EMLSAG00000004666, EMLSAG00000004666-687432 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000004666
Unique NameEMLSAG00000004666-687432
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000004666 vs. GO
Match: - (symbol:Cyp6a17 "Cytochrome P450-6a17" species:7227 "Drosophila melanogaster" [GO:0009055 "electron carrier activity" evidence=ISS;NAS] [GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS] [GO:0016020 "membrane" evidence=NAS] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0005506 "iron ion binding" evidence=IEA] [GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0040040 "thermosensory behavior" evidence=IMP] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PROSITE:PS00086 EMBL:AE013599 GO:GO:0040040 GO:GO:0005789 GO:GO:0005506 GO:GO:0004497 eggNOG:COG2124 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0016705 GeneTree:ENSGT00730000110591 OrthoDB:EOG7W6WKQ KO:K14999 EMBL:AY069090 RefSeq:NP_652018.1 UniGene:Dm.2289 ProteinModelPortal:Q9V770 SMR:Q9V770 PaxDb:Q9V770 PRIDE:Q9V770 EnsemblMetazoa:FBtr0087451 GeneID:45556 KEGG:dme:Dmel_CG10241 UCSC:CG10241-RA CTD:45556 FlyBase:FBgn0015714 InParanoid:Q9V770 PhylomeDB:Q9V770 GenomeRNAi:45556 NextBio:838218 Bgee:Q9V770 Uniprot:Q9V770)

HSP 1 Score: 106.301 bits (264), Expect = 2.858e-24
Identity = 92/327 (28.13%), Postives = 137/327 (41.90%), Query Frame = 0
Query:    6 DIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFL-TFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNND-------------------------------------------------TLFLFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKF 282
            D+V RYT   I    FG+  NC  L   +  F+     I  R   + R   M   FL  FP   ++   + L    ++ F+  +V+ +I+ R ++K  R DF+D L+ E YKN     ++  N E+                +TF+E      L+A   I  +AGF+T+S+ M      LA +  VQ+KL EEI  V  + N +                                                 T+ + P    +   D Y EPE+F P  FT+E    R + ++L FG+GPRNCIG+RF M+Q    L  L+  YKF
Sbjct:  175 DLVARYTADVIGNCAFGL--NCNSLYDPKAEFVS----IGKRAITEHRYGNMLDIFLFGFPK-LSRRLRLKLNIQEAEDFYTKIVRETIDYRLRTKEKRNDFMDSLI-EMYKN-----EQSGNSEDG---------------LTFNE------LLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKHNKEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKF 467          
BLAST of EMLSAG00000004666 vs. GO
Match: - (symbol:Cyp6a9 "Cytochrome P450-6a9" species:7227 "Drosophila melanogaster" [GO:0009055 "electron carrier activity" evidence=ISS;NAS] [GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS] [GO:0017143 "insecticide metabolic process" evidence=NAS] [GO:0016020 "membrane" evidence=NAS] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0005506 "iron ion binding" evidence=IEA] [GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PROSITE:PS00086 EMBL:AE013599 GO:GO:0005789 GO:GO:0005506 GO:GO:0009055 GO:GO:0004497 eggNOG:COG2124 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0016705 GeneTree:ENSGT00730000110591 OrthoDB:EOG7W6WKQ KO:K14999 EMBL:L46860 EMBL:AY119196 PIR:JC5321 RefSeq:NP_523748.2 UniGene:Dm.632 ProteinModelPortal:Q27594 SMR:Q27594 BioGrid:62405 IntAct:Q27594 MINT:MINT-334517 PaxDb:Q27594 EnsemblMetazoa:FBtr0300128 GeneID:36663 KEGG:dme:Dmel_CG10246 CTD:36663 FlyBase:FBgn0013771 InParanoid:Q27594 OMA:ARIGMAM PhylomeDB:Q27594 GenomeRNAi:36663 NextBio:799743 Bgee:Q27594 Uniprot:Q27594)

HSP 1 Score: 105.145 bits (261), Expect = 8.351e-24
Identity = 89/348 (25.57%), Postives = 154/348 (44.25%), Query Frame = 0
Query:    1 MVDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGK-KWRQVYMFLCFL-TFPNWFTK-HSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNNDTLF--------------------------------------------------LFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVA 295
            +V+ RDI+ R+TT  I    FG+E +    S+K+P   E    + GR+   + R   + + F+ +F N   + H  I+L +  ++ FF+ +V+ ++  R+K+ + R DF+D L+    KN+ + + E  +GE                 +T +E      + A   +   AGF+T+S+ M      LA H  +Q+++ +E   VI + N +  +                                                  L P  A +  +  Y  P  FNP+NF+ E   +R +  +L FG GPRNCIGMRF  +Q ++ L  L+ ++KF   E+T   I+ +
Sbjct:  171 IVEVRDILARFTTDVIGTCAFGIECS----SLKDP---EAEFRVMGRRAIFEQRHGPIGIAFINSFQNLARRLHMKITLEE--AEHFFLRIVRETVAFREKNNIRRNDFMDQLID--LKNSPLTKSE--SGE--------------SVNLTIEE------MAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTIPIVYS 485          
BLAST of EMLSAG00000004666 vs. GO
Match: - (symbol:Cyp6a18 "Cyp6a18" species:7227 "Drosophila melanogaster" [GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS] [GO:0009055 "electron carrier activity" evidence=ISS;NAS] [GO:0016020 "membrane" evidence=NAS] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA] [GO:0005506 "iron ion binding" evidence=IEA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PROSITE:PS00086 EMBL:AE014297 GO:GO:0005789 GO:GO:0005506 GO:GO:0004497 eggNOG:COG2124 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0016705 GeneTree:ENSGT00730000110591 OrthoDB:EOG7W6WKQ KO:K14999 EMBL:AY071195 RefSeq:NP_651563.1 UniGene:Dm.6065 ProteinModelPortal:Q9VB31 SMR:Q9VB31 PRIDE:Q9VB31 EnsemblMetazoa:FBtr0085183 GeneID:43304 KEGG:dme:Dmel_CG13977 UCSC:CG13977-RA CTD:43304 FlyBase:FBgn0039519 InParanoid:Q9VB31 OMA:RNIPHES PhylomeDB:Q9VB31 GenomeRNAi:43304 NextBio:833239 Bgee:Q9VB31 Uniprot:Q9VB31)

HSP 1 Score: 104.76 bits (260), Expect = 9.914e-24
Identity = 83/348 (23.85%), Postives = 140/348 (40.23%), Query Frame = 0
Query:    1 MVDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLA-EFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN------------------NDTL--------------------------------FLFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPN 297
            ++D RD+V R+T   I    FG++ N       E L      ++  R G     +       ++PN   +   +       + F+  +VK ++  R+K  + R DF+D+L+  +  KN +++  E+  G                  +T DE      +VA   +  +AGFDT+SS M      LA +P +Q+K+  E+  V+ + +                  N+TL                                 + P+ A +     Y EP  F P  F+ E   KR + ++L FG+GPRNCIG+RF  +Q +  L  L+  + F     T D +   P+
Sbjct:  172 ILDVRDLVARFTVDVIGTCAFGIKCNSLRDEKAEFLHFGRRALLDSRHGNLVSGL-----MRSYPN-LARRLGLCRNTAQIQEFYQRIVKETVTLREKENIKRNDFMDMLIGLKNQKNMTLENGEVVKG------------------LTMDE------IVAQAFVFFIAGFDTSSSTMGFALYELAKNPSIQDKVRAELGQVLEQHDQKFTYECIKDLKYLDQVINETLRHYTIVPNVDRVAAKRFVVPGNPKFVIEAGQSVIIPSSAIHHDPSIYPEPNEFRPERFSPEESAKRPSVAWLPFGEGPRNCIGLRFGQMQARIGLAMLIKNFTFSPCSATPDPLTFDPH 489          
BLAST of EMLSAG00000004666 vs. GO
Match: - (symbol:Cyp6a13 "Cyp6a13" species:7227 "Drosophila melanogaster" [GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS] [GO:0009055 "electron carrier activity" evidence=ISS;NAS] [GO:0016020 "membrane" evidence=NAS] [GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0005506 "iron ion binding" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0042742 "defense response to bacterium" evidence=IMP] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PROSITE:PS00086 EMBL:AE013599 GO:GO:0005789 GO:GO:0005506 GO:GO:0004497 GO:GO:0042742 eggNOG:COG2124 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0016705 GeneTree:ENSGT00730000110591 OrthoDB:EOG7W6WKQ EMBL:AY051723 RefSeq:NP_610390.1 UniGene:Dm.530 ProteinModelPortal:Q9V4U9 SMR:Q9V4U9 BioGrid:61688 DIP:DIP-23076N IntAct:Q9V4U9 MINT:MINT-322173 STRING:7227.FBpp0087770 PaxDb:Q9V4U9 PRIDE:Q9V4U9 EnsemblMetazoa:FBtr0088690 GeneID:35837 KEGG:dme:Dmel_CG2397 UCSC:CG2397-RA CTD:35837 FlyBase:FBgn0033304 HOGENOM:HOG000264037 InParanoid:Q9V4U9 KO:K14999 OMA:MGRSITE PhylomeDB:Q9V4U9 GenomeRNAi:35837 NextBio:795448 Bgee:Q9V4U9 Uniprot:Q9V4U9)

HSP 1 Score: 104.375 bits (259), Expect = 1.199e-23
Identity = 84/336 (25.00%), Postives = 139/336 (41.37%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN------------------------------------------NDTLFLFPND-------AFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKT 288
            ++++D+  R+TT  I    FG+E N   L   E  F  M   +T    ++     +   F+       +     L  P    FF++ V+ +++ R++  + R D + LL+              + GEE           ++D  ++F++      + A  L+  +AGFDT+S+ M+     LA +P VQE+L  E+  V+   N                                          N  L L P         + +   + Y +PE F+P+ F  E    R  +++L FG+GPRNCIG RF  LQ+K  L  L+  +KF R+EKT
Sbjct:  166 IEAKDLCARFTTDVIGSCAFGLECN--SLQDPESQFRRMGRSVT----QEPLHSVLVQAFMFAQPELARKLRFRLFRPEVSEFFLDTVRQTLDYRRRENIHRNDLIQLLM--------------ELGEEG----------VKDA-LSFEQ------IAAQALVFFLAGFDTSSTTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLTYDSVQEMPYLDQVVAETLRKYPILPHLLRRSTKEYQIPNSNLILEPGSKIIIPVHSIHHDPELYPDPEKFDPSRFEPEEIKARHPFAYLPFGEGPRNCIGERFGKLQVKVGLVYLLRDFKFSRSEKT 464          
BLAST of EMLSAG00000004666 vs. GO
Match: - (symbol:Cyp9f2 "Cyp9f2" species:7227 "Drosophila melanogaster" [GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS] [GO:0009055 "electron carrier activity" evidence=ISS;NAS] [GO:0016020 "membrane" evidence=NAS] [GO:0020037 "heme binding" evidence=IEA] [GO:0005506 "iron ion binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA] [GO:0035220 "wing disc development" evidence=IMP] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PROSITE:PS00086 EMBL:AE014297 GO:GO:0005789 GO:GO:0005506 GO:GO:0004497 eggNOG:COG2124 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0035220 GO:GO:0016705 GeneTree:ENSGT00730000110591 OrthoDB:EOG7W6WKQ KO:K15003 EMBL:AY058466 RefSeq:NP_650189.1 UniGene:Dm.1169 ProteinModelPortal:Q9VG82 SMR:Q9VG82 BioGrid:66620 DIP:DIP-18506N MINT:MINT-309569 STRING:7227.FBpp0082070 PaxDb:Q9VG82 PRIDE:Q9VG82 EnsemblMetazoa:FBtr0082598 GeneID:41520 KEGG:dme:Dmel_CG11466 UCSC:CG11466-RA CTD:41520 FlyBase:FBgn0038037 InParanoid:Q9VG82 OMA:AHELMEN PhylomeDB:Q9VG82 GenomeRNAi:41520 NextBio:824228 Bgee:Q9VG82 Uniprot:Q9VG82)

