ ++        L  ++ +  S  +  +Y LQF+V  E+I   + S++    +L+ +  +R ++V +T   A+LIP L + ++LVG++SSS LALI P ++  +T Y + G   + +  +  I   G VG + GT+ S+ + I+
Sbjct:   51 TLIHLLKGNIGTGLLGLPLAVKNAGLLLGPLSLLVIGIVAVHCMGILVKCAHHLCRRLNKPFLDYGDTVMYGLECSPSTWVRNHSHWGR---RIVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTTNCNNNVTVIPTPTMDSRLYM-LSFLPFLVLLSFIRNLRVLSIFSLLANISMFVSLIMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFAFEGIGVVLPLENKMKDSQK---FPLILYLGMAIITVLYISLGSLGYLQFGANIKGSITLNLPNC----WLYQSVKLLYSIGIFFTYALQFYVAAEIIIPAIVSRVPEHFELMVDLCVRTAMVCVTCVLAILIPRLDLVISLVGSVSSSALALIIPPLLEVVTYYGE-GISPLTVTKDALISILGFVGFVVGTYESLCELIQ 460          
BLAST of EMLSAG00000004159 vs. SwissProt
Match: gi|51316558|sp|Q924A5.1|S36A1_RAT (RecName: Full=Proton-coupled amino acid transporter 1; Short=Proton/amino acid transporter 1; AltName: Full=Lysosomal amino acid transporter 1; Short=LYAAT-1; AltName: Full=Neutral amino acid/proton symporter; AltName: Full=Solute carrier family 36 member 1)

HSP 1 Score: 197.208 bits (500), Expect = 1.343e-56
Identity = 148/458 (32.31%), Postives = 240/458 (52.40%), Query Frame = 0
Query:    8 VSSEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDN---------------WIGETDVSIYTTLLLLPILGLAS-IRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIE 448
            VS E+       SF  GS    +++ +   +    T +HLLKGN+GTG+L +P A KNAG  LG      I +V ++ M +L++C+  L  ++ K +L Y +T    +  +   +IR    + +    I++ FL +TQLGF  VYFVF++ N K +++                     D  +Y  L  LP L L S IRNL+IL  F   AN     ++   + F+   I   S +  +AP    PLFFGTA++ FEGI +VLP+E +MK  +    +  +L + M  ++  Y+ +G  GYL FG  I GS++ ++        L  ++ +  S  +  +Y LQF+V  E+I   + S++ P+R +L+ +   R ++V +T   AVLIP L + ++LVG++SSS LALI P ++   T Y + G   + +  +  I   G VG + GT+ S+ + I+
Sbjct:   19 VSPEESPSEGLGSFSPGSY---QRLGENSSMTWFQTLIHLLKGNIGTGLLGLPLAVKNAGLLLGPLSLLVIGIVAVHCMGILVKCAHHLCRRLNKPFLDYGDTVMYGLECSPSTWIRNHSHWGR---RIVDFFLVVTQLGFCCVYFVFLADNFKQVIEAANGTTTNCNNNETVILTPTMDSRLYM-LTFLPFLVLLSFIRNLRILSIFSLLANISMFVSLIMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFAFEGIGVVLPLENKMKDSQK---FPLILYLGMAIITVLYISLGSLGYLQFGADIKGSITLNLPNC----WLYQSVKLLYSIGIFFTYALQFYVAAEIIIPAIVSRV-PERFELVVDLSARTAMVCVTCVLAVLIPRLDLVISLVGSVSSSALALIIPPLLEVTTYYGE-GISPLTITKDALISILGFVGFVVGTYESLWELIQ 460          
BLAST of EMLSAG00000004159 vs. SwissProt
Match: gi|121943282|sp|Q495M3.1|S36A2_HUMAN (RecName: Full=Proton-coupled amino acid transporter 2; Short=Proton/amino acid transporter 2; AltName: Full=Solute carrier family 36 member 2; AltName: Full=Tramdorin-1)

HSP 1 Score: 196.823 bits (499), Expect = 2.075e-56
Identity = 138/464 (29.74%), Postives = 239/464 (51.51%), Query Frame = 0
Query:    5 LDLVS---SEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYT--TLLLLPILG--------------LASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIET 449
            LDL+S   S K   +   +F + S ++   +KK   I      +HL+KGN+GTGIL +P A KNAG  +G      +  +  + MH+L++C+ +   ++ K ++ Y +T    +      +++    +    + I++ FL ITQLGF  VY VF++ N+K +++  +  T  + Y+  T++L P +               L  IRNL+IL  F   AN   L ++     ++  +I   S +  +A     PLFFGTA+++FE I +VLP+E +MK  +    +  +L++ M  V+  Y+ M   GYL FGD I  S+S ++        L  ++ +     +  +Y LQF+VP E+I     S++     L  +  IR  +V LT   A+LIP L + ++LVG++S + LALI P ++   T Y + G   + +  +  I   G VG + GT+ ++ + +++
Sbjct:   18 LDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGFIACHCMHILVKCAQRFCKRLNKPFMDYGDTVMHGLEANPNAWLQNHAHWG---RHIVSFFLIITQLGFCCVYIVFLADNLKQVVEA-VNSTTNNCYSNETVILTPTMDSRLYMLSFLPFLVLLVLIRNLRILTIFSMLANISMLVSLVIIIQYITQEIPDPSRLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKNARH---FPAILSLGMSIVTSLYIGMAALGYLRFGDDIKASISLNLPNC----WLYQSVKLLYIAGILCTYALQFYVPAEIIIPFAISRVSTRWALPLDLSIRLVMVCLTCLLAILIPRLDLVISLVGSVSGTALALIIPPLLEVTTFYSE-GMSPLTIFKDALISILGFVGFVVGTYQALDELLKS 469          
BLAST of EMLSAG00000004159 vs. SwissProt
Match: gi|74870787|sp|Q9VT04.1|PATH_DROME (RecName: Full=Proton-coupled amino acid transporter-like protein pathetic)

HSP 1 Score: 193.356 bits (490), Expect = 4.251e-55
Identity = 143/448 (31.92%), Postives = 227/448 (50.67%), Query Frame = 0
Query:    9 SSEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKF---FPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGET-DVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPD-FGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETFS 451
             S+ ++  +G  F    D    +    P  +N  T  HLLK +LGTGIL MP AF  +G  +G   T F A +C +  ++L++C  KL  +  ++ +++AE A       E  F +  K+   F  + K  I   L +T  G  SVY V V+ N + ++  W G    + +   ++L+P++ +A + NLK L P    AN      +  TFY+L  D+ PV + + +   S LP FF   ++  E I +V+P+E  MKT +S  G  GVL+  M  V+  Y+L+GF GYL +G +   S++ ++         A  + V +S +V  ++ LQFFV  E+I+ G++ K +  R  L  YV+R  LV      AV +P +G FM L+GA   S L LI P +I  +  +   FG +   L  N  I   G+   + GT  +I D ++ +S
Sbjct:   34 KSDTEQALAGNDF----DPFALRDNPHPTTDNE-TLTHLLKASLGTGILGMPFAFMCSGLIMGIFSTIFTAFICTHCSYVLVKCGHKLYYRTRRTKMTFAEIA-------EAAFQKGPKWCRGFAPVAKFSILFGLFLTYFGTCSVYTVIVASNFEQLISYWTGTAVSLRMLICIMLVPLILIAWVPNLKYLAPVSMVANVFMGLGLGITFYYLVQDLPPVEERESVV-WSTLPQFFSITIFAMEAIGVVMPLENNMKTPQSFLGICGVLSQGMSGVTLIYMLLGFLGYLRYGSATGESITLNLPIE---EWPAQTVKVLISLAVYCTFGLQFFVCLEIIWDGIKEKCK-KRPTLVNYVLRTVLVTAAVVLAVAVPTIGPFMGLIGAFCFSILGLIFPVVIELIVHWESGFGKYNWILWKNAIITLCGIGALVFGTQAAIKDIVKAYS 464          
BLAST of EMLSAG00000004159 vs. SwissProt
Match: gi|81873793|sp|Q8BHK3.1|S36A2_MOUSE (RecName: Full=Proton-coupled amino acid transporter 2; Short=Proton/amino acid transporter 2; AltName: Full=Solute carrier family 36 member 2; AltName: Full=Tramdorin-1)