HSP 1 Score: 100.523 bits (249), Expect = 3.681e-22
Identity = 86/367 (23.43%), Postives = 147/367 (40.05%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEIS-------------------------------------GVIHEKNNDTLF---------------LFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVD--EILVAPNELSPDITGGSWVTLKKR 314
            +D +D   R+T   IA   FG++ N F    +E  F +M   +T      + Q   F+ F        K   + L D  S  +F+ +V  +++ R++  + R D +++L+                       E    I  + TK +   +  +  +VA   +   AGF+T++ +M      L  +  VQ++L+EE+                                       V  E N D  F                 P   F+    ++E P  F+P  F++ENK     +++  FG G RNCIG RFA+L+ K  +Y L+  Y+F   +K+    E++ +  +LSP   GG W+ L +R
Sbjct:  180 LDMKDYCTRFTNDVIASTAFGLQVNSF--KDRENTFYQMGKKLTTFT---FLQSMKFMLFFALKG-LNKILKVELFDRKSTQYFVRLVLDAMKYRQEHNIVRPDMINMLM-----------------------EARGIIQTEKTKASAVREWSDRDIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKELTYEAIMGMKYLDQVVNEVLRKWPAAIAVDRECNKDITFDVDGQKVEVKKGDVIWLPTCGFHRDPKYFENPMKFDPERFSDENKESIQPFTYFPFGLGQRNCIGSRFALLEAKAVIYYLLKDYRFAPAKKSCIPLELITSGFQLSP--KGGFWIKLVQR 515          
BLAST of EMLSAG00000004666 vs. GO
Match: - (symbol:Cyp6a8 "Cytochrome P450-6a8" species:7227 "Drosophila melanogaster" [GO:0009055 "electron carrier activity" evidence=ISS;NAS] [GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS] [GO:0016020 "membrane" evidence=NAS] [GO:0005506 "iron ion binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0017143 "insecticide metabolic process" evidence=IDA] [GO:0048252 "lauric acid metabolic process" evidence=IDA] [GO:0018685 "alkane 1-monooxygenase activity" evidence=IDA] [GO:0031000 "response to caffeine" evidence=IDA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PROSITE:PS00086 EMBL:AE013599 GO:GO:0005789 GO:GO:0017143 GO:GO:0005506 GO:GO:0009055 GO:GO:0031000 eggNOG:COG2124 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0018685 GeneTree:ENSGT00730000110591 OrthoDB:EOG7W6WKQ KO:K14999 GO:GO:0048252 EMBL:L46859 PIR:JC5320 RefSeq:NP_523749.2 UniGene:Dm.6618 ProteinModelPortal:Q27593 SMR:Q27593 PaxDb:Q27593 EnsemblMetazoa:FBtr0087455 GeneID:36666 KEGG:dme:Dmel_CG10248 CTD:36666 FlyBase:FBgn0013772 InParanoid:Q27593 PhylomeDB:Q27593 GenomeRNAi:36666 NextBio:799758 Bgee:Q27593 Uniprot:Q27593)

HSP 1 Score: 99.7525 bits (247), Expect = 4.789e-22
Identity = 86/369 (23.31%), Postives = 150/369 (40.65%), Query Frame = 0
Query:    1 MVDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSP-------ISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVI--HEKN----------------NDTLFLF--------------------------------PNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLK 312
            +++ RD+V R+T   I    FG++ N       E L+    +++  R G             T  N F +  P       +    P  + F+  +V  ++  R+K  + R DF+D+L+    KN   K+  ++NG+                 +T +E      ++A   +  +AGF+T+SS M      LA +P +Q+K+  E+  VI  H++N                ++TL L+                                P+ A +     Y EP  F P  F+ E    R + ++L FG GPRNCIG+RF  +Q +  L  L+  +KF    KT + ++  P      +  G ++ ++
Sbjct:  172 VLEIRDLVARFTVDVIGTCAFGIQCNSLRDEKAEFLYFGKRSLVDKRHG-------------TLLNGFMRSYPKLARKLGMVRTAPHIQEFYSRIVTETVAVREKEHIKRNDFMDMLIE--LKNQ--KEMTLENGDVV-------------RGLTMEE------VLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTYECTKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPLVYDPKSFVLGVKDGIYLKVE 504          
BLAST of EMLSAG00000004666 vs. GO
Match: - (symbol:CYP3A12 "Cytochrome P450 3A12" species:9615 "Canis lupus familiaris" [GO:0005506 "iron ion binding" evidence=IEA] [GO:0016712 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] InterPro:IPR001128 InterPro:IPR002402 InterPro:IPR008072 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00464 PRINTS:PR01689 PROSITE:PS00086 GO:GO:0005506 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0016712 OrthoDB:EOG744TBS TreeFam:TF105087 KO:K07424 CTD:1576 GeneTree:ENSGT00730000110610 EMBL:AAEX03004276 RefSeq:XP_536868.2 UniGene:Cfa.48431 ProteinModelPortal:F1PDL2 Ensembl:ENSCAFT00000023623 GeneID:479740 KEGG:cfa:479740 OMA:FILHRAS Uniprot:F1PDL2)

HSP 1 Score: 97.4413 bits (241), Expect = 3.767e-21
Identity = 77/247 (31.17%), Postives = 106/247 (42.91%), Query Frame = 0
Query:   84 FFINMVKSSIENRKKSKVS-RGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQEL-ELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-----------------NDTLFLFP---------------------------NDAFNLCKDH--YEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKF 282
            FF   VK   ENR K K   R DF+ L+                             IN Q++K T   + L +L LVA  +I + AG++TTS+ ++ +   LA HP VQ+KL EEI      K                  N+TL L+P                              F L +D   + EPE F P  F+ +NK   + Y++L FG GPRNCIGMRFA++ MK  L R++  + F
Sbjct:  248 FFTKSVKRMKENRLKDKQKHRVDFLQLM-----------------------------INSQNSKETDTHKALSDLELVAQSIIFIFAGYETTSTSLSFLMYELATHPDVQQKLQEEIDATFPNKALPTYDALVQMEYLDMVLNETLRLYPIAGRLERVCKKDVEISGVFIPKGTVVMVPTFTLHRDQSLWPEPEEFRPERFSRKNKDSINPYTYLPFGTGPRNCIGMRFAIMNMKLALVRVLQNFSF 465          
BLAST of EMLSAG00000004666 vs. GO
Match: - (symbol:CYP3A4 "Cytochrome P450 3A4" species:9606 "Homo sapiens" [GO:0004497 "monooxygenase activity" evidence=IEA] [GO:0005506 "iron ion binding" evidence=IEA] [GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PROSITE:PS00086 GO:GO:0005506 GO:GO:0004497 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0016705 HGNC:HGNC:2637 EMBL:AC069294 ProteinModelPortal:E7EVM8 SMR:E7EVM8 PRIDE:E7EVM8 Ensembl:ENST00000354593 NextBio:35500671 ArrayExpress:E7EVM8 Bgee:E7EVM8 Uniprot:E7EVM8)

HSP 1 Score: 95.5153 bits (236), Expect = 4.440e-21
Identity = 64/190 (33.68%), Postives = 94/190 (49.47%), Query Frame = 0
Query:  140 INIQDTKVTFDEQEL-ELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-----------------NDTLFLFP---------------------------NDAFNLCKD--HYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKF 282
            I+ Q++K T   + L +L LVA  +I + AG++TTSS+++ +   LA HP VQ+KL EEI  V+  K                  N+TL LFP                             ++ L +D  ++ EPE F P  F+++NK     Y +  FG GPRNCIGMRFA++ MK  L R++  + F
Sbjct:  126 IDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSF 315          
BLAST of EMLSAG00000004666 vs. GO
Match: - (symbol:Cyp3a2 "Cytochrome P450 3A2" species:10116 "Rattus norvegicus" [GO:0005506 "iron ion binding" evidence=IEA] [GO:0005789 "endoplasmic reticulum membrane" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0070330 "aromatase activity" evidence=IEA] InterPro:IPR001128 InterPro:IPR002402 InterPro:IPR008072 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00464 PRINTS:PR01689 PROSITE:PS00086 RGD:708379 GO:GO:0005789 GO:GO:0005506 GO:GO:0017144 eggNOG:COG2124 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0070989 GO:GO:0032451 GO:GO:0070330 HOGENOM:HOG000039127 HOVERGEN:HBG108567 GO:GO:0050649 EMBL:M13646 EMBL:X79319 EMBL:X79320 EMBL:U09742 EMBL:U09734 EMBL:U09725 EMBL:U09726 EMBL:U09727 EMBL:U09728 EMBL:U09729 EMBL:U09730 EMBL:U09731 EMBL:U09732 EMBL:U09733 EMBL:BC089765 PIR:A25222 RefSeq:NP_695224.2 UniGene:Rn.225885 ProteinModelPortal:P05183 SMR:P05183 BindingDB:P05183 ChEMBL:CHEMBL3324 PaxDb:P05183 PRIDE:P05183 GeneID:266682 KEGG:rno:266682 CTD:266682 KO:K07424 SABIO-RK:P05183 NextBio:624480 Genevestigator:P05183 Uniprot:P05183)

HSP 1 Score: 97.0561 bits (240), Expect = 4.576e-21
Identity = 56/171 (32.75%), Postives = 84/171 (49.12%), Query Frame = 0
Query:  158 LVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-----------------NDTLFLFP--NDAFNLCK---------------------------DHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKF 282
            ++A  +I + AG++TTSS ++ +  +LA HP +Q+KL EEI G +  K                  N+TL L+P  N    +CK                            H+ +PE F+P  F++ENK     Y +L FG GPRNCIGMRFA++ MK  L +++  + F
Sbjct:  296 IIAQSVIFIFAGYETTSSTLSFVLYFLATHPDIQKKLQEEIDGALPSKAPPTYDIVMEMEYLDMVLNETLRLYPIGNRLERVCKKDIELDGLFIPKGSVVTIPTYALHHDPQHWPKPEEFHPERFSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSF 466          
BLAST of EMLSAG00000004666 vs. GO
Match: - (symbol:Cyp3a2 "cytochrome P450, family 3, subfamily a, polypeptide 2" species:10116 "Rattus norvegicus" [GO:0004497 "monooxygenase activity" evidence=ISO;IDA] [GO:0005496 "steroid binding" evidence=ISO] [GO:0005506 "iron ion binding" evidence=IEA;ISO] [GO:0005737 "cytoplasm" evidence=ISO] [GO:0005789 "endoplasmic reticulum membrane" evidence=IEA] [GO:0006706 "steroid catabolic process" evidence=ISO] [GO:0008202 "steroid metabolic process" evidence=ISO] [GO:0008395 "steroid hydroxylase activity" evidence=ISO] [GO:0009822 "alkaloid catabolic process" evidence=ISO] [GO:0016098 "monoterpenoid metabolic process" evidence=ISO] [GO:0016491 "oxidoreductase activity" evidence=ISO] [GO:0016712 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen" evidence=IEA] [GO:0017144 "drug metabolic process" evidence=ISO;IDA] [GO:0019899 "enzyme binding" evidence=ISO] [GO:0020037 "heme binding" evidence=IEA] [GO:0030343 "vitamin D3 25-hydroxylase activity" evidence=ISO] [GO:0032451 "demethylase activity" evidence=IDA] [GO:0034875 "caffeine oxidase activity" evidence=ISO] [GO:0036378 "calcitriol biosynthetic process from calciol" evidence=ISO] [GO:0042737 "drug catabolic process" evidence=ISO] [GO:0042738 "exogenous drug catabolic process" evidence=ISO] [GO:0046483 "heterocycle metabolic process" evidence=ISO] [GO:0050649 "testosterone 6-beta-hydroxylase activity" evidence=ISO;IMP] [GO:0055114 "oxidation-reduction process" evidence=ISO] [GO:0070330 "aromatase activity" evidence=IEA] [GO:0070576 "vitamin D 24-hydroxylase activity" evidence=ISO] [GO:0070989 "oxidative demethylation" evidence=ISO;IDA] InterPro:IPR001128 InterPro:IPR002402 InterPro:IPR008072 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00464 PRINTS:PR01689 PROSITE:PS00086 RGD:708379 GO:GO:0005789 GO:GO:0005506 GO:GO:0017144 eggNOG:COG2124 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0070989 GO:GO:0032451 GO:GO:0070330 HOGENOM:HOG000039127 HOVERGEN:HBG108567 GO:GO:0050649 EMBL:M13646 EMBL:X79319 EMBL:X79320 EMBL:U09742 EMBL:U09734 EMBL:U09725 EMBL:U09726 EMBL:U09727 EMBL:U09728 EMBL:U09729 EMBL:U09730 EMBL:U09731 EMBL:U09732 EMBL:U09733 EMBL:BC089765 PIR:A25222 RefSeq:NP_695224.2 UniGene:Rn.225885 ProteinModelPortal:P05183 SMR:P05183 BindingDB:P05183 ChEMBL:CHEMBL3324 PaxDb:P05183 PRIDE:P05183 GeneID:266682 KEGG:rno:266682 CTD:266682 KO:K07424 SABIO-RK:P05183 NextBio:624480 Genevestigator:P05183 Uniprot:P05183)

HSP 1 Score: 97.0561 bits (240), Expect = 4.576e-21
Identity = 56/171 (32.75%), Postives = 84/171 (49.12%), Query Frame = 0
Query:  158 LVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-----------------NDTLFLFP--NDAFNLCK---------------------------DHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKF 282
            ++A  +I + AG++TTSS ++ +  +LA HP +Q+KL EEI G +  K                  N+TL L+P  N    +CK                            H+ +PE F+P  F++ENK     Y +L FG GPRNCIGMRFA++ MK  L +++  + F
Sbjct:  296 IIAQSVIFIFAGYETTSSTLSFVLYFLATHPDIQKKLQEEIDGALPSKAPPTYDIVMEMEYLDMVLNETLRLYPIGNRLERVCKKDIELDGLFIPKGSVVTIPTYALHHDPQHWPKPEEFHPERFSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSF 466          
BLAST of EMLSAG00000004666 vs. C. finmarchicus
Match: gi|592781400|gb|GAXK01173168.1| (TSA: Calanus finmarchicus comp133932_c1_seq3 transcribed RNA sequence)

HSP 1 Score: 132.88 bits (333), Expect = 2.054e-33
Identity = 99/362 (27.35%), Postives = 165/362 (45.58%), Query Frame = 0
Query:   10 RYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNII---TGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEIS-----------------------GVIHEKNNDTL----------------FLFPNDAFNLCKDH---------------YEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            +++  +IA   FGV+A  FD   K+ LF++    I   +   G +   +++          F     I+++ P    FF+++++ +I++R++S   R D +DL+L    ++ +  + E    E+  Q+E D K++       FDE+     +V+  ++L+ AG+DTT+  +      L+  P +Q KL  E+                         VIHE    TL                +  P   + + KD                Y  PE FNP NF++E K  RS Y+FL FGQGPR CIGMRFA+L+ K  L  ++ ++ F R EKT +   + P  +   + GG W  +K+R
Sbjct:  342 KFSMDTIASCAFGVDAESFD--NKDSLFVKNAAQIFTFSLLDGLRIIGIHLIPGLAKIYEIFN----INVMHPKETGFFVDVIRKTIKHRRESTERRNDLIDLMLDAMSEDNAKVKTET---EDLDQYEKDMKLDHVSGIKDFDEK----TIVSTAMVLMAAGYDTTAMTLAFAAYELSKKPDIQIKLQNEVDEAYAAAEEGIPDYNTIQNLPYLDQVIHE----TLRMHPVFNMTRTCVVPEYKVPGTNYTIKKDERIMINVSGIHSDQKFYPNPEEFNPENFSKEAKSTRSPYAFLGFGQGPRACIGMRFALLEAKVGLAEVMKRFSFERCEKTAETPELDPTSILGYVKGGLWAKVKQR 1376          
BLAST of EMLSAG00000004666 vs. C. finmarchicus
Match: gi|592781401|gb|GAXK01173167.1| (TSA: Calanus finmarchicus comp133932_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 132.88 bits (333), Expect = 3.332e-33
Identity = 99/362 (27.35%), Postives = 165/362 (45.58%), Query Frame = 0
Query:   10 RYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNII---TGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEIS-----------------------GVIHEKNNDTL----------------FLFPNDAFNLCKDH---------------YEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            +++  +IA   FGV+A  FD   K+ LF++    I   +   G +   +++          F     I+++ P    FF+++++ +I++R++S   R D +DL+L    ++ +  + E    E+  Q+E D K++       FDE+     +V+  ++L+ AG+DTT+  +      L+  P +Q KL  E+                         VIHE    TL                +  P   + + KD                Y  PE FNP NF++E K  RS Y+FL FGQGPR CIGMRFA+L+ K  L  ++ ++ F R EKT +   + P  +   + GG W  +K+R
Sbjct:  666 KFSMDTIASCAFGVDAESFD--NKDSLFVKNAAQIFTFSLLDGLRIIGIHLIPGLAKIYEIFN----INVMHPKETGFFVDVIRKTIKHRRESTERRNDLIDLMLDAMSEDNAKVKTET---EDLDQYEKDMKLDHVSGIKDFDEK----TIVSTAMVLMAAGYDTTAMTLAFAAYELSKKPDIQIKLQNEVDEAYAAAEEGIPDYNTIQNLPYLDQVIHE----TLRMHPVFNMTRTCVVPEYKVPGTNYTIKKDERIMINVSGIHSDQKFYPNPEEFNPENFSKEAKSTRSPYAFLGFGQGPRACIGMRFALLEAKVGLAEVMKRFSFERCEKTAETPELDPTSILGYVKGGLWAKVKQR 1700          
BLAST of EMLSAG00000004666 vs. C. finmarchicus
Match: gi|592781402|gb|GAXK01173166.1| (TSA: Calanus finmarchicus comp133932_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 132.88 bits (333), Expect = 3.663e-33
Identity = 99/362 (27.35%), Postives = 165/362 (45.58%), Query Frame = 0
Query:   10 RYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNII---TGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEIS-----------------------GVIHEKNNDTL----------------FLFPNDAFNLCKDH---------------YEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            +++  +IA   FGV+A  FD   K+ LF++    I   +   G +   +++          F     I+++ P    FF+++++ +I++R++S   R D +DL+L    ++ +  + E    E+  Q+E D K++       FDE+     +V+  ++L+ AG+DTT+  +      L+  P +Q KL  E+                         VIHE    TL                +  P   + + KD                Y  PE FNP NF++E K  RS Y+FL FGQGPR CIGMRFA+L+ K  L  ++ ++ F R EKT +   + P  +   + GG W  +K+R
Sbjct:  763 KFSMDTIASCAFGVDAESFD--NKDSLFVKNAAQIFTFSLLDGLRIIGIHLIPGLAKIYEIFN----INVMHPKETGFFVDVIRKTIKHRRESTERRNDLIDLMLDAMSEDNAKVKTET---EDLDQYEKDMKLDHVSGIKDFDEK----TIVSTAMVLMAAGYDTTAMTLAFAAYELSKKPDIQIKLQNEVDEAYAAAEEGIPDYNTIQNLPYLDQVIHE----TLRMHPVFNMTRTCVVPEYKVPGTNYTIKKDERIMINVSGIHSDQKFYPNPEEFNPENFSKEAKSTRSPYAFLGFGQGPRACIGMRFALLEAKVGLAEVMKRFSFERCEKTAETPELDPTSILGYVKGGLWAKVKQR 1797          
BLAST of EMLSAG00000004666 vs. C. finmarchicus
Match: gi|592792800|gb|GAXK01161768.1| (TSA: Calanus finmarchicus comp35684_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 122.094 bits (305), Expect = 6.700e-30
Identity = 94/347 (27.09%), Postives = 164/347 (47.26%), Query Frame = 0
Query:    1 MVDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEP--LFMEMVNIITGRKGKKWR-QVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTS-SMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-----------------NDTL--FLFPNDAFNLCKDHYEEPEV----------------------FNPNNFTEEN---KIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEIL--VAPN 297
            +++++++  +YT  +IA +GFG+E N F    K+P  LF +    +   +G   +  V  F   +  P   +K    S++  G+  FF  +++ ++E R+++   R D +DLLL E  K   I  D+ +NG +                   ++ ++EL +++N +I   AGFDT+S ++ TV+F +L + P +Q++  +EI  V+ +                   N+ L  +   N+   LC   Y+ P+                       FNP     +N   K   +   F  FG GPRNCIGMR+A + +K  L + + KYK ++ EKTVD+++  VA N
Sbjct:  256 ILEAKEVFGKYTIDAIATSGFGIELNSF----KDPDSLFRQTALRMARAEGYSSKLDVLKFFIMIAVPK-LSKLLGFSMMPTGTIEFFAKIIRQTVEQRRETGTRRNDIIDLLLDEIKK---IGDDKTENGLKK------------------EDIDVELAVISNAIIFFFAGFDTSSLTLATVIFSFL-DKPAIQDRARQEIEDVVGDSKVITSDHLRDLKYLENVINEALRYYGLMNNTMRLCTKDYKIPDADFTIKKGMQVNVLTGCLAEECFFNPAELDPDNFDIKNNPNKIGFAGFGIGPRNCIGMRYAYIALKLALVKTITKYKVVKCEKTVDKLVFDVAKN 1215          
BLAST of EMLSAG00000004666 vs. C. finmarchicus
Match: gi|592792801|gb|GAXK01161767.1| (TSA: Calanus finmarchicus comp35684_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 121.709 bits (304), Expect = 1.142e-29
Identity = 91/340 (26.76%), Postives = 160/340 (47.06%), Query Frame = 0
Query:    1 MVDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEP--LFMEMVNIITGRKGKKWR-QVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTS-SMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-----------------NDTL--FLFPNDAFNLCKDHYEEPEV----------------------FNPNNFTEEN---KIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEI 292
            +++++++  +YT  +IA +GFG+E N F    K+P  LF +    +   +G   +  V  F   +  P   +K    S++  G+  FF  +++ ++E R+++   R D +DLLL E  K   I  D+ +NG +                   ++ ++EL +++N +I   AGFDT+S ++ TV+F +L + P +Q++  +EI  V+ +                   N+ L  +   N+   LC   Y+ P+                       FNP     +N   K   +   F  FG GPRNCIGMR+A + +K  L + + KYK ++ EKTVD++
Sbjct:  374 ILEAKEVFGKYTIDAIATSGFGIELNSF----KDPDSLFRQTALRMARAEGYSSKLDVLKFFIMIAVPK-LSKLLGFSMMPTGTIEFFAKIIRQTVEQRRETGTRRNDIIDLLLDEIKK---IGDDKTENGLKK------------------EDIDVELAVISNAIIFFFAGFDTSSLTLATVIFSFL-DKPAIQDRARQEIEDVVGDSKVITSDHLRDLKYLENVINEALRYYGLMNNTMRLCTKDYKIPDADFTIKKGMQVNVLTGCLAEECFFNPAELDPDNFDIKNNPNKIGFAGFGIGPRNCIGMRYAYIALKLALVKTITKYKVVKCEKTVDKL 1312          
BLAST of EMLSAG00000004666 vs. C. finmarchicus
Match: gi|592841635|gb|GAXK01115909.1| (TSA: Calanus finmarchicus comp168525_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 117.857 bits (294), Expect = 2.168e-28
Identity = 91/361 (25.21%), Postives = 157/361 (43.49%), Query Frame = 0
Query:    5 RDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKI-NIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNN--------------------------------------------------DTLFLFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            +D+  +++  ++A + FGV+A  F  + K+  F+   +     K +K       +  +   +   K   ++   P    FF +++  +I  R+++K  + D VDL++     +T + + +    EE  Q++ D K+ N   TK    +Q  EL +VA  ++LL+AG+DTT   ++ +   LA +P VQ KL EEI     E                                                     D +  +   + N   +H+  P  F P +F++E K  RS Y+F  FGQGPR CIGMRFA+L+ K  +  ++ K+ F    KT + ++  P         G WV ++ R
Sbjct:  683 KDVFGKFSLDALASSAFGVDAESF--TNKDSKFV--YHAAESFKQRKSDFAVFAVKLIPGVSQLFKWLKLNTFKPKQAKFFRDIILQTIRTRRETKERKNDMVDLMIDCIKDDTGVDETD----EELDQYDADMKLTNTSKTK----QQINELNVVATAMVLLIAGYDTTGMTLSYLAYELAKNPEVQSKLQEEIDQAFEESGGEFPDYNAVQSLPYLEMVIYETLRNHSPVALNTRVASKDYNLPGTDIVIKADDMVSWNARSLNFDPEHWTNPTEFRPEHFSKEEKANRSPYAFQTFGQGPRACIGMRFALLEAKVAVLSVLRKFSFKPGTKTTEPLVYDPEMELMWSKDGLWVHIEAR 1729          
BLAST of EMLSAG00000004666 vs. C. finmarchicus
Match: gi|592792798|gb|GAXK01161770.1| (TSA: Calanus finmarchicus comp35684_c1_seq4 transcribed RNA sequence)