HSP 1 Score: 191.045 bits (484), Expect = 2.847e-54
Identity = 140/462 (30.30%), Postives = 243/462 (52.60%), Query Frame = 0
Query:    4 TLDLVSSEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTT---------------LLLLPILGLAS-IRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIET 449
             LDL  S K       S  NGS ++  K  K   I    T +HL+KGN+GTGIL +P A KNAG  +G      + ++  + MH+L+ C+ +   ++ K ++ Y +T    + ++   +++    +    + +++ FL +TQLGF  VY VF++ N+K +++  +  T +S +                 L  LP+LGL   +RNL++L  F   AN   L ++     ++  +I   S +  +A     PLFFGTA+++FE I +VLP+E +MK  +   G+  +L++ M  ++  Y+ +G  GYL FGD I  S++ ++        L  ++ +     +  +Y LQF+VP E+I     S++     L  +  IR +LV LT   A+LIP L + ++LVG++SSS LALI P ++  +T Y + G   + +  +  I   G +G + GT+ ++ + I++
Sbjct:   17 NLDLPESAKKLQSQDPSPANGSSSESSKKTKG--ITGFQTLVHLVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGLIACHCMHILVRCAQRFCHRLNKPFMDYGDTVMHGLAFSPNAWLQNHAHWG---RRVVSFFLIVTQLGFCCVYIVFLADNLKQVVEA-VNSTTISCHKNETVVLTPTMDSRLYMLSFLPVLGLLVFVRNLRVLTIFSLLANISMLVSLVIIAQYIIQEIPDASQLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKDAR---GFPTILSLGMSIITTLYIAIGALGYLRFGDDIKASITLNLPNC----WLYQSVKLLYVVGILCTYALQFYVPAEIIIPLAVSQVSKRWALPVDLSIRLALVCLTCMLAILIPRLDLVLSLVGSVSSSALALIIPPLLEVVTYYGE-GISPLTVTKDALISILGFMGFVVGTYQALDELIKS 464          
BLAST of EMLSAG00000004159 vs. Select Arthropod Genomes
Match: gb|KYB28192.1| (Proton-coupled amino acid transporter 4 -like protein [Tribolium castaneum])

HSP 1 Score: 306.605 bits (784), Expect = 6.365e-99
Identity = 176/448 (39.29%), Postives = 278/448 (62.05%), Query Frame = 0
Query:    4 TLDLVSSEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGD-SIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPD-FGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIE 448
            +LDL S+      SGE F     T  +K++     +N  T +HLLKGN+GTGILAMP+AF+NAG+ +G  GT F+  +C + MH+L+ C+ +L  +  K  LS+ E   E+   T  + +++   F +I KT+IN+FLCITQLGF  VYFVFV+ N+  ++ ++  +  V  Y  +LL+P++ L  +++LK L P   FA+ +    +  TF+++  D+   S ++  +  S LPL+FGTA+Y FEGI ++LP+E  MK+ +  GG+ GVLN  MV V+  Y  +GFFGYL +GD ++ GSV+  +       +LA ++ + ++ ++ LSY LQF+VPF +++  ++     D+ K L E+  R  LV +T+  A+ IP+LG  ++LVGA SSS LALI P +I  +T +PD  G     L  ++ I+ FG VG I G++VS+L+ ++
Sbjct:   43 SLDLDSA------SGEDFSE-DPTLNRKLEHP--TSNFDTMIHLLKGNIGTGILAMPDAFRNAGWVVGLFGTMFMGFICTHCMHMLVACAHELCRRTQKPALSFDEVV-ENAFKTGPQPLQR---FSQIAKTLINLFLCITQLGFCCVYFVFVAANLHDVIKHYFFDISVHWYLVILLIPMVLLNFVKSLKYLTPASLFASILTCSGLVITFFYMLQDLPDTSTVQAFSSWSQLPLYFGTAIYAFEGIGVILPLENNMKSPQDFGGWTGVLNTGMVIVATLYTAVGFFGYLKYGDQAVLGSVTLLLPP---NELLAQSVRLMMAVAIFLSYSLQFYVPFNIVWPWVKDYFHSDKSKRLAEHATRTILVFVTFALAIAIPNLGAVISLVGAFSSSALALIFPPLIEIITFWPDKLGKNNWILWKDLAIVLFGFVGFIIGSYVSLLNILQ 474          
BLAST of EMLSAG00000004159 vs. Select Arthropod Genomes
Match: EAA12852.4 (AGAP008490-PA, partial [Anopheles gambiae str. PEST])

HSP 1 Score: 298.516 bits (763), Expect = 2.568e-95
Identity = 170/444 (38.29%), Postives = 270/444 (60.81%), Query Frame = 0
Query:    2 SSTLDLVSSEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPD-FGPFKIKLIVNMCILCFGVVGSITGTFVSI 443
            S+  D + S++D  +   S E    +  + ++      N  T +HLLKGN+GTGILAMP+AFK+AG  +G  GT F+  VC + MH+L+ CS +L  ++    LS+A+  + +     I   R    + K+   +IN+FL ITQLGF  VYFVFV+ N++ ++ ++  +    IY  LLL+P++ L  ++NLK L P    A  + +  ++ TFY++  D+     +KP +  + LPL+FGTA+Y FEGI +VLP+E  MKT +  GG+ GVLN  MV V+C Y  +GFFGYL +GDS+ GS++ ++        +A  + + ++ ++  SY LQFFVP  ++   +  ++  ++ +L+ EY+ R SLV+ T+  A +IP+LG  ++LVGA+SSS LALI P +I  +T +PD  G     L  ++ I+ FG++G I GT+ S+
Sbjct:   64 SNDTDSLVSKEDPTYGSSSGEPYEPSMHRTLEHP--TTNLDTMIHLLKGNIGTGILAMPDAFKHAGLYVGLFGTLFMGAVCTHCMHMLVNCSHELCRRLQVPSLSFADVCQRAFESGPIGLRR----YSKLATNLINMFLVITQLGFCCVYFVFVAANLREVIAHYFFDLHTRIYLLLLLIPMVLLNLVKNLKYLTPISLIAALLTVTGLSCTFYYMLQDLPNTHTVKPYSSWAQLPLYFGTAIYAFEGIGMVLPLENNMKTPEDFGGWSGVLNTGMVIVACLYTAVGFFGYLKYGDSVKGSITLNLP---GDEFIAQLVRIMMALAIFFSYSLQFFVPMSILNPHIRRRLHTEQSRLIGEYLARVSLVVFTFILAAMIPNLGAVISLVGAVSSSTLALIFPPLIEIVTFWPDKLGRHYWVLWKDIAIMVFGILGFIFGTYTSV 498          
BLAST of EMLSAG00000004159 vs. Select Arthropod Genomes
Match: ADV36977.1 (uncharacterized protein Dmel_CG13384, isoform L [Drosophila melanogaster])

HSP 1 Score: 292.738 bits (748), Expect = 1.755e-93
Identity = 169/439 (38.50%), Postives = 266/439 (60.59%), Query Frame = 0
Query:    7 LVSSEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYP-DFGPFKIKLIVNMCILCFGVVGSITGTFVSI 443
            L +S   +   G + ++ + T  + ++     +N  T +HLLKGN+GTGILAMP+AFKNAG  +G  GT  +  +C + MH+L+ CS +L  +  +  L ++E A  S     +   R    +  + + I+  FL ITQ+GF  VYF+FV++N+K ++D++  +  V IY  ++L P++ L  +RNLK L P    A  + +  +A TF ++ +D+  V  +KP+A  + LPL+FGTA+Y FEGI +VLP+E  M+T +  GG  GVLN  MV V+C Y  +GFFGYL +G+ ++GS++ ++ +   G+ L+  + +S++ ++ LSY LQF+VP  ++   + S     R K L   V+R  LV  T+  A  IP+LG  ++LVGA+SSS LALIAP II  +T Y   +G F   L  ++ IL FG+ G + GT+ S+
Sbjct:   45 LAASGSGDDEIGSTDKSYNPTHHRDLEHP--TSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMGAICTHCMHMLVNCSHELCRRFQQPSLDFSEVAYCSFESGPLGLRR----YSMLARRIVTTFLFITQIGFCCVYFLFVALNIKDVMDHYY-KMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPDVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQ---GDTLSQLVRISMAVAIFLSYTLQFYVPVNIVEPFVRSHFDTTRAKDLSATVLRVVLVTFTFLLATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNWMLWKDVLILIFGLCGFVFGTWASL 473          
BLAST of EMLSAG00000004159 vs. Select Arthropod Genomes
Match: ADV36976.1 (uncharacterized protein Dmel_CG13384, isoform K [Drosophila melanogaster])

HSP 1 Score: 292.738 bits (748), Expect = 1.755e-93
Identity = 169/439 (38.50%), Postives = 266/439 (60.59%), Query Frame = 0
Query:    7 LVSSEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYP-DFGPFKIKLIVNMCILCFGVVGSITGTFVSI 443
            L +S   +   G + ++ + T  + ++     +N  T +HLLKGN+GTGILAMP+AFKNAG  +G  GT  +  +C + MH+L+ CS +L  +  +  L ++E A  S     +   R    +  + + I+  FL ITQ+GF  VYF+FV++N+K ++D++  +  V IY  ++L P++ L  +RNLK L P    A  + +  +A TF ++ +D+  V  +KP+A  + LPL+FGTA+Y FEGI +VLP+E  M+T +  GG  GVLN  MV V+C Y  +GFFGYL +G+ ++GS++ ++ +   G+ L+  + +S++ ++ LSY LQF+VP  ++   + S     R K L   V+R  LV  T+  A  IP+LG  ++LVGA+SSS LALIAP II  +T Y   +G F   L  ++ IL FG+ G + GT+ S+
Sbjct:   45 LAASGSGDDEIGSTDKSYNPTHHRDLEHP--TSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMGAICTHCMHMLVNCSHELCRRFQQPSLDFSEVAYCSFESGPLGLRR----YSMLARRIVTTFLFITQIGFCCVYFLFVALNIKDVMDHYY-KMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPDVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQ---GDTLSQLVRISMAVAIFLSYTLQFYVPVNIVEPFVRSHFDTTRAKDLSATVLRVVLVTFTFLLATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNWMLWKDVLILIFGLCGFVFGTWASL 473          
BLAST of EMLSAG00000004159 vs. Select Arthropod Genomes
Match: AAS64738.1 (uncharacterized protein Dmel_CG13384, isoform G [Drosophila melanogaster])