HSP 1 Score: 116.316 bits (290), Expect = 2.801e-28
Identity = 88/334 (26.35%), Postives = 154/334 (46.11%), Query Frame = 0
Query:    1 MVDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEP--LFME-MVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTS-SMMTVMFVYLANHPIVQEKLFEEISGVI---------HEKN--------NDTLFLF----------------PNDAF-------------NLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLR 284
            +++++D+  ++T  +IA +GFG+E+N F    K P  +F +  + ++          +  F+    FP    +   +S+   G+  FF  +++ ++E R+KS   R D +DLLL           DEI  G E  + + D            D+ +++L L++N +I   AGFDT+S ++ TV+F ++   P +QEK  +EI  V+         H K+        N+ L  +                P+  F              L ++ +  P   +P+NF   N   +  + F  FGQGPRNCIGMR+A + +K  L + + KYK ++
Sbjct:    6 ILEAKDVFGKFTLDAIATSGFGIESNSF----KNPDSIFRKTALRMVRAEGYGSIMDIPKFIFLFVFPK-LARSLGVSIFPAGTSEFFAKILRQTVEERRKSGARRNDIIDLLL-----------DEINKGNEDSKPDEDK-----------DDTDVQLALISNAIIFFFAGFDTSSLTLATVIFSFM-QKPSIQEKARQEILDVVGDSKTITAEHLKDLKYLENVINEALRFYGITSNLQRICNKDYKVPDSDFTIIKGMTINVETSGLAEECFFNPSELDPDNFDPSNNPNK--FGFSGFGQGPRNCIGMRYAYIALKMALVKTLTKYKVVK 917          
BLAST of EMLSAG00000004666 vs. C. finmarchicus
Match: gi|592777364|gb|GAXK01177204.1| (TSA: Calanus finmarchicus comp141722_c2_seq1 transcribed RNA sequence)

HSP 1 Score: 117.087 bits (292), Expect = 5.229e-28
Identity = 95/353 (26.91%), Postives = 160/353 (45.33%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEP--LFMEMVNIIT----GRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEA-----PQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIH-------EKNNDTLFL-------------FPNDAFNLCKDHYEEP---------EVFN----------------------PNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEI 292
            +DS+DI  ++    IA +GFG+E+N F    K+P  +F +MV+ +        GK +    + L  +     +   +P     P    F  +++K +I +R+ +   R D +DL+         + Q E + G E       +FE DA +++   + T D+ + E +LV+N  +L +A  DTTSS +T +  +L  HP VQE+  +EI  VI        ++  D  ++             FP+     C   Y  P         EV N                      P NF   N     ++SFL FGQGPRNCIG R+AM+ +K  L  ++ K++ ++++ T +++
Sbjct:  589 IDSKDIFSKFALDGIATSGFGIESNSF----KDPDNIFRKMVSDVMRHPGSESGKPYEVAKIVLKGIIPAIQYVVSAPN--FSPKGTLFLKDVLKKTIAHRETTHTKRNDIIDLI---------VDQMENKKGAETKREFESKFEEDAALDMSGVQETKDKVDKEKILVSNAFLLFVAALDTTSSTLTFIMHFLLKHPEVQERARDEIMEVIGTSKKITFDQIQDLKYMDKVIYETLRHYHPFPHIIERECTKDYLIPGTDYVVKKGEVVNFTFLYERMKKDNESFYNSSEYDPENFDASN--NPDSFSFLGFGQGPRNCIGKRYAMISIKIALVSILRKFRVVKSKNTTEKL 1596          
BLAST of EMLSAG00000004666 vs. C. finmarchicus
Match: gi|592792799|gb|GAXK01161769.1| (TSA: Calanus finmarchicus comp35684_c1_seq3 transcribed RNA sequence)

HSP 1 Score: 112.464 bits (280), Expect = 5.914e-27
Identity = 88/334 (26.35%), Postives = 156/334 (46.71%), Query Frame = 0
Query:    1 MVDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEP--LFMEMVNIITGRKGKKWR-QVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTS-SMMTVMFVYLANHPIVQEKLFEEISGVI---------HEKN--------NDTLFLF----------------PNDAFNLCK-------------DHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLR 284
            +++++++  +YT  +IA +GFG+E N F    K+P  LF +    +   +G   +  V  F   +  P   +K    S++  G+  FF  +++ ++E R+++   R D +DLLL E  K   I  D+ +NG +                   ++ ++EL +++N +I   AGFDT+S ++ TV+F ++   P +QEK  +EI  V+         H K+        N+ L  +                P+  F + K             + +  P   +P+NF   N   +  + F  FGQGPRNCIGMR+A + +K  L + + KYK ++
Sbjct:    6 ILEAKEVFGKYTIDAIATSGFGIELNSF----KDPDSLFRQTALRMARAEGYSSKLDVLKFFIMIAVPK-LSKLLGFSMMPTGTIEFFAKIIRQTVEQRRETGTRRNDIIDLLLDEIKK---IGDDKTENGLKK------------------EDIDVELAVISNAIIFFFAGFDTSSLTLATVIFSFM-QKPSIQEKARQEILDVVGDSKTITAEHLKDLKYLENVINEALRFYGITSNLQRICNKDYKVPDSDFTIIKGMTINVETSGLAEECFFNPSELDPDNFDPSNNPNK--FGFSGFGQGPRNCIGMRYAYIALKMALVKTLTKYKVVK 920          
BLAST of EMLSAG00000004666 vs. C. finmarchicus
Match: gi|592872005|gb|GAXK01085557.1| (TSA: Calanus finmarchicus comp78114_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 112.464 bits (280), Expect = 2.084e-26
Identity = 82/288 (28.47%), Postives = 132/288 (45.83%), Query Frame = 0
Query:   79 PGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKIN-IQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISG-----------------------VIHE----------------------------KNNDTLFLFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            P    FF +++  +I+ RK SK  + D VDL+L          Q +  + E A Q+E D K+N  + +K   DE    + +VA  ++LL+AG+DTT   ++ +   ++ +P VQ+KL EEI                         VIHE                            K  D +  +     +   +H+  P  F P +F++E K  R+ Y+F AFGQGPR CIGMRFA+L+ K  +  ++ KY F+   KT++ +++        + GG W  ++ R
Sbjct:  856 PKETRFFRDVILQTIKARKASKERKNDLVDLMLDCI---KDDAQVDDGDDEIADQYEKDMKLNHSKKSKNNLDE----MTVVATAMVLLVAGYDTTGMTLSFLAYEMSKNPEVQKKLQEEIDQAYDESDGEMPDYSVIQSLPYLDMVIHETLRVHSPVGVNSRVAAKDYSIPGTDIVLKTGD-MVSWNARTLHRNPEHWSNPTEFYPEHFSKEAKANRNPYAFQAFGQGPRACIGMRFALLEAKVAVLSVLRKYSFMPGTKTIEPLVIDAESQLAWVKGGLWARVEMR 1695          
BLAST of EMLSAG00000004666 vs. L. salmonis peptides
Match: EMLSAP00000004666 (pep:novel supercontig:LSalAtl2s:LSalAtl2s242:969444:971852:1 gene:EMLSAG00000004666 transcript:EMLSAT00000004666 description:"augustus_masked-LSalAtl2s242-processed-gene-9.0")

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 316/316 (100.00%), Postives = 316/316 (100.00%), Query Frame = 0
Query:    1 MVDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNNDTLFLFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKRRA 316
            MVDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNNDTLFLFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKRRA
Sbjct:    1 MVDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNNDTLFLFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKRRA 316          
BLAST of EMLSAG00000004666 vs. L. salmonis peptides
Match: EMLSAP00000006058 (pep:novel supercontig:LSalAtl2s:LSalAtl2s327:9124:12815:1 gene:EMLSAG00000006058 transcript:EMLSAT00000006058 description:"augustus_masked-LSalAtl2s327-processed-gene-0.0")

HSP 1 Score: 230.335 bits (586), Expect = 1.072e-71
Identity = 125/220 (56.82%), Postives = 150/220 (68.18%), Query Frame = 0
Query:    1 MVDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNNDTLFLFPNDAFNL 220
            M+DSR I+ RYTT+SIAKAGFGVEA CFD ++ E  FM  V+IIT RKG KWRQ  +F  FL  PNW  K  PIS LDP S+ FFI M++ SIE+RKKS V+RGDFVDLL+ E+ K  S K  E  + EE  QF+ DAKI   + K   D++ELE +L+ANV ILL AGF+TTSSMMT M VYLAN+P VQEKL EEI   I    N    L  N+   +
Sbjct:  174 MIDSRYIISRYTTESIAKAGFGVEAGCFD-TIDESPFMNNVDIITSRKGSKWRQALVFALFLFLPNWLVKILPISFLDPKSQDFFIKMIEGSIEHRKKSNVTRGDFVDLLIQEYNKIES-KGQEKGDEEEITQFDKDAKIQKMNLK-ALDKEELETLLIANVFILLFAGFETTSSMMTAMLVYLANYPEVQEKLLEEIFDTIQNNTNQNGILSYNEIMGM 390          
BLAST of EMLSAG00000004666 vs. L. salmonis peptides
Match: EMLSAP00000009405 (pep:novel supercontig:LSalAtl2s:LSalAtl2s5:994028:996076:1 gene:EMLSAG00000009405 transcript:EMLSAT00000009405 description:"augustus_masked-LSalAtl2s5-processed-gene-10.0")

HSP 1 Score: 68.5514 bits (166), Expect = 3.419e-13
Identity = 58/242 (23.97%), Postives = 99/242 (40.91%), Query Frame = 0
Query:   86 INMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEI--------------SGVIHEK-------------------------NNDTLFLFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKT 288
            I +  S I NR+   + + DF+++L+ E  KN +   +E+ N E                           ++ A  +I  +AG+ TTS  +  +   LA +P +Q++L++EI              S VI E                           N T+   P  A +   + +  PE F P  F +EN  +    +F  FG G R CI  RFAM++++  + +LV K++ +   +T
Sbjct:  244 IKIANSIIANRETENIKKKDFINVLV-EMRKNNNECPNELLNNE---------------------------IITAQAVIFFVAGYVTTSHSLCCLIYVLATNPEIQDQLYQEILSSEDQGFDEHSYTSAVIKEALRLYPPATMHTRVCTHDTEVEGIFIKNGTIIEMPIYASHYYPEFFPNPEEFKPERFFKENNSEIIPDTFRPFGDGNRICIAYRFAMMELQIVIEKLVKKFEIIPTHET 457          
BLAST of EMLSAG00000004666 vs. L. salmonis peptides
Match: EMLSAP00000012088 (pep:novel supercontig:LSalAtl2s:LSalAtl2s865:171159:172708:-1 gene:EMLSAG00000012088 transcript:EMLSAT00000012088 description:"maker-LSalAtl2s865-snap-gene-0.12")

HSP 1 Score: 62.7734 bits (151), Expect = 3.191e-11
Identity = 63/247 (25.51%), Postives = 102/247 (41.30%), Query Frame = 0
Query:   85 FINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEI--------------SGVIHEKNNDTLFLFPNDAFNL---CKD---------------------HYE-----EPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKT 288
             I +  S IE R+   + + DF+++L+ +  K +    + + N E                           ++ A  +I  +AG+ TTS+ +  +   LA HP +QEKL++EI              S VI E    TL ++P  A +L    KD                     HY       P  F P  F +EN ++    ++  FG G R+CI  RFAM++ +  L +LV K++ L   +T
Sbjct:  255 LIKIANSIIETRESHNIEKKDFLNVLV-QMRKKSHEDPNTLLNDE---------------------------IITAQAIIFFIAGYSTTSTTLCCLTYMLATHPEIQEKLYKEIVSSEDKDFSEHSYTSAVIKE----TLRMYPPVALHLRVCAKDTEVEGIPIKKGTIIEMPIYASHYNPEFFPNPNEFKPERFFQENNLEIIPNTYRPFGNGNRSCIAYRFAMMEXQLILEKLVKKFEILPTHET 469          
BLAST of EMLSAG00000004666 vs. L. salmonis peptides
Match: EMLSAP00000005269 (pep:novel supercontig:LSalAtl2s:LSalAtl2s281:237457:238966:1 gene:EMLSAG00000005269 transcript:EMLSAT00000005269 description:"maker-LSalAtl2s281-snap-gene-2.7")

HSP 1 Score: 60.8474 bits (146), Expect = 1.386e-10
Identity = 47/168 (27.98%), Postives = 72/168 (42.86%), Query Frame = 0
Query:  161 NVLILLMAGFDTTSSMMTVMFVY-LANHPIVQEKLFEEI--------------SGVIHEK-------------------------NNDTLFLFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKT 288
            NVL+ +     +T+SM      Y LA HP +QEKL++EI              S VI E                           N T+   P  A +   + +  P  F P  F +EN ++    ++  FG G R+CI  RFAM++++  L +LV K++ L   +T
Sbjct:  261 NVLVQMRKKSYSTTSMTLCCLTYILATHPEIQEKLYKEIVSSQDKDFSEHSYTSAVIKETLRMYPPVTLHLRACVKDTEVEGILIKNGTIVEMPIYASHYNPEFFPTPNEFKPERFFQENNLEIIPNTYRPFGDGNRSCIAYRFAMMELQLILEKLVKKFEILPTHET 428          
BLAST of EMLSAG00000004666 vs. L. salmonis peptides
Match: EMLSAP00000010829 (pep:novel supercontig:LSalAtl2s:LSalAtl2s71:248776:254023:1 gene:EMLSAG00000010829 transcript:EMLSAT00000010829 description:"maker-LSalAtl2s71-snap-gene-2.17")

HSP 1 Score: 55.0694 bits (131), Expect = 7.837e-9
Identity = 50/213 (23.47%), Postives = 88/213 (41.31%), Query Frame = 0
Query:   77 LDPGSKSFF-INMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNNDTLFLFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKT 288
            L PG   +  I +  S I++R+   + + DF+++L+ E  KN     +E+ N E                           ++ A  ++  +AG+  TS  +  +   LA +P +QE +++EI   +  K+ D              D +       PN             +F  FG G R CI  RFAM++++  L +LV K++ L   +T
Sbjct:  226 LFPGMIGYMNIQVANSIIDSRESGNIKKKDFINVLV-EMRKNNLENPNELLNKE---------------------------IITAQAVLFFVAGYAXTSISLCNLIFILATNPEIQEAIYKEI---VSSKDEDF-------------DEHSYTSAIIPN-------------TFRPFGDGNRICIAYRFAMMELQIILEKLVKKFQILPTHET 381          
BLAST of EMLSAG00000004666 vs. SwissProt
Match: gi|6166033|sp|P05183.2|CP3A2_RAT (RecName: Full=Cytochrome P450 3A2; AltName: Full=CYPIIIA2; AltName: Full=Cytochrome P450-PCN2; AltName: Full=Cytochrome P450/6-beta-A; AltName: Full=Testosterone 6-beta-hydroxylase)

HSP 1 Score: 97.0561 bits (240), Expect = 2.961e-21
Identity = 56/171 (32.75%), Postives = 84/171 (49.12%), Query Frame = 0
Query:  158 LVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-----------------NDTLFLFP--NDAFNLCK---------------------------DHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKF 282
            ++A  +I + AG++TTSS ++ +  +LA HP +Q+KL EEI G +  K                  N+TL L+P  N    +CK                            H+ +PE F+P  F++ENK     Y +L FG GPRNCIGMRFA++ MK  L +++  + F
Sbjct:  296 IIAQSVIFIFAGYETTSSTLSFVLYFLATHPDIQKKLQEEIDGALPSKAPPTYDIVMEMEYLDMVLNETLRLYPIGNRLERVCKKDIELDGLFIPKGSVVTIPTYALHHDPQHWPKPEEFHPERFSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSF 466          
BLAST of EMLSAG00000004666 vs. SwissProt
Match: gi|11386701|sp|Q9V773.2|C6A20_DROME (RecName: Full=Probable cytochrome P450 6a20; AltName: Full=CYPVIA20)

HSP 1 Score: 97.0561 bits (240), Expect = 3.012e-21
Identity = 83/327 (25.38%), Postives = 137/327 (41.90%), Query Frame = 0
Query:    6 DIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEM-VNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNN-------------------------------------------------DTLFLFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKF 282
            ++V R+T   I    FG++  C  LS  +  F++M    IT R+  K   + +F      P    K    + +    + F++N+++ +++ R K+ V R DFVD+L+        +K D   NG+             ++  +TF+E      + A   I  +AGF+T+S+ M      LA H  +Q+KL  EI+ V+ + N                                                   T  + P  A +   + Y EPE F P  F E+   +R   +FL FG GPRNCIG+RF  +Q+   +  L++ +KF
Sbjct:  176 NVVARFTADVIGSCAFGLD--CHSLSDPKAKFVQMGTTAITERRHGKSMDLLLFGA----PELAAKLRMKATVQE-VEDFYMNIIRDTVDYRVKNNVKRHDFVDMLI-----EMKLKFD---NGD-------------KENGLTFNE------IAAQAFIFFLAGFETSSTTMGFALYELACHQDIQDKLRTEINTVLKQHNGKLDYDSMREMTYLEKVIDETMRKRPVVGHLIRVATQHYQHTNPKYNIEKGTGVIVPTLAIHHDPEFYPEPEKFIPERFDEDQVQQRPACTFLPFGDGPRNCIGLRFGRMQVIVGMALLIHNFKF 468          
BLAST of EMLSAG00000004666 vs. SwissProt
Match: gi|12644217|sp|P33270.2|CP6A2_DROME (RecName: Full=Cytochrome P450 6a2; AltName: Full=CYPVIA2; AltName: Full=Cytochrome P450-B1)