HSP 1 Score: 292.738 bits (748), Expect = 1.755e-93
Identity = 169/439 (38.50%), Postives = 266/439 (60.59%), Query Frame = 0
Query:    7 LVSSEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYP-DFGPFKIKLIVNMCILCFGVVGSITGTFVSI 443
            L +S   +   G + ++ + T  + ++     +N  T +HLLKGN+GTGILAMP+AFKNAG  +G  GT  +  +C + MH+L+ CS +L  +  +  L ++E A  S     +   R    +  + + I+  FL ITQ+GF  VYF+FV++N+K ++D++  +  V IY  ++L P++ L  +RNLK L P    A  + +  +A TF ++ +D+  V  +KP+A  + LPL+FGTA+Y FEGI +VLP+E  M+T +  GG  GVLN  MV V+C Y  +GFFGYL +G+ ++GS++ ++ +   G+ L+  + +S++ ++ LSY LQF+VP  ++   + S     R K L   V+R  LV  T+  A  IP+LG  ++LVGA+SSS LALIAP II  +T Y   +G F   L  ++ IL FG+ G + GT+ S+
Sbjct:   45 LAASGSGDDEIGSTDKSYNPTHHRDLEHP--TSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMGAICTHCMHMLVNCSHELCRRFQQPSLDFSEVAYCSFESGPLGLRR----YSMLARRIVTTFLFITQIGFCCVYFLFVALNIKDVMDHYY-KMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPDVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQ---GDTLSQLVRISMAVAIFLSYTLQFYVPVNIVEPFVRSHFDTTRAKDLSATVLRVVLVTFTFLLATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNWMLWKDVLILIFGLCGFVFGTWASL 473          
BLAST of EMLSAG00000004159 vs. Select Arthropod Genomes
Match: ADV36974.1 (uncharacterized protein Dmel_CG13384, isoform I [Drosophila melanogaster])

HSP 1 Score: 292.352 bits (747), Expect = 2.440e-93
Identity = 170/443 (38.37%), Postives = 261/443 (58.92%), Query Frame = 0
Query:   16 HSGESFENGSDTQGKKVKKAPLINNPV-------------TFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYP-DFGPFKIKLIVNMCILCFGVVGSITGTFVSI 443
            HS +S    S +   ++       NP              T +HLLKGN+GTGILAMP+AFKNAG  +G  GT  +  +C + MH+L+ CS +L  +  +  L ++E A  S     +   R    +  + + I+  FL ITQ+GF  VYF+FV++N+K ++D++  +  V IY  ++L P++ L  +RNLK L P    A  + +  +A TF ++ +D+  V  +KP+A  + LPL+FGTA+Y FEGI +VLP+E  M+T +  GG  GVLN  MV V+C Y  +GFFGYL +G+ ++GS++ ++ +   G+ L+  + +S++ ++ LSY LQF+VP  ++   + S     R K L   V+R  LV  T+  A  IP+LG  ++LVGA+SSS LALIAP II  +T Y   +G F   L  ++ IL FG+ G + GT+ S+
Sbjct:   40 HSEDSLAAASGSGDDEIGSTDKSYNPTHHRDLEHPTSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMGAICTHCMHMLVNCSHELCRRFQQPSLDFSEVAYCSFESGPLGLRR----YSMLARRIVTTFLFITQIGFCCVYFLFVALNIKDVMDHYY-KMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPDVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQ---GDTLSQLVRISMAVAIFLSYTLQFYVPVNIVEPFVRSHFDTTRAKDLSATVLRVVLVTFTFLLATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNWMLWKDVLILIFGLCGFVFGTWASL 474          
BLAST of EMLSAG00000004159 vs. Select Arthropod Genomes
Match: ADV36973.1 (uncharacterized protein Dmel_CG13384, isoform H [Drosophila melanogaster])

HSP 1 Score: 292.352 bits (747), Expect = 2.440e-93
Identity = 170/443 (38.37%), Postives = 261/443 (58.92%), Query Frame = 0
Query:   16 HSGESFENGSDTQGKKVKKAPLINNPV-------------TFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYP-DFGPFKIKLIVNMCILCFGVVGSITGTFVSI 443
            HS +S    S +   ++       NP              T +HLLKGN+GTGILAMP+AFKNAG  +G  GT  +  +C + MH+L+ CS +L  +  +  L ++E A  S     +   R    +  + + I+  FL ITQ+GF  VYF+FV++N+K ++D++  +  V IY  ++L P++ L  +RNLK L P    A  + +  +A TF ++ +D+  V  +KP+A  + LPL+FGTA+Y FEGI +VLP+E  M+T +  GG  GVLN  MV V+C Y  +GFFGYL +G+ ++GS++ ++ +   G+ L+  + +S++ ++ LSY LQF+VP  ++   + S     R K L   V+R  LV  T+  A  IP+LG  ++LVGA+SSS LALIAP II  +T Y   +G F   L  ++ IL FG+ G + GT+ S+
Sbjct:   40 HSEDSLAAASGSGDDEIGSTDKSYNPTHHRDLEHPTSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMGAICTHCMHMLVNCSHELCRRFQQPSLDFSEVAYCSFESGPLGLRR----YSMLARRIVTTFLFITQIGFCCVYFLFVALNIKDVMDHYY-KMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPDVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQ---GDTLSQLVRISMAVAIFLSYTLQFYVPVNIVEPFVRSHFDTTRAKDLSATVLRVVLVTFTFLLATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNWMLWKDVLILIFGLCGFVFGTWASL 474          
BLAST of EMLSAG00000004159 vs. Select Arthropod Genomes
Match: AAN10664.1 (uncharacterized protein Dmel_CG13384, isoform E [Drosophila melanogaster])

HSP 1 Score: 292.352 bits (747), Expect = 2.440e-93
Identity = 170/443 (38.37%), Postives = 261/443 (58.92%), Query Frame = 0
Query:   16 HSGESFENGSDTQGKKVKKAPLINNPV-------------TFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYP-DFGPFKIKLIVNMCILCFGVVGSITGTFVSI 443
            HS +S    S +   ++       NP              T +HLLKGN+GTGILAMP+AFKNAG  +G  GT  +  +C + MH+L+ CS +L  +  +  L ++E A  S     +   R    +  + + I+  FL ITQ+GF  VYF+FV++N+K ++D++  +  V IY  ++L P++ L  +RNLK L P    A  + +  +A TF ++ +D+  V  +KP+A  + LPL+FGTA+Y FEGI +VLP+E  M+T +  GG  GVLN  MV V+C Y  +GFFGYL +G+ ++GS++ ++ +   G+ L+  + +S++ ++ LSY LQF+VP  ++   + S     R K L   V+R  LV  T+  A  IP+LG  ++LVGA+SSS LALIAP II  +T Y   +G F   L  ++ IL FG+ G + GT+ S+
Sbjct:   40 HSEDSLAAASGSGDDEIGSTDKSYNPTHHRDLEHPTSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMGAICTHCMHMLVNCSHELCRRFQQPSLDFSEVAYCSFESGPLGLRR----YSMLARRIVTTFLFITQIGFCCVYFLFVALNIKDVMDHYY-KMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPDVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQ---GDTLSQLVRISMAVAIFLSYTLQFYVPVNIVEPFVRSHFDTTRAKDLSATVLRVVLVTFTFLLATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNWMLWKDVLILIFGLCGFVFGTWASL 474          
BLAST of EMLSAG00000004159 vs. Select Arthropod Genomes
Match: AAN10663.1 (uncharacterized protein Dmel_CG13384, isoform D [Drosophila melanogaster])

HSP 1 Score: 292.352 bits (747), Expect = 2.440e-93
Identity = 170/443 (38.37%), Postives = 261/443 (58.92%), Query Frame = 0
Query:   16 HSGESFENGSDTQGKKVKKAPLINNPV-------------TFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYP-DFGPFKIKLIVNMCILCFGVVGSITGTFVSI 443
            HS +S    S +   ++       NP              T +HLLKGN+GTGILAMP+AFKNAG  +G  GT  +  +C + MH+L+ CS +L  +  +  L ++E A  S     +   R    +  + + I+  FL ITQ+GF  VYF+FV++N+K ++D++  +  V IY  ++L P++ L  +RNLK L P    A  + +  +A TF ++ +D+  V  +KP+A  + LPL+FGTA+Y FEGI +VLP+E  M+T +  GG  GVLN  MV V+C Y  +GFFGYL +G+ ++GS++ ++ +   G+ L+  + +S++ ++ LSY LQF+VP  ++   + S     R K L   V+R  LV  T+  A  IP+LG  ++LVGA+SSS LALIAP II  +T Y   +G F   L  ++ IL FG+ G + GT+ S+
Sbjct:   40 HSEDSLAAASGSGDDEIGSTDKSYNPTHHRDLEHPTSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMGAICTHCMHMLVNCSHELCRRFQQPSLDFSEVAYCSFESGPLGLRR----YSMLARRIVTTFLFITQIGFCCVYFLFVALNIKDVMDHYY-KMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPDVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQ---GDTLSQLVRISMAVAIFLSYTLQFYVPVNIVEPFVRSHFDTTRAKDLSATVLRVVLVTFTFLLATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNWMLWKDVLILIFGLCGFVFGTWASL 474          
BLAST of EMLSAG00000004159 vs. Select Arthropod Genomes
Match: AAF52661.1 (uncharacterized protein Dmel_CG13384, isoform F [Drosophila melanogaster])

HSP 1 Score: 292.352 bits (747), Expect = 2.440e-93
Identity = 170/443 (38.37%), Postives = 261/443 (58.92%), Query Frame = 0
Query:   16 HSGESFENGSDTQGKKVKKAPLINNPV-------------TFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYP-DFGPFKIKLIVNMCILCFGVVGSITGTFVSI 443
            HS +S    S +   ++       NP              T +HLLKGN+GTGILAMP+AFKNAG  +G  GT  +  +C + MH+L+ CS +L  +  +  L ++E A  S     +   R    +  + + I+  FL ITQ+GF  VYF+FV++N+K ++D++  +  V IY  ++L P++ L  +RNLK L P    A  + +  +A TF ++ +D+  V  +KP+A  + LPL+FGTA+Y FEGI +VLP+E  M+T +  GG  GVLN  MV V+C Y  +GFFGYL +G+ ++GS++ ++ +   G+ L+  + +S++ ++ LSY LQF+VP  ++   + S     R K L   V+R  LV  T+  A  IP+LG  ++LVGA+SSS LALIAP II  +T Y   +G F   L  ++ IL FG+ G + GT+ S+
Sbjct:   40 HSEDSLAAASGSGDDEIGSTDKSYNPTHHRDLEHPTSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMGAICTHCMHMLVNCSHELCRRFQQPSLDFSEVAYCSFESGPLGLRR----YSMLARRIVTTFLFITQIGFCCVYFLFVALNIKDVMDHYY-KMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPDVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQ---GDTLSQLVRISMAVAIFLSYTLQFYVPVNIVEPFVRSHFDTTRAKDLSATVLRVVLVTFTFLLATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNWMLWKDVLILIFGLCGFVFGTWASL 474          
BLAST of EMLSAG00000004159 vs. nr
Match: gi|1061485324|gb|ODN02463.1| (Proton-coupled amino acid transporter 4 [Orchesella cincta])

HSP 1 Score: 313.923 bits (803), Expect = 6.366e-99
Identity = 184/442 (41.63%), Postives = 279/442 (63.12%), Query Frame = 0
Query:   10 SEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLD-IKPVSDIKP-----IAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVY-PDFGPFKIKLIVNMCILCFGVVGSITGTFVSI 443
            +E D   +GE +    D   ++  + P  +N  T +HLLKGN+GTGILAMP+AFKNAG A+G  GT  I ++C++ MH+L+ C+  L  +     LS+AE A+ S         R    F  + +  I+ FLC+TQLGF  VYFVFV+ N+K + D ++G   +  Y  LLLLP++ L  +RNLK+L PF   AN      +   FY++F D + P+   +P      A    LPL+FGTA+Y FEGI +VLP+E  MKT    GG+ GVLN +M+ V C Y  +GFFGYL +GD + GSV+ +++    G +LA ++ + ++ S+ LSYPLQF+VP ++++  ++S++  +R +L+ EY  R  LV+LT+  A LIP+LG+F++LVGA+SSS LALI P +I+ LT +   +G F+ +L  ++ ++ FG +G + GT+VS+
Sbjct:   48 AEHDYSITGEHY----DPLTERDIEHP-TSNCDTMIHLLKGNVGTGILAMPDAFKNAGLAVGTIGTVMIGLICVHTMHILVRCAHDLCRRTQTPTLSFAEVAEVSFKVGPPPLRR----FSSVARMTIDSFLCVTQLGFCCVYFVFVAQNLKHVFDPYMGTWPLQSYMALLLLPMILLNYVRNLKLLAPFSMIANIFMAAGLGIIFYYIFRDPLPPIH--RPEFHSGFASWKQLPLYFGTAIYAFEGIGMVLPLENSMKTPLDFGGWNGVLNTSMIIVGCLYTAVGFFGYLKYGDLVAGSVTLNLST---GEVLAESVRLMMALSIFLSYPLQFYVPMDIMWPSIKSRIPTERMQLISEYAFRTFLVILTFAMAELIPNLGLFISLVGAVSSSTLALIFPPLINILTTWNAGYGKFRWELWKDISLMIFGGIGFVAGTYVSL 475          
BLAST of EMLSAG00000004159 vs. nr
Match: gi|1131309057|gb|JAV04889.1| (putative amino acid transporter [Nyssomyia neivai])

HSP 1 Score: 310.071 bits (793), Expect = 1.928e-97
Identity = 171/448 (38.17%), Postives = 267/448 (59.60%), Query Frame = 0
Query:    8 VSSEKDEHHSGESFENGS--DTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYP-DFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETFS 451
            +  E  E  S ES  + +  D    +  + P  +N  T +HLLKGN+GTGILAMP+AFKNAG  +G  GT  +  +C + MH+L+ CS +L  ++    L ++E    + V       R    + ++ + IINIFLCITQLGF  VYF+FV++N++ ++  +  + D+ +Y  LLL+P++ L  +RNLK L P    A  + +  +  TFY++  D+ P S +   +  + LPL+FGTA+Y FEGI +VLP+E  M T + +GG  GVLN  MV V+C Y  +GFFGYL +GDS+ GS++  +       +LA ++ + ++ ++  SY LQF+VP  VI   ++S  + ++ K+  E + R +LV  T+  A +IP+LG  ++LVGAMSSS LALI P +I  +T +P D G +   L  ++ I+ FG+ G   GT+ S+   +   +
Sbjct:   45 IVEETMEGDSRESLYDSTMYDPWSNRKLEHP-TSNLDTLIHLLKGNIGTGILAMPDAFKNAGLYVGLFGTLLMGAICTHCMHILVRCSHELCRRLQIPSLGFSEVCCAAFVTGPFGLRR----YAQLVRVIINIFLCITQLGFCCVYFLFVALNLQEVIARYYIKVDIRVYLVLLLIPMIALNMVRNLKYLTPVSLLAAVLTVSGLTITFYYVLQDLPPSSSVHAFSSWAQLPLYFGTAIYAFEGIGIVLPLENNMGTPEDLGGATGVLNTGMVIVACLYTAVGFFGYLKYGDSVSGSITLDLPN----TMLAQSVRIVMAVAIFFSYGLQFYVPINVIGPWVKSHFQSEQHKVYAENLFRIALVFFTFILAAIIPNLGGVISLVGAMSSSMLALIFPPLIEIVTFWPTDLGRYYWILWKDLAIMIFGICGFFFGTYTSLWQLLNQHT 483          
BLAST of EMLSAG00000004159 vs. nr
Match: gi|1059398527|ref|XP_017772198.1| (PREDICTED: proton-coupled amino acid transporter-like protein CG1139 isoform X3 [Nicrophorus vespilloides] >gi|1059398529|ref|XP_017772199.1| PREDICTED: proton-coupled amino acid transporter-like protein CG1139 isoform X3 [Nicrophorus vespilloides])

HSP 1 Score: 309.301 bits (791), Expect = 2.210e-97
Identity = 178/460 (38.70%), Postives = 278/460 (60.43%), Query Frame = 0
Query:    7 LVSSEKDEHHSGESFENGS---DTQGKKVKKA----PLIN--------NPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSID-GSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLW-EYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYP-DFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIE 448
            L + + DE  S E+    S   D Q   V       P++N        N  T +HLLKGN+GTGILAMP+AF+NAG A+G  GT F+  +C + MH+L+  + +L  +V K  L ++E A E    T  E ++K   + ++ K++IN+FLCITQLGF  VYFVFV+ N+  ++ N+  +  V  Y  +LL+P++ L  ++ LK + P   FA+ +    +   F++L  D+   S +   A  S LPL+FGTA+Y FEGI ++LP+E  M+T +  GG+ GVLN  MV V+C Y  +GFFGYL +G+    GS++  +    D +ILA ++ + ++ ++ LSY LQF+VP  +++  ++  ++ D+++ + EYV R  LV LT+  A  IP+LG  ++LVGA SSS LALI P +I  +T++P + G     L  ++ I+ FG+ G I G++VSIL+ + 
Sbjct:    9 LENEQLDEGSSSETINVQSTALDIQQIPVNDGKDDDPVLNRNLESPTSNLETMIHLLKGNIGTGILAMPDAFRNAGLAVGFFGTLFMGAICTHCMHILVNSTHELCRRVQKPSLGFSE-AGEVAFKTGPEPLQK---YSQLVKSLINVFLCITQLGFCCVYFVFVAANLHDVIKNYFFDMSVVWYLVMLLIPMIFLNWVKKLKYITPASLFASILTTSGLVIIFFYLLQDLPSTSTVNAFASWSQLPLYFGTAIYAFEGIGVILPLENNMQTPQDFGGWNGVLNTGMVIVACLYTAVGFFGYLKYGERAKYGSITLLLP---DTDILAQSVRLMMAIAIFLSYCLQFYVPMNIVWPMIKKHLQTDKQIFYGEYVTRSCLVFLTFALAAAIPNLGAVISLVGAFSSSALALIFPPLIEIVTLWPNNLGHRNWILWKDVAIMVFGICGFIVGSYVSILNILH 461          
BLAST of EMLSAG00000004159 vs. nr
Match: gi|1059398525|ref|XP_017772197.1| (PREDICTED: proton-coupled amino acid transporter-like protein CG1139 isoform X2 [Nicrophorus vespilloides])