HSP 1 Score: 96.6709 bits (239), Expect = 4.242e-21
Identity = 83/363 (22.87%), Postives = 150/363 (41.32%), Query Frame = 0
Query:    1 MVDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN------------------NDTLFLF--------------------------------PNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKK 313
            +++ ++++ R+TT  I    FG+E N     V +   M        R GK    + MF+   +FP   ++   + ++      FF+ +V  +I  R++    R DF++LL+ E  +   +  D   NGE     +                      L A V +  +AGF+T+SS M+     LA +  +Q++L  EI  V+ E+                   ++TL L+                                P  A++  +D Y  PE F+P  F+ E    R +  +L FG GPRNCIGMRF  +Q +  L +++ +++    + T   +  +P  +     GG ++ +++
Sbjct:  172 VLEIKELMARFTTDVIGTCAFGIECNTLRTPVSDFRTMGQKVFTDMRHGK---LLTMFV--FSFPKLASRLR-MRMMPEDVHQFFMRLVNDTIALRERENFKRNDFMNLLI-ELKQKGRVTLD---NGEVIEGMDIGE-------------------LAAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLTYESIKAMTYLNQVISETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYPNPETFDPERFSPEKVAARESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVCDTTEIPLKYSPMSIVLGTVGGIYLRVER 505          
BLAST of EMLSAG00000004666 vs. SwissProt
Match: gi|2506240|sp|P51538.2|CP3A9_RAT (RecName: Full=Cytochrome P450 3A9; AltName: Full=3AH15; AltName: Full=CYPIIIA9; AltName: Full=Cytochrome P450 olfactive 3; AltName: Full=Cytochrome P450-OLF3)

HSP 1 Score: 95.9005 bits (237), Expect = 7.641e-21
Identity = 88/326 (26.99%), Postives = 139/326 (42.64%), Query Frame = 0
Query:    5 RDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSK-VSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELV-LVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-----------------NDTLFLFPNDA---------------------------FNLCKD--HYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKF 282
            +DI   Y+   I    FGV  +  + + ++P F+E V  +   K   +  +++ +    F     +   +S+       FF   V+   ENR K K   R DF+ L+                             IN Q++KV    + L  V +VA  +I + AG++TTSS ++ +   LA HP +Q+KL +EI   +  K                  N+TL L+P                              F L KD  ++ EPE F P  F+++N+   + Y +L FG GPRNCIGMRFA++ MK  L+R++  + F
Sbjct:  173 KDIFGAYSMDVITATSFGVNVDSLN-NPQDP-FVEKVKKLL--KFDIFDPLFLSVTLFPFLTPLFEALNVSMFPRDVIDFFKTSVERMKENRMKEKEKQRMDFLQLM-----------------------------INSQNSKVKDSHKALSDVEIVAQSVIFIFAGYETTSSALSFVLYLLAIHPDIQKKLQDEIDAALPNKAHATYDTLLQMEYLDMVVNETLRLYPIAGRLERVCKTDVEINGVFIPKGTVVMIPTFALHKDPHYWPEPEEFRPERFSKKNQDNINPYMYLPFGNGPRNCIGMRFALMNMKVALFRVLQNFSF 465          
BLAST of EMLSAG00000004666 vs. SwissProt
Match: gi|116241312|sp|P08684.4|CP3A4_HUMAN (RecName: Full=Cytochrome P450 3A4; AltName: Full=1,8-cineole 2-exo-monooxygenase; AltName: Full=Albendazole monooxygenase; AltName: Full=Albendazole sulfoxidase; AltName: Full=CYPIIIA3; AltName: Full=CYPIIIA4; AltName: Full=Cholesterol 25-hydroxylase; AltName: Full=Cytochrome P450 3A3; AltName: Full=Cytochrome P450 HLp; AltName: Full=Cytochrome P450 NF-25; AltName: Full=Cytochrome P450-PCN1; AltName: Full=Nifedipine oxidase; AltName: Full=Quinine 3-monooxygenase; AltName: Full=Taurochenodeoxycholate 6-alpha-hydroxylase)

HSP 1 Score: 95.5153 bits (236), Expect = 9.599e-21
Identity = 64/190 (33.68%), Postives = 94/190 (49.47%), Query Frame = 0
Query:  140 INIQDTKVTFDEQEL-ELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-----------------NDTLFLFP---------------------------NDAFNLCKD--HYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKF 282
            I+ Q++K T   + L +L LVA  +I + AG++TTSS+++ +   LA HP VQ+KL EEI  V+  K                  N+TL LFP                             ++ L +D  ++ EPE F P  F+++NK     Y +  FG GPRNCIGMRFA++ MK  L R++  + F
Sbjct:  276 IDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSF 465          
BLAST of EMLSAG00000004666 vs. SwissProt
Match: gi|3913302|sp|O18993.1|CP3AL_CALJA (RecName: Full=Cytochrome P450 3A21; AltName: Full=CYPIIIA21; AltName: Full=Cytochrome P450 CM3A-10)

HSP 1 Score: 94.7449 bits (234), Expect = 1.681e-20
Identity = 63/190 (33.16%), Postives = 91/190 (47.89%), Query Frame = 0
Query:  140 INIQDTKVTFDEQEL-ELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-----------------NDTLFLF-----------------------------PNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKF 282
            I+ Q++K T  ++ L +L LVA  +I + AG++TTSS ++ +   LA HP VQ+KL EEI  V+  K                  N+TL LF                             P+ A +    ++ EPE F P  F++ NK     Y +  FG GPRNCIGMRFA++ MK  L R++  + F
Sbjct:  276 IDSQNSKETESDKALSDLELVAQSIIFIFAGYETTSSTLSFIMYELATHPDVQQKLQEEIDAVLPNKAPATYDTVLQMEYLDMVVNETLRLFPLAMRLERVCKKDVEINGVFIPKGVVVMIPSYALHYDPKYWTEPEKFLPERFSKNNKDNIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSF 465          
BLAST of EMLSAG00000004666 vs. SwissProt
Match: gi|117162|sp|P24463.1|CP3AC_CANFA (RecName: Full=Cytochrome P450 3A12; AltName: Full=CYPIIIA12; AltName: Full=Cytochrome P450-PBD-1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.052e-20
Identity = 63/190 (33.16%), Postives = 90/190 (47.37%), Query Frame = 0
Query:  140 INIQDTKVTFDEQEL-ELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-----------------NDTLFLFP---------------------------NDAFNLCKDH--YEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKF 282
            IN Q++K     + L +L LVA  +I + AG++TTS+ ++ +   LA HP VQ+KL EEI      K                  N+TL L+P                              F L +D   + EPE F P  F+ +NK   + Y++L FG GPRNCIGMRFA++ MK  L R++  + F
Sbjct:  276 INSQNSKEMDTHKALSDLELVAQSIIFIFAGYETTSTSLSFLMYELATHPDVQQKLQEEIDATFPNKALPTYDALVQMEYLDMVLNETLRLYPIAGRLERVCKKDVEISGVFIPKGTVVMVPTFTLHRDQSLWPEPEEFRPERFSRKNKDSINPYTYLPFGTGPRNCIGMRFAIMNMKLALVRVLQNFSF 465          
BLAST of EMLSAG00000004666 vs. SwissProt
Match: gi|341940389|sp|Q64481.2|CP3AG_MOUSE (RecName: Full=Cytochrome P450 3A16; AltName: Full=CYPIIIA16)

HSP 1 Score: 94.3597 bits (233), Expect = 2.513e-20
Identity = 74/256 (28.91%), Postives = 106/256 (41.41%), Query Frame = 0
Query:   74 ISLLDPGSKSFFINMVKSSIENRKKSKVS-RGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-----------------NDTLFLFP--NDAFNLCK---------------------------DHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKF 282
            I +    S  FF   V    ENR  SK   R DF+ L++  + K+                         +D+     E E+     A  +I + AG++TTSS+++     LA HP +Q+KL EEI   +  K                  N+TL L+P  N    +CK                            H+ EPE F P  F++ENK     Y +L FG GPRNCIGMRFA++ MK  L +++  + F
Sbjct:  238 ICMFPKDSIEFFKKFVDRMTENRLDSKQKHRVDFIYLMMEAYNKSKD-----------------------KDSHKALSEIEI----TAQSIIFIFAGYETTSSILSFTVYSLATHPDIQKKLQEEIDEALPNKAPPTYDTVMAMEYLDMVLNETLRLYPITNRLQRVCKKDVEINGIYIPKGSTVIIPSYVLHHDPQHWPEPEEFQPERFSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALIKVLQNFSF 466          
BLAST of EMLSAG00000004666 vs. SwissProt
Match: gi|5921922|sp|O70537.1|CP3AV_MESAU (RecName: Full=Cytochrome P450 3A31; AltName: Full=CYPIIIA31; AltName: Full=Cytochrome P450 SH3A-1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.868e-20
Identity = 89/329 (27.05%), Postives = 138/329 (41.95%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQV----YMFLCFLTFPNWFTKHSP--ISLLDPGSKSFFINMVKSSIENR-KKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-----------------NDTLFLFPNDAF--NLCKD----------------------HYE-----EPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLV 277
            V ++++   Y+   I    FGV  +  + + K+ L+          KG+K  +      +FL  + FP     +    +S+    S SFF   V  + ENR   ++  R DF+ L++                         ++  N +D+     + E+    +A  +I + AG+DTTSS ++     LA HP VQ+KL EEI   +  K                  N+TL L+P  +    +CK                       HY+     EPE F P  F++ENK     Y FL FG GPRNCIGMRFA++ MK  L +++
Sbjct:  170 VTTKEVFGAYSMDVITSTAFGVSVDSLN-NPKDLLW----------KGRKLLRFDFFDPLFLSVVLFPFLIPIYEKLNVSMFPKDSISFFRKFVDKTKENRLDYNQKHRVDFLQLMM-------------------------NSHDNSKDSHKALSDMEI----IAQSIIFIFAGYDTTSSTLSFALYLLATHPDVQKKLQEEIDIALPNKARPSYDKVMEMEYLDMVLNETLRLYPIGSRLERVCKQDVEMDGVFVPKGSIVMVPVFALHYDPQYWPEPEKFRPERFSKENKGSIDPYIFLPFGNGPRNCIGMRFALMNMKLALTKVL 458          
BLAST of EMLSAG00000004666 vs. SwissProt
Match: gi|5921921|sp|P79401.1|CP3AT_PIG (RecName: Full=Cytochrome P450 3A29; AltName: Full=CYPIIIA29)