HSP 1 Score: 308.916 bits (790), Expect = 5.137e-97
Identity = 178/460 (38.70%), Postives = 278/460 (60.43%), Query Frame = 0
Query:    7 LVSSEKDEHHSGESFENGS---DTQGKKVKKA----PLIN--------NPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSID-GSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLW-EYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYP-DFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIE 448
            L + + DE  S E+    S   D Q   V       P++N        N  T +HLLKGN+GTGILAMP+AF+NAG A+G  GT F+  +C + MH+L+  + +L  +V K  L ++E A E    T  E ++K   + ++ K++IN+FLCITQLGF  VYFVFV+ N+  ++ N+  +  V  Y  +LL+P++ L  ++ LK + P   FA+ +    +   F++L  D+   S +   A  S LPL+FGTA+Y FEGI ++LP+E  M+T +  GG+ GVLN  MV V+C Y  +GFFGYL +G+    GS++  +    D +ILA ++ + ++ ++ LSY LQF+VP  +++  ++  ++ D+++ + EYV R  LV LT+  A  IP+LG  ++LVGA SSS LALI P +I  +T++P + G     L  ++ I+ FG+ G I G++VSIL+ + 
Sbjct:   30 LENEQLDEGSSSETINVQSTALDIQQIPVNDGKDDDPVLNRNLESPTSNLETMIHLLKGNIGTGILAMPDAFRNAGLAVGFFGTLFMGAICTHCMHILVNSTHELCRRVQKPSLGFSE-AGEVAFKTGPEPLQK---YSQLVKSLINVFLCITQLGFCCVYFVFVAANLHDVIKNYFFDMSVVWYLVMLLIPMIFLNWVKKLKYITPASLFASILTTSGLVIIFFYLLQDLPSTSTVNAFASWSQLPLYFGTAIYAFEGIGVILPLENNMQTPQDFGGWNGVLNTGMVIVACLYTAVGFFGYLKYGERAKYGSITLLLP---DTDILAQSVRLMMAIAIFLSYCLQFYVPMNIVWPMIKKHLQTDKQIFYGEYVTRSCLVFLTFALAAAIPNLGAVISLVGAFSSSALALIFPPLIEIVTLWPNNLGHRNWILWKDVAIMVFGICGFIVGSYVSILNILH 482          
BLAST of EMLSAG00000004159 vs. nr
Match: gi|1108468875|emb|CRL02568.1| (CLUMA_CG015764, isoform A [Clunio marinus])

HSP 1 Score: 309.301 bits (791), Expect = 5.659e-97
Identity = 174/452 (38.50%), Postives = 274/452 (60.62%), Query Frame = 0
Query:    2 SSTLDLVSSEKDEHHSGESFENGSDTQGKKVKKAPL---INNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMR-PDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPD-FGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIE 448
            S+ LD     KDE +   S  N         K   L    +N  T +HLLKGN+GTGILAMP+AFKNAG  +G  GT  + ++C + MH+L++C  +L  ++    L+++     S   T    IR+   +  I K +IN FL ITQ+GF  VYFVFV+VN++ ++ ++    D  +Y  L+LLP++GL  ++NLK L PF   A+ + +  +   FYF+  D+     +   +  + LPL+FGTA+Y FEGI +VLP+E  MK  ++ GG+ GVLN  MV V+C Y  +GFFGYL +GD++ GS++ ++     G++LA  + + ++ ++ LSY LQF+VP  +I   L +++   + ++L +Y++R  LVL T+  A +IP+LG  ++LVGA+SSS LALI P II  +T +P+  G +   L  ++ I+ FG++G + G+F SI+  + 
Sbjct:   55 SNNLD---DHKDESNESSSLFNALADDYDPAKNRNLEHPTSNLDTLIHLLKGNIGTGILAMPDAFKNAGLYVGLFGTLLMGLICTHCMHMLVKCCHELCRRLQVPSLNFSGVCYASF-ETGPPGIRR---YSHIAKNLINTFLIITQIGFCCVYFVFVAVNLQEVVAHYWALLDTRVYLILMLLPMIGLNLVKNLKYLTPFSFIASVLTISGLVICFYFMLQDLPRTDTVNGFSSWAQLPLYFGTAIYAFEGIGVVLPLENNMKNPENFGGWNGVLNTGMVIVACLYTSVGFFGYLKYGDNVKGSITLNLG----GDLLAQLVRLIMAMAIFLSYTLQFYVPINIIGPWLRARLHGENNRILGDYLLRVGLVLFTFILAAMIPNLGAVISLVGAVSSSTLALIFPPIIEIVTFWPNGLGKWNWILWKDIVIMIFGIMGFVFGSFTSIMQILH 495          
BLAST of EMLSAG00000004159 vs. nr
Match: gi|1059398522|ref|XP_017772196.1| (PREDICTED: proton-coupled amino acid transporter-like protein CG1139 isoform X1 [Nicrophorus vespilloides])

HSP 1 Score: 309.686 bits (792), Expect = 6.621e-97
Identity = 178/460 (38.70%), Postives = 278/460 (60.43%), Query Frame = 0
Query:    7 LVSSEKDEHHSGESFENGS---DTQGKKVKKA----PLIN--------NPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSID-GSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLW-EYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYP-DFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIE 448
            L + + DE  S E+    S   D Q   V       P++N        N  T +HLLKGN+GTGILAMP+AF+NAG A+G  GT F+  +C + MH+L+  + +L  +V K  L ++E A E    T  E ++K   + ++ K++IN+FLCITQLGF  VYFVFV+ N+  ++ N+  +  V  Y  +LL+P++ L  ++ LK + P   FA+ +    +   F++L  D+   S +   A  S LPL+FGTA+Y FEGI ++LP+E  M+T +  GG+ GVLN  MV V+C Y  +GFFGYL +G+    GS++  +    D +ILA ++ + ++ ++ LSY LQF+VP  +++  ++  ++ D+++ + EYV R  LV LT+  A  IP+LG  ++LVGA SSS LALI P +I  +T++P + G     L  ++ I+ FG+ G I G++VSIL+ + 
Sbjct:   56 LENEQLDEGSSSETINVQSTALDIQQIPVNDGKDDDPVLNRNLESPTSNLETMIHLLKGNIGTGILAMPDAFRNAGLAVGFFGTLFMGAICTHCMHILVNSTHELCRRVQKPSLGFSE-AGEVAFKTGPEPLQK---YSQLVKSLINVFLCITQLGFCCVYFVFVAANLHDVIKNYFFDMSVVWYLVMLLIPMIFLNWVKKLKYITPASLFASILTTSGLVIIFFYLLQDLPSTSTVNAFASWSQLPLYFGTAIYAFEGIGVILPLENNMQTPQDFGGWNGVLNTGMVIVACLYTAVGFFGYLKYGERAKYGSITLLLP---DTDILAQSVRLMMAIAIFLSYCLQFYVPMNIVWPMIKKHLQTDKQIFYGEYVTRSCLVFLTFALAAAIPNLGAVISLVGAFSSSALALIFPPLIEIVTLWPNNLGHRNWILWKDVAIMVFGICGFIVGSYVSILNILH 508          
BLAST of EMLSAG00000004159 vs. nr
Match: gi|1131308346|gb|JAV04534.1| (putative transmembrane amino acid transporter protein, partial [Nyssomyia neivai])

HSP 1 Score: 309.686 bits (792), Expect = 6.860e-97
Identity = 171/448 (38.17%), Postives = 267/448 (59.60%), Query Frame = 0
Query:    8 VSSEKDEHHSGESFENGS--DTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYP-DFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETFS 451
            +  E  E  S ES  + +  D    +  + P  +N  T +HLLKGN+GTGILAMP+AFKNAG  +G  GT  +  +C + MH+L+ CS +L  ++    L ++E    + V       R    + ++ + IINIFLCITQLGF  VYF+FV++N++ ++  +  + D+ +Y  LLL+P++ L  +RNLK L P    A  + +  +  TFY++  D+ P S +   +  + LPL+FGTA+Y FEGI +VLP+E  M T + +GG  GVLN  MV V+C Y  +GFFGYL +GDS+ GS++  +       +LA ++ + ++ ++  SY LQF+VP  VI   ++S  + ++ K+  E + R +LV  T+  A +IP+LG  ++LVGAMSSS LALI P +I  +T +P D G +   L  ++ I+ FG+ G   GT+ S+   +   +
Sbjct:   73 IVEETMEGDSRESLYDSTMYDPWSNRKLEHP-TSNLDTLIHLLKGNIGTGILAMPDAFKNAGLYVGLFGTLLMGAICTHCMHILVRCSHELCRRLQIPSLGFSEVCCAAFVTGPFGLRR----YAQLVRVIINIFLCITQLGFCCVYFLFVALNLQEVIARYYIKVDIRVYLVLLLIPMIALNMVRNLKYLTPVSLLAAVLTVSGLTITFYYVLQDLPPSSSVHAFSSWAQLPLYFGTAIYAFEGIGIVLPLENNMGTPEDLGGATGVLNTGMVIVACLYTAVGFFGYLKYGDSVSGSITLDLPN----TMLAQSVRIVMAVAIFFSYGLQFYVPINVIGPWVKSHFQSEQHKVYAENLFRIALVFFTFILAAIIPNLGGVISLVGAMSSSMLALIFPPLIEIVTFWPTDLGRYYWILWKDLAIMIFGICGFFFGTYTSLWQLLNQHT 511          
BLAST of EMLSAG00000004159 vs. nr
Match: gi|1069804983|ref|XP_018326738.1| (PREDICTED: proton-coupled amino acid transporter-like protein pathetic isoform X2 [Agrilus planipennis] >gi|1069804985|ref|XP_018326739.1| PREDICTED: proton-coupled amino acid transporter-like protein pathetic isoform X2 [Agrilus planipennis])

HSP 1 Score: 308.145 bits (788), Expect = 7.775e-97
Identity = 174/413 (42.13%), Postives = 261/413 (63.20%), Query Frame = 0
Query:   39 NNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSID-GSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPD-FGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIE 448
            +N  T +HLLKGN+GTGILAMP+AF+NAG+A+G  GT  + ++C + MH+L++CS  L  +   + L++AE + E       E +RK   + +IFK  IN FLCITQ+GF  VYFVFV+ N++ ++ ++I +  V  Y   LL P++ L  ++NLK L P   FA+ +    +A TF+++   +   S IK     S   LFFGTA+Y FEGI +VLP+E  MK  +  GG+ GVLN  MV V+C Y  +GFFGYL +GD    GSV+  +  +ND  ILA ++ + ++ ++ LSY LQF+VPF +I+  ++  +  ++ ++L EY+ R  LV++T+  A  IP+LG  ++LVGA SSS LALI P ++  LT +PD  G +K     +  I  FG +G I G++VS+L+ I 
Sbjct:   59 SNLDTMIHLLKGNVGTGILAMPDAFRNAGWAVGTVGTLLMGIICTHCMHMLVKCSHDLCRRTNTAALNFAEVS-EYACQLGPEPLRK---YSRIFKISINSFLCITQIGFCCVYFVFVAANLQEVIKHYIVDISVHWYLVFLLPPMIVLNWLKNLKYLAPVSFFASILTCTGLAITFFYMLQGLPNTSSIKASTNWSQFALFFGTAIYAFEGIGVVLPLENNMKRPQDFGGWTGVLNTGMVIVACLYTAVGFFGYLKYGDMAQLGSVTLYL-PSND--ILAQSVRLMMAIAIFLSYGLQFYVPFSIIWPIVKDHLETEKAQVLGEYITRTILVIITFALAAAIPNLGAVISLVGAFSSSALALIFPPLLEILTFWPDRLGKYKWIFWKDFFIAVFGFLGFILGSYVSVLNIIS 464          
BLAST of EMLSAG00000004159 vs. nr
Match: gi|1069804980|ref|XP_018326737.1| (PREDICTED: proton-coupled amino acid transporter-like protein pathetic isoform X1 [Agrilus planipennis])

HSP 1 Score: 308.531 bits (789), Expect = 8.123e-97
Identity = 174/412 (42.23%), Postives = 261/412 (63.35%), Query Frame = 0
Query:   39 NNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSID-GSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPD-FGPFKIKLIVNMCILCFGVVGSITGTFVSILDAI 447
            +N  T +HLLKGN+GTGILAMP+AF+NAG+A+G  GT  + ++C + MH+L++CS  L  +   + L++AE + E       E +RK   + +IFK  IN FLCITQ+GF  VYFVFV+ N++ ++ ++I +  V  Y   LL P++ L  ++NLK L P   FA+ +    +A TF+++   +   S IK     S   LFFGTA+Y FEGI +VLP+E  MK  +  GG+ GVLN  MV V+C Y  +GFFGYL +GD    GSV+  +  +ND  ILA ++ + ++ ++ LSY LQF+VPF +I+  ++  +  ++ ++L EY+ R  LV++T+  A  IP+LG  ++LVGA SSS LALI P ++  LT +PD  G +K     +  I  FG +G I G++VS+L+ I
Sbjct:   83 SNLDTMIHLLKGNVGTGILAMPDAFRNAGWAVGTVGTLLMGIICTHCMHMLVKCSHDLCRRTNTAALNFAEVS-EYACQLGPEPLRK---YSRIFKISINSFLCITQIGFCCVYFVFVAANLQEVIKHYIVDISVHWYLVFLLPPMIVLNWLKNLKYLAPVSFFASILTCTGLAITFFYMLQGLPNTSSIKASTNWSQFALFFGTAIYAFEGIGVVLPLENNMKRPQDFGGWTGVLNTGMVIVACLYTAVGFFGYLKYGDMAQLGSVTLYL-PSND--ILAQSVRLMMAIAIFLSYGLQFYVPFSIIWPIVKDHLETEKAQVLGEYITRTILVIITFALAAAIPNLGAVISLVGAFSSSALALIFPPLLEILTFWPDRLGKYKWIFWKDFFIAVFGFLGFILGSYVSVLNII 487          
BLAST of EMLSAG00000004159 vs. nr
Match: gi|1008435857|ref|XP_015834577.1| (PREDICTED: proton-coupled amino acid transporter 4 isoform X2 [Tribolium castaneum])

HSP 1 Score: 307.375 bits (786), Expect = 1.470e-96
Identity = 175/448 (39.06%), Postives = 274/448 (61.16%), Query Frame = 0
Query:    4 TLDLVSSEKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGD-SIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDR-KLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPD-FGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIE 448
            +LDL S+      SGE F     T  +K++     +N  T +HLLKGN+GTGILAMP+AF+NAG+ +G  GT F+  +C + MH+L+ C+ +L  +  K  LS+ E  + +         R    F +I KT+IN+FLCITQLGF  VYFVFV+ N+  ++ ++  +  V  Y  +LL+P++ L  +++LK L P   FA+ +    +  TF+++  D+   S ++  +  S LPL+FGTA+Y FEGI ++LP+E  MK+ +  GG+ GVLN  MV V+  Y  +GFFGYL +GD ++ GSV+  +       +LA ++ + ++ ++ LSY LQF+VPF +++  ++     D+ K L E+  R  LV +T+  A+ IP+LG  ++LVGA SSS LALI P +I  +T +PD  G     L  ++ I+ FG VG I G++VS+L+ ++
Sbjct:   42 SLDLDSA------SGEDFSE-DPTLNRKLEHP--TSNFDTMIHLLKGNIGTGILAMPDAFRNAGWVVGLFGTMFMGFICTHCMHMLVACAHELCRRTQKPALSFDEVVENAFKTGPQPLQR----FSQIAKTLINLFLCITQLGFCCVYFVFVAANLHDVIKHYFFDISVHWYLVILLIPMVLLNFVKSLKYLTPASLFASILTCSGLVITFFYMLQDLPDTSTVQAFSSWSQLPLYFGTAIYAFEGIGVILPLENNMKSPQDFGGWTGVLNTGMVIVATLYTAVGFFGYLKYGDQAVLGSVTLLLPP---NELLAQSVRLMMAVAIFLSYSLQFYVPFNIVWPWVKDYFHSDKSKRLAEHATRTILVFVTFALAIAIPNLGAVISLVGAFSSSALALIFPPLIEIITFWPDKLGKNNWILWKDLAIVLFGFVGFIIGSYVSLLNILQ 473          
BLAST of EMLSAG00000004159 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold12_size759060-processed-gene-2.9 (protein:Tk05567 transcript:snap_masked-scaffold12_size759060-processed-gene-2.9-mRNA-1 annotation:"proton-coupled amino acid transporter 4")

HSP 1 Score: 329.331 bits (843), Expect = 2.161e-108
Identity = 178/441 (40.36%), Postives = 269/441 (61.00%), Query Frame = 0
Query:   14 EHHSGESFENGSDTQGK---KVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFKIKLIVNMCILCFGVVGSITGTFVSILDAIETFS 451
            E    E    GS+++        ++  I+N  T +H+LKGN+GTGILAMP+A KN+G   G  G  F+ ++C++ MH+L++C+ +L  +V  + L+Y E   ++        +R+   F +  KT I++FLCITQLGF  VYFVFV+ N+K ++D+   E D   Y  L+L  +L L S+RNLK L P   FAN I    +    ++L  D+    + K  +    LPL+FGTA+Y FEGI +VLP+E +MK    + GYFGVLN +M  V   Y+ +GFFGYL +GD + GS++ ++        LA  + + +S ++  SY LQF+VP E++   + S+  P R LL EY++R+SLVL T+  A  IP L +F++LVGA+SSS LAL+AP +I  +T +P+   F   L+ N+CI   G +G +TGT+VS+ + IE F+
Sbjct:   81 EERDSELGPGGSESEESITFNPDRSDEISNFDTIVHMLKGNVGTGILAMPDAIKNSGLGFGCIGLVFMGLICVHCMHMLVKCAQELCRRVKVNSLTYPEVGSQAFSTAHSPRLRR---FAQPAKTSIDVFLCITQLGFCCVYFVFVAQNLKRVVDHHWQEMDYHFYMALVLPLMLALCSVRNLKYLSPISMFANIIQFVGLGIILFYLVQDLPKTWERKQFSSWGQLPLYFGTAIYAFEGIGVVLPLENKMKYPGDLKGYFGVLNTSMTIVVSLYIALGFFGYLKYGDDVLGSITLNLPVE---EWLAQLVMIMMSVAIFFSYALQFYVPVEIVLPIVASRF-PSRPLLTEYIVRYSLVLFTFAMAAAIPKLDLFISLVGAVSSSTLALMAPPLIDVITFWPNISKF--CLVKNLCIFTLGFLGFVTGTYVSLQNIIEYFA 512          
BLAST of EMLSAG00000004159 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold521_size146803-snap-gene-0.10 (protein:Tk12186 transcript:maker-scaffold521_size146803-snap-gene-0.10-mRNA-1 annotation:"proton-coupled amino acid transporter 4")