HSP 1 Score: 93.5893 bits (231), Expect = 5.097e-20
Identity = 96/333 (28.83%), Postives = 140/333 (42.04%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPI------SLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-----------------NDTLFLFPNDAF--NLCK---------------------------DHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKF 282
            V  +DI   Y+   I    FGV  +  + + ++P F+E          KK  +   F  FL    +F   +PI      +L    S +FF   VK   E+R   +  R   VDLL  +   N+       QN +E             D   +   +EL    VA  +I + AG++TTSS ++++   LA HP VQ+KL EEI      K                  N+TL L+P  A     CK                           D + EPE F P  F++++K   + Y++L FG GPRNCIGMRFA++ MK  L R++  + F
Sbjct:  170 VTMKDIFGAYSMDVITSTAFGVNIDSLN-NPQDP-FVE--------NSKKLLKFSFFDPFLLSLIFFPFLTPIFEVLNITLFPKSSVNFFTKSVKRMKESRLTDQQKRR--VDLL--QLMINS-------QNSKE------------MDPHKSLSNEEL----VAQGIIFIFAGYETTSSALSLLAYELATHPDVQQKLQEEIEATFPNKAPPTYDALAQMEYLDMVVNETLRLYPIAARLERACKKDVEIHGVFVPKGTVVVVPVFVLHRDPDLWPEPEEFRPERFSKKHKDTINPYTYLPFGTGPRNCIGMRFALMNMKLALVRVLQNFSF 465          
BLAST of EMLSAG00000004666 vs. Select Arthropod Genomes
Match: gb|EFA12635.1| (cytochrome P450 6BK3 [Tribolium castaneum])

HSP 1 Score: 132.494 bits (332), Expect = 3.689e-34
Identity = 108/366 (29.51%), Postives = 165/366 (45.08%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCF-----LTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNND------------------TLFLFPNDAFNLCK-------------------------------DHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKK 313
            ++ ++++  +TT  I    FG++  C  L  +   F +         GKK  ++ +          TFP+ F K   +S        F ++MV+ +IE R+K+  SR DF+ LL+            +++N +  P+ + D K       +T DE      + +  ++   AGF+T+S++MT  F  LA +P +Q+KL EEI+ ++ E NN+                  TL L P  A    K                               D+Y +PE F+P  FTEENK  R  Y+FL FG+GPRNCIGMRF +LQ K  L  L+  YKF  NEKT + I   P  +     G  W+  +K
Sbjct:  177 INIKEVLACFTTNIIGSCAFGLD--CKALEDENSPFRQF--------GKKLFKISVLHRLKRTFAATFPD-FAKFLRMSNSRKEIVKFIMDMVEGTIEYREKNNYSRNDFMQLLI------------DMKNNK--PKGDHDGK------PLTLDE------VASQAIVFFAAGFETSSTLMTFAFYELAKNPHIQDKLREEINLILAEHNNEISYDAIQEMKYLSQVIDETLRLHPPAAQTSRKCIKDYKIPDQDITIEKGTSVTVSILGIHHDPDYYPDPEKFDPERFTEENKSLRHNYAFLPFGEGPRNCIGMRFGLLQSKMGLVSLIKNYKFTVNEKTKEPITYQPAHVVLAAQGEIWLNAQK 505          
BLAST of EMLSAG00000004666 vs. Select Arthropod Genomes
Match: EAA08231.2 (AGAP002869-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 130.954 bits (328), Expect = 1.769e-33
Identity = 100/363 (27.55%), Postives = 162/363 (44.63%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNND-------------------------------------------------TLFLFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPN--ELSPDITGGSWVTLKK 313
            ++ +D++ RYTT  I    FG+E N   L   +  F++  N +  +K     ++ + L      + FT    + + D   ++FF+N+V+ ++E R+++ V R DF++LLL    KNT     ++  GEE         I   +  +T +E      L A V I  +AGF+T+S+ M      LA HP +QE+L  EI   + E   +                                                 T+   P  A +    +Y +PE F+P  F  E    R  Y ++ FG+GPR CIG+RF M+Q K  L  L+ +++F   E+T D I   PN   LSPD   G+++ ++K
Sbjct:  171 MEMKDVLARYTTDVIGTCAFGIECNT--LRNPDSDFLKYGNKVFEQKVSTMIKIILVLMGRKISSKFT----LKITDADVETFFMNLVRETVEYRERNNVKRNDFLNLLLQ--IKNTG----KLWEGEED-------HIGKGEVGMTMNE------LAAQVFIFFLAGFETSSTTMNFCLYELAKHPDIQERLRREIERAVEENGGELTYDVVMGTEYLNWVVDETLRKYPPLETVTRAPEHDYTVPGTAHVIPKGTMIQIPIYALHHDAQYYPDPERFDPERFRPEVANARPAYVYMPFGEGPRICIGLRFGMMQTKVGLITLLRQFRFSPTEQTPDRIRFMPNVFVLSPD--SGNYLEVEK 506          
BLAST of EMLSAG00000004666 vs. Select Arthropod Genomes
Match: EAL40825.1 (AGAP002868-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 129.413 bits (324), Expect = 6.192e-33
Identity = 98/362 (27.07%), Postives = 165/362 (45.58%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHS---PISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN------------------NDTLFLFPN-----------------------------DAFNLCKD--HYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTL 311
            ++ + ++ R+TT  I    FG+E N   L   +  F++      GR+  + R + M    +TF   F   +    + + D   ++FF+N+V  ++E+R+++ V R DF++LLL    KN    +++ Q G  +             T +T +E      L A V I  +AGF+T+S++M      LA +P +QE+L +E++  I                      N+TL  +P                                + +  D  HY EPE F+P+ F+ E    R+ Y+FL FG+GPR CIGMRF M+Q+K  L  +V  ++FL   +T D I+  P        GG+++ +
Sbjct:  172 LEMKAVLARFTTDVIGTCAFGIECNT--LRNPDSDFLKY-----GRRVFEHRMLAMVK--MTFAMLFRAQAVKLGVKVTDDDLEAFFMNLVHDTVEHRERNGVQRNDFLNLLLQ--IKNKGCLEEQEQEGSAS----------ADRTGMTMNE------LAAQVFIFFVAGFETSSTVMNFCLYELAKNPHIQERLRDELNRSIDANGGELTYDMVMGHEYLGQVVNETLRKYPPLETTLRVAGQDYTIPGTRHVIPRHVGVQIPVYAIHHDPAHYPEPECFDPDRFSAEACRNRTPYTFLPFGEGPRVCIGMRFGMMQVKVGLVSMVRAFRFLPTAQTPDRIVFDPKSFILSPAGGNYLRI 506          
BLAST of EMLSAG00000004666 vs. Select Arthropod Genomes
Match: gb|KYB25678.1| (putative cytochrome P450 9f2-like Protein [Tribolium castaneum])

HSP 1 Score: 130.183 bits (326), Expect = 1.130e-32
Identity = 105/367 (28.61%), Postives = 169/367 (46.05%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELEL---VLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISG------------------------------------------VIHEKN---------NDTLFLFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            V+ +D   ++T   IA   FG+E  C  L   E  F +M  +++  K   WR ++  L +  FP  F +   I  L P    FF+ ++K +I  R++  + R D + LLL    +   +K D+I++ E  P F       +Q++ +  +E+ L++   ++ A  L+  +AGF T+SS+M+ +   L  +P +Q+K+ +EI                                            VI  K             L   P  A +   + + +PE FNP  F++ENK K    S++ FG GPRNCIG RFA+L++K  L +L+ K+  +  +KTV  +  A   L  D  GG WV LKKR
Sbjct:  409 VEMKDTCTKFTNDVIANCAFGIE--CNSLLNPENEFYKMGTMVS--KPSPWR-LFKSLLYGFFPKIF-EFFRIPALPPTISDFFLRIIKDAIIVREQQGIVRPDMIHLLLEA--RKGRLKHDKIESNE--PGFA-----TVQESTIGQNEKSLQITDELITAQALVFFIAGFTTSSSLMSFLAYELVVNPEIQKKMQKEIDAFLDREFSYEQVLQMKYLDQVVSEALRKYPPGYVLNRICVKDYVIKPKQEGEKVAVIEKGCLVAIPVIALHYSPEFFPDPEKFNPERFSDENKGKILPGSYIPFGLGPRNCIGSRFALLEIKVLLVKLLAKFDLVPVDKTVIPLKFA-KTLGLDAKGGIWVGLKKR 759          
BLAST of EMLSAG00000004666 vs. Select Arthropod Genomes
Match: gb|KFM82631.1| (Cytochrome P450 3A13, partial [Stegodyphus mimosarum])

HSP 1 Score: 127.487 bits (319), Expect = 3.838e-32
Identity = 99/340 (29.12%), Postives = 157/340 (46.18%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLL---AEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELEL-VLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN------------------NDTLFLFP-----------------------------NDAFNLCKD--HYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKT 288
            V+++ I   +T   IA + F  + +  +    +  F++    +  R    WR    F+ F+ +P+ F K   IS+  PG  +FF  +    IE RKK+  +R DF+ LLL    E  K  +    E +  + A  ++ D   +    K  + ++ L L  LVA  +I  +AG+DTT+S +      LA +P VQ+KL  EI   I E N                  ++TL L+P                                + + +D  +Y EPE FNP+ FT E + KR  Y+FL FG GPRNC+GMRFA++++K CL  ++  ++  R  +T
Sbjct:  174 VEAKSIYGAFTMDIIASSAFSTKIDSHNDPNNK--FVQTAKNVFQR-NVSWR----FVLFVLWPS-FMKFFGISVFPPGPLNFFTEVTHQIIEERKKTGKTRNDFLQLLLDTAKEVTKEETSDASEKETEDIAQNYDDDNHQH-HVLKEIYSKKNLSLNELVAQCVIFFLAGYDTTASTLAFATYNLALNPDVQDKLIAEIDAAIKENNGELTYDAIQSMKLLDNVISETLRLYPPAIRTERVADADYKLGDTGIIIPKGMIVTTPVYAIHRDPKYYPEPEKFNPDRFTPEERAKREQYTFLPFGAGPRNCVGMRFALMEIKACLAEVLRNFRIKRCPQT 504          
BLAST of EMLSAG00000004666 vs. Select Arthropod Genomes
Match: gb|EFA02824.1| (cytochrome P450 6BQ11 [Tribolium castaneum])