HSP 1 Score: 250.366 bits (638), Expect = 9.942e-78
Identity = 158/451 (35.03%), Postives = 259/451 (57.43%), Query Frame = 0
Query:   11 EKDEHHSGESFENGSDTQGKKVKKAPLINNPVTFMHLLKGNLGTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDKVGKS-YLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGE----TDVSIYTTLLLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKP-IAPLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVIYKGLESKMRPDRKLLW----EYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIHTLTVYPDFGPFK-IKLIVNMCILCFGVVGSITGTFVSILDAIETF 450
            E+DE +S    E+    Q ++  +   I+N  T +H+LKGN+G G+L +P A +N+G   G  G A IA +C++ M +L+  + K   K  ++ +L YA+TAK + +     + R   F  K+    +NIFLC++Q+G ++VY +F++ N++PI++++ GE     +  IY   +L  ++ +  I+NL+ L PF   AN      +   FY++F +  P S   P +A +S LPLFFGTA++  EGI++VLP+E +MK  K M G+ GVLN +M  V   YV MGF+GYL +G+ I+ S++ ++  A   +ILA    +  S S+  SY LQF+V  E++   +   +RP     W    EY  R  + ++T+  A  +P L + ++L+GA+  S LA++APA+I T + +     FK  +++ N  I   G  G I GT+VS+L   + F
Sbjct:   81 EEDEENSLVPVEDVHAMQDERDTEHA-ISNTETIIHILKGNIGIGVLTLPIAIRNSGLLFGNIGLACIAYMCVHCMKMLVNAAHKACAKRPEAVFLDYADTAKAAFLDAGGVWERWASFMGKL----VNIFLCLSQVGSNAVYVLFIAQNIQPIVEHYGGELFHSMNYRIYIAAILPFMIAICMIKNLRYLSPFSVVANIFQFVGLGIIFYYIFREPLPHSASLPWVANVSRLPLFFGTAIFAIEGISVVLPIENQMKYPKEMLGWNGVLNTSMSMVGLLYVAMGFYGYLKYGEEIESSITLNLPPA---DILAQICLLLFSLSIFFSYALQFYVLMEILGPNV---IRPRVSDRWYNLSEYGTRIVINIITFALAATVPWLDLVVSLLGAVKMSTLAIMAPALIDTASHWHGGRGFKNWRVVKNGIIFLIGFFGCIMGTYVSVLSIAQNF 520          
BLAST of EMLSAG00000004159 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold292_size219010-processed-gene-1.17 (protein:Tk00330 transcript:snap_masked-scaffold292_size219010-processed-gene-1.17-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_23032")

HSP 1 Score: 53.9138 bits (128), Expect = 5.401e-8
Identity = 88/372 (23.66%), Postives = 151/372 (40.59%), Query Frame = 0
Query:   53 GTGILAMPEAFKNAGYALGGGGTAFIAVVCIYGMHLLLECSAKLRDK--VGKSYLSYAETAKESMVYTEIEFIRKRKFFPKIFKTIINIFLCITQLGFSSVYFVFVSVNMKPILDNWIGETDVSIYTTL---LLLPILGLASIRNLKILGPFITFANAINLFAIASTFYFLFLDIKPVSDIKPIA---PLSXLPLFFGTALYTFEGIALVLPMEKEMKTRKSMGGYFGVLNIAMVTVSCFYVLMGFFGYLSFGDSIDGSVSESVAKANDGNILAIAISVSLSTSVTLSYPLQFFVPFEVI----YKGLESKMRP-----DRKL-LWEYVIRFSLVLLTYGFAVLIPDLGIFMALVGAMSSSFLALIAPAIIH 406
            G  I+++P A  + GY  G      IA +C +   +L+EC  +  D+  + K   SY E A+E              F  +    I+N+   I  L    +Y V     +     N  G  D   Y  +   +LLP   L ++RN+  L    +F N I    I +      L      D   +     +   P+  G  ++++     +  +E  M  +     +  +LN + V  + F  L G+ G+L++ +     V  ++        L   +++ L     LSYPL ++   E++    +KG    + P     D +L LW    R  +V++T  FAV+IP   I M  +G+ +  FL+ I P   H
Sbjct:   71 GMFIVSLPYAVLHGGY-WGIVAMVGIAHICCHTGKILVECLYEKNDEGELVKVRFSYNEIAQEC-------------FGKRFGGKIVNVAQLIELLMTCILYVVLCGDLLMGAFPN--GSIDTRSYMMICGAILLPTAFLKNLRNVSNL----SFYNGIVHMIINAVIIGYCLTQAGRWDFSKVTLTINILSFPIALGVIVFSYTSQIFLPTLEGSMIDKSK---FHCMLNWSHVAAAVFKGLFGYIGFLTWQEDTQEEVVNNLEPG-----LKSLVNLILVIKALLSYPLPYYAACELLETELFKGKPETVFPSIWALDGELKLWGLGFRVMVVVVTIVFAVVIPHFTILMGFIGSFTGCFLSFIWPTFFH 414          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000004159 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-2.984e-9138.50symbol:CG13384 species:7227 "Drosophila melanogast... [more]
-2.056e-7234.94symbol:CG1139 species:7227 "Drosophila melanogaste... [more]
-4.210e-7035.19symbol:CG16700 species:7227 "Drosophila melanogast... [more]
-1.317e-6934.22symbol:CG8785 species:7227 "Drosophila melanogaste... [more]
-1.617e-6936.36symbol:CG7888 species:7227 "Drosophila melanogaste... [more]
-9.203e-6833.25symbol:Y43F4B.7 species:6239 "Caenorhabditis elega... [more]
-9.203e-6833.25symbol:CELE_Y43F4B.7 "Protein Y43F4B.7" species:62... [more]
-3.650e-6733.96symbol:slc36a4 "solute carrier family 36 (proton/a... [more]
-8.337e-6432.64symbol:CELE_T27A1.5 "Protein T27A1.5, isoform a" s... [more]
-1.181e-6233.49symbol:Slc36a4 "solute carrier family 36 (proton/a... [more]

Pages

back to top
BLAST of EMLSAG00000004159 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592845586|gb|GAXK01111958.1|7.917e-8341.33TSA: Calanus finmarchicus comp53514_c0_seq2 transc... [more]
gi|592845587|gb|GAXK01111957.1|9.646e-8341.33TSA: Calanus finmarchicus comp53514_c0_seq1 transc... [more]
gi|592845585|gb|GAXK01111959.1|1.088e-8241.63TSA: Calanus finmarchicus comp53514_c0_seq3 transc... [more]
gi|592845582|gb|GAXK01111962.1|1.153e-8240.76TSA: Calanus finmarchicus comp53514_c6_seq2 transc... [more]
gi|592862259|gb|GAXK01095303.1|5.303e-6738.41TSA: Calanus finmarchicus comp1395846_c0_seq1 tran... [more]
gi|592772942|gb|GAXK01181626.1|3.732e-5935.45TSA: Calanus finmarchicus comp128642_c0_seq1 trans... [more]
gi|592862258|gb|GAXK01095304.1|3.917e-5838.00TSA: Calanus finmarchicus comp1395846_c0_seq2 tran... [more]
gi|592845583|gb|GAXK01111961.1|5.549e-4340.22TSA: Calanus finmarchicus comp53514_c6_seq1 transc... [more]
gi|592943227|gb|GAXK01015326.1|7.373e-4032.69TSA: Calanus finmarchicus comp631523_c0_seq1 trans... [more]
gi|592876128|gb|GAXK01081449.1|2.686e-3031.97TSA: Calanus finmarchicus comp1098095_c0_seq1 tran... [more]

Pages

back to top
BLAST of EMLSAG00000004159 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 4
Match NameE-valueIdentityDescription
EMLSAP000000041590.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s21:158842... [more]
EMLSAP000000013734.998e-6440.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1230:2090... [more]
EMLSAP000000047468.144e-2125.61pep:novel supercontig:LSalAtl2s:LSalAtl2s24:144470... [more]
EMLSAP000000119244.455e-922.12pep:novel supercontig:LSalAtl2s:LSalAtl2s841:55690... [more]
back to top
BLAST of EMLSAG00000004159 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|74871976|sp|Q9W056.1|C1139_DROME8.288e-7434.94RecName: Full=Proton-coupled amino acid transporte... [more]
gi|123904452|sp|Q4KL91.1|S36A4_XENLA2.208e-6732.62RecName: Full=Proton-coupled amino acid transporte... [more]
gi|81871266|sp|Q8CH36.1|S36A4_MOUSE6.696e-6433.49RecName: Full=Proton-coupled amino acid transporte... [more]
gi|74749514|sp|Q6YBV0.1|S36A4_HUMAN5.759e-6332.82RecName: Full=Proton-coupled amino acid transporte... [more]
gi|51316800|sp|Q7Z2H8.1|S36A1_HUMAN1.535e-6132.30RecName: Full=Proton-coupled amino acid transporte... [more]
gi|51316868|sp|Q8K4D3.1|S36A1_MOUSE5.346e-5832.46RecName: Full=Proton-coupled amino acid transporte... [more]
gi|51316558|sp|Q924A5.1|S36A1_RAT1.343e-5632.31RecName: Full=Proton-coupled amino acid transporte... [more]
gi|121943282|sp|Q495M3.1|S36A2_HUMAN2.075e-5629.74RecName: Full=Proton-coupled amino acid transporte... [more]
gi|74870787|sp|Q9VT04.1|PATH_DROME4.251e-5531.92RecName: Full=Proton-coupled amino acid transporte... [more]
gi|81873793|sp|Q8BHK3.1|S36A2_MOUSE2.847e-5430.30RecName: Full=Proton-coupled amino acid transporte... [more]

Pages

back to top
BLAST of EMLSAG00000004159 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
gb|KYB28192.1|6.365e-9939.29Proton-coupled amino acid transporter 4 -like prot... [more]
EAA12852.42.568e-9538.29AGAP008490-PA, partial [Anopheles gambiae str. PES... [more]
ADV36977.11.755e-9338.50uncharacterized protein Dmel_CG13384, isoform L [D... [more]
ADV36976.11.755e-9338.50uncharacterized protein Dmel_CG13384, isoform K [D... [more]
AAS64738.11.755e-9338.50uncharacterized protein Dmel_CG13384, isoform G [D... [more]
ADV36974.12.440e-9338.37uncharacterized protein Dmel_CG13384, isoform I [D... [more]
ADV36973.12.440e-9338.37uncharacterized protein Dmel_CG13384, isoform H [D... [more]
AAN10664.12.440e-9338.37uncharacterized protein Dmel_CG13384, isoform E [D... [more]
AAN10663.12.440e-9338.37uncharacterized protein Dmel_CG13384, isoform D [D... [more]
AAF52661.12.440e-9338.37uncharacterized protein Dmel_CG13384, isoform F [D... [more]

Pages

back to top
BLAST of EMLSAG00000004159 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|1061485324|gb|ODN02463.1|6.366e-9941.63Proton-coupled amino acid transporter 4 [Orchesell... [more]
gi|1131309057|gb|JAV04889.1|1.928e-9738.17putative amino acid transporter [Nyssomyia neivai][more]
gi|1059398527|ref|XP_017772198.1|2.210e-9738.70PREDICTED: proton-coupled amino acid transporter-l... [more]
gi|1059398525|ref|XP_017772197.1|5.137e-9738.70PREDICTED: proton-coupled amino acid transporter-l... [more]
gi|1108468875|emb|CRL02568.1|5.659e-9738.50CLUMA_CG015764, isoform A [Clunio marinus][more]
gi|1059398522|ref|XP_017772196.1|6.621e-9738.70PREDICTED: proton-coupled amino acid transporter-l... [more]
gi|1131308346|gb|JAV04534.1|6.860e-9738.17putative transmembrane amino acid transporter prot... [more]
gi|1069804983|ref|XP_018326738.1|7.775e-9742.13PREDICTED: proton-coupled amino acid transporter-l... [more]
gi|1069804980|ref|XP_018326737.1|8.123e-9742.23PREDICTED: proton-coupled amino acid transporter-l... [more]
gi|1008435857|ref|XP_015834577.1|1.470e-9639.06PREDICTED: proton-coupled amino acid transporter 4... [more]

Pages

back to top
BLAST of EMLSAG00000004159 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 3
Match NameE-valueIdentityDescription
snap_masked-scaffold12_size759060-processed-gene-2.92.161e-10840.36protein:Tk05567 transcript:snap_masked-scaffold12_... [more]
maker-scaffold521_size146803-snap-gene-0.109.942e-7835.03protein:Tk12186 transcript:maker-scaffold521_size1... [more]
snap_masked-scaffold292_size219010-processed-gene-1.175.401e-823.66protein:Tk00330 transcript:snap_masked-scaffold292... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s21supercontigLSalAtl2s21:158842..160854 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteProton-coupled amino acid transporter-like protein CG1139
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s21-augustus-gene-1.7
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000004159 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000004159EMLSAT00000004159-700006Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s21:158842..160854-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000004159-686925 ID=EMLSAG00000004159-686925|Name=EMLSAG00000004159|organism=Lepeophtheirus salmonis|type=gene|length=2013bp|location=Sequence derived from alignment at LSalAtl2s21:158842..160854- (Lepeophtheirus salmonis)
ATGTCCTCCACGCTGGATTTAGTATCTTCAGAGAAAGATGAACATCATTC TGGGGAGTCTTTTGAGTAAGTAATTTATTTATAATGGATGAATAAACGTT TAACGGATATTTGTACAATTTATACTCATATTACAGAAATGGGTCGGATA CTCAAGGAAAAAAGGTCAAAAAGGCTCCACTCATTAAGTAACTCTTGTTT CAAAATGGACTAAATAGAGTTACGATCTTCTTCTTTTTCAGTAATCCAGT GACATTTATGCATTTGTTGAAAGGAAATCTTGGAACTGGGATTTTAGCTA TGCCAGAGGCTTTTAAAAATGCAGGCTATGCCTTGGGAGGTGGAGGAACC GCCTTTATCGCTGTCGTATGCATTTACGGCATGCATTTACTTTTAGAATG TTCAGCCAAACTACGAGACAAGGTAGGAAAGTCATATTTATCCTACGCAG AAACAGCTAAGGAGTCCATGGTTTACACTGAAATTGAGTTTATTAGGAAA AGGAAATTTTTTCCGAAGATATTTAAGTAAATAAGAACTTATTACCATTT TGATTGGATTCTACTTTTTTATCTTTTTCTCTCAGAACCATCATCAATAT TTTCCTTTGCATCACACAATTGGGATTTAGCAGTGTTTATTTTGTGTTTG TTTCGGTGAATATGAAGCCTGTAAGTACCTTGAGGTATATGTATTTTTAC TAACTATGATTATATTCCAAGCCTCCTTAATTGATCTTTAGATTTTAGAT AATTGGATCGGAGAGACAGATGTCAGCATTTACACTACATTACTACTACT TCCAATACTGGGCTTAGCATCAATACGTAATCTCAAGATTCTTGGACCTT TTATCACCTTTGCAAATGCAATCAATTTATTTGCAATTGCATCTACCTTC TATTTTTTATTTTTGGATATCAAACCAGTATCTGATATTAAACCTATAGC ACCATTGTACGTTGCAAAATCCCAAAAGAATTCTTATATAATTTACAATG AAAGTTATTCAAATAATTTTAAATTTATTTGGCTTAAGTTTTGAGGATAA AGGCTTTTTATCTAATAAGATAATATATCATATATTATGTTTATAAAAAT TTGCTTACTTATAAATATTTTACTAAGTAATTATTTTCAGAGAAATATCA AATCAATTGTAATGTTCACATACATATTAACATCTAAAACCTACATTCTG TTTTTAAAAATGATAATTAACTCCCAAATTTGTCACCATAAGGTCAKCTC TGCCATTATTTTTTGGAACTGCACTCTACACATTCGAAGGAATAGCTCTG GTACTGCCAATGGAAAAAGAAATGAAGACTCGTAAATCCATGGGTGGATA CTTTGGTGTCCTCAACATAGCAATGGTTACGGTATCCTGTTTTTATGTTC TCATGGGTTTTTTTGGTTACTTGAGTTTTGGAGACTCAATAGATGGAAGT GTCTCTGAGTCTGTTGCAAAGGCAAATGATGGAAACATGTTCGTATAGTT CTTCATTTCTAATTTCCATATGTTTAATAGGGAAATACTTTTCTATATAG ATTAGCGATCGCAATCAGTGTTTCTCTCTCAACTTCTGTAACGTTATCGT ATCCCCTTCAATTTTTTGTTCCTTTTGAAGTAATATACAAAGGACTCGAG AGTAAAATGAGACCAGATAGAAAACTTTTGTGGGAGTATGTAATTCGATT TTCTCTTGTTCTTCTCACATGTAAGATATGCACATTGTTCAAAATAATTT TAATACCATTTTCCTCCTTTGTAGATGGGTTTGCTGTCCTTATTCCTGAT TTAGGGATATTTATGGCTCTTGTGGGCGCGATGAGTTCTTCTTTTTTAGC TTTGATAGCKCCAGCCATCATCCACACCCTAACAGTTTATCCAGACTTTG GTCCATTCAAAATCAAACTTATAGTTAATATGTGTATTCTATGCTTTGGA GTTGTTGGAAGTATCACTGGAACATTTGTGTCTATTTTGGATGCCATTGA AACATTCAGTTAA
back to top
Add to Basket