HSP 1 Score: 125.176 bits (313), Expect = 2.200e-31
Identity = 100/366 (27.32%), Postives = 163/366 (44.54%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMF-----LCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNN------------------DTL----------------FLFPNDAFNLCK---------------DHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKK 313
             D +DI+ R+TT  I    FG+E N    S+K+P      +    + G+K  +V        +C L+ P+   +   +       + FF++ ++ ++  R+K+ + R DF+ LLL    KN     D+ +  +E        K N+++  +T +E      L A   +  +AGF+T+S+ MT     LA +  VQEKL  EI+ V+   +N                  +TL                +  PN +  L +               ++Y  PE F+P +F+EEN   R  +++L FG GPR CIG+RF MLQ K  L  L+  YK   ++KT   I + P        GG W+ ++K
Sbjct:  179 ADIKDILGRFTTDIIGSVAFGIECN----SLKDP------DAEFRKYGRKVFEVGFIDRLKTICILSLPHPVLRFFKLKFTKSDVEKFFMSAIRDTVNYREKNNIYRKDFMHLLLQ--LKNRGFVADDGKVTDE--------KENVKEKALTLNE------LSAQAFVFFLAGFETSSTTMTWALYELATNQDVQEKLRNEINNVLSRHDNKLTYEAMMEMTYMEKVIHETLRKYPPLPILTRKCNKDYTIPNTSIKLSRGTAVGIPVLALHTDPEYYSNPEKFDPEHFSEENVKTRPGFTWLPFGDGPRVCIGLRFGMLQSKVGLTALLKNYKIKLSKKTELPIKLDPKSFITTAKGGIWLDVEK 518          
BLAST of EMLSAG00000004666 vs. Select Arthropod Genomes
Match: gb|EEZ99338.1| (cytochrome P450 6BQ13 [Tribolium castaneum])

HSP 1 Score: 124.79 bits (312), Expect = 2.913e-31
Identity = 100/361 (27.70%), Postives = 165/361 (45.71%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEP--LFMEMVNI--ITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEI-QNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-----------------NDTLFLFPN-----------------------------DAFNLCKD--HYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWV 309
            VD+++I+ R+TT  I    FG+E N    S+K P   F + + +  + G     W+ +   + F+  P    K   + +++P   +FF+ +V+ ++  R+++ + R DF+ LLL    +   +  D I QN  +A           ++ +VT    EL     A   +  +AG++T+S+ MT     LA++P +Q+KL  EI+ V+ +                   N+TL  +P                                  L +D  ++  PE F+P  FTEENK +R  Y++L FG+GPR CIG+RF M+Q K  L  L+  YKF  N KT   + + P        GG W+
Sbjct:  178 VDAKNILARFTTDIIGSCAFGIECN----SLKNPNDEFTQYLKLFFVEGF----WQNLNGIITFVA-PE-LAKKLNMKVVNPVLSNFFMKVVEDTVNMRERNNIYRKDFMHLLLQLKNRGELVDDDSILQNNTDA-----------ENKEVTLTLNEL----AAQAFVFFLAGYETSSTTMTFCLYELASNPEIQDKLRAEINEVLQKHGKLTYDAIMEMRYMDKVVNETLRKYPPLPGLNRVCNKEYKVPGTDFVIEKGTKIWIPVLGLHRDPEYFPNPEKFDPERFTEENKRQRHPYTYLPFGEGPRICIGLRFGMMQTKVGLSVLLKNYKFSINSKTKLPLQLDPKSFIMSTEGGIWL 513          
BLAST of EMLSAG00000004666 vs. Select Arthropod Genomes
Match: gb|EFA02825.1| (cytochrome P450 6BQ12 [Tribolium castaneum])

HSP 1 Score: 124.79 bits (312), Expect = 3.109e-31
Identity = 103/367 (28.07%), Postives = 161/367 (43.87%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKK------WRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNND------------------TLFLFP--------------------------NDAFNLCKDH-----YEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKK 313
            V+ ++I+ R+TT  I   GFG+E N    S+K+P      + +  + GKK        Q+   L F   PN   K     + +   + FF+  V+ ++  R+K+ + R DF+ LLL    + T    ++I           D     Q+  +T +E      L A   +  +AGF+T+S+ MT     LA +P +QEKL  EI  V+ + NN+                  TL  +P                          + A  +   H     Y  PEVF+P  F EENK  R+ +++L FG GPR CIG+RF M+Q K  L  L+  Y+   N+KT   + ++ N       GG W+ ++K
Sbjct:  179 VNIKNILERFTTDIIGSVGFGIECN----SLKDP------DSLFPKYGKKVFDLTPAEQLKQSLLFF-LPNPVLKAMKFRITNKDVEDFFMKTVRETVLYREKNNIYRKDFMHLLLQLKNRGTVTDDEKI----------IDHSNQKQEPALTMNE------LTAQAFVFFLAGFETSSTTMTFALYELATNPDIQEKLRNEICTVLEKHNNELTYNAIAEMTYMDQVLHETLRKYPPLPILQRQCNKDYIVPETNIRIPKGVDVAITILALHRDPEFYPNPEVFDPERFNEENKNARTPFTWLPFGDGPRVCIGLRFGMMQSKVGLTALLKDYRVTLNKKTKVPLEMSKNSFIIAAEGGIWLDIEK 518          
BLAST of EMLSAG00000004666 vs. Select Arthropod Genomes
Match: EEB15938.1 (cytochrome P-450, putative [Pediculus humanus corporis])

HSP 1 Score: 119.783 bits (299), Expect = 1.631e-29
Identity = 94/367 (25.61%), Postives = 164/367 (44.69%), Query Frame = 0
Query:    1 MVDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRK---GKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNND-------------------TLFLFPN-------------------------------DAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            M+D+RD + RYT   I    FG++ N      ++  F+ M     G+K     ++ +V   +    +  W  K   + ++      FFIN+V +++  R+++ V R DF+  L+    K    K  ++++ +E           +++  +   E  +  V+ A   +  +AG++T+SS M+     LA+HP +QEKL+EE++ V+  K ND                   TL L+P                                 AF+   +++ +PE FNP  F+ EN+     Y+++ FG GPR CIG R AM++MK  L  ++  +K L+ EKT     + P+        G W+ + KR
Sbjct:  180 MLDARDFLGRYTVDIIGNVAFGIDVNAMK---EDSEFLHM-----GQKFFEPTQFERVGQIIANTNY--WMYKIFKLRMVSKKVTDFFINVVNNTMTYRRENNVERNDFLHFLM----KINETKGTDLKDMDEMK--------GVKNYNMAVSENSIG-VIAAQAFVFFVAGYETSSSAMSACLFELAHHPEIQEKLYEEVTQVL--KTNDDVTYDSVQQLTYTEQVLEETLRLYPPVGILLRKCTQPYEIPETSIILPKGCQLFIPVYAFHHDPEYFPDPEEFNPERFSSENRKNIPPYAYMPFGHGPRVCIGFRLAMMEMKLTLALIIKNFKILKCEKT-KPFKMCPSSFFLVPKDGFWIKVIKR 520          
BLAST of EMLSAG00000004666 vs. Select Arthropod Genomes
Match: gb|EFA12634.1| (cytochrome P450 6BK4 [Tribolium castaneum])

HSP 1 Score: 119.398 bits (298), Expect = 2.222e-29
Identity = 92/361 (25.48%), Postives = 160/361 (44.32%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN------------------NDTLFLFPNDAF-------------------------------NLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKK 313
            +D ++++  +TT+ I    FG+    F+     P  +    +    K ++ ++  +   F T    F     IS+      +F++N+VK ++E R+K+  +R DF+ LL+        +K ++++ G     F             T  E      + A   +  +AGF+T+S++MT     LA H  +Q+ + EEI+ V+ + N                  ++TL L+P  +                                +  KD+Y +PE F+P  FTEENK  R  Y+ + FG+GPR CIGMRF ++Q K  L  L+  YKF  N++T + + + P+ L     G  W+  +K
Sbjct:  178 IDIKEVLACFTTEIIGSCAFGLNCKAFE-DENSPFRVYGRKVFATSKLQRLKRT-IATIFPTLGYLFN----ISITPKDITNFYLNVVKDTVEYREKNNYNRNDFMQLLI-------DLKNNKLEGGTSNGGF-------------TLKE------VAAQSFVFFLAGFETSSTLMTFALYELARHQEIQDIVREEINEVLRKHNGNVTYDSINDMKYLSQVIDETLRLYPPASLVNRKCIKDYQVPDCDLVIEKGTTVLIPIMGIHYDKDYYPDPEKFDPERFTEENKNARHNYAHIPFGEGPRICIGMRFGLMQTKVGLSCLLKHYKFTVNKRTQEPLKMQPSPLILSAEGEIWLDAEK 506          
BLAST of EMLSAG00000004666 vs. nr
Match: gi|675803099|gb|AIL94157.1| (cytochrome P450 CYP3025B1 [Tigriopus japonicus])

HSP 1 Score: 179.874 bits (455), Expect = 8.570e-49
Identity = 119/361 (32.96%), Postives = 185/361 (51.25%), Query Frame = 0
Query:    3 DSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-------------------NDTL---------------FLFPNDAF-------------NLCKD--HYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            +++  +V +TT  IA+ GFG+ A    +   + +F + V  ++G        +  F+  L F N   +   I +++  S ++FI +++ ++  RK+SK  R D +DL+L +  K+ S     +++     QFE DA+I +     +  E+ELEL +V+N  IL  AG +T+S++M V  V+LA HP VQE+L  EI   I +                     N+TL               + FP   F              + KD  ++ +P  FNP NF EENK KRS Y+FLAFGQGPRNCIGMRFA+LQ+K  + RL+  Y+ LR+ KT D+   +P   S     G+++ + KR
Sbjct:  183 EAKQSMVNFTTDVIAECGFGINAQA--MLNPDSVFKQNVMKLSGGPKGSIMGMIRFVMIL-FLNPLARMLKIKIMNEESLNYFIKVIRQTMATRKESKTRRNDLIDLIL-DALKDDSQDPKPVEDA----QFEKDAQIEVNTPFQSIPEEELELYIVSNAFILFFAGLETSSTIMAVCSVFLATHPDVQERLHLEIQDAIDDHGSQDLPYERIHSLPYLDMVVNETLRHFPLAIMERQCVKDYKFPGYDFVVPAGMLVQVPSPAIMKDAKYFPDPLRFNPENFNEENKAKRSPYAFLAFGQGPRNCIGMRFALLQVKIAIIRLLANYEILRSPKTNDQFRPSPKSPSGQPINGTFIRIAKR 535          
BLAST of EMLSAG00000004666 vs. nr
Match: gi|675803107|gb|AIL94161.1| (cytochrome P450 CYP3025A2 [Tigriopus japonicus])

HSP 1 Score: 162.54 bits (410), Expect = 2.264e-42
Identity = 117/367 (31.88%), Postives = 173/367 (47.14%), Query Frame = 0
Query:    3 DSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFL-----CFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEIS------------------------GVIHE------------------KNNDTLFLFP--------NDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            D++     +T  +IA  GFG EA    L   +  F  M+  +T        Q  M L       +T   W  K   +S L+  + +F +++   S+E RKKS + R    + LL             I+   E  QF+ DA++++    V  D+ E++L L++N L+L  AGF+T+S++M+V   +LA H  VQ+K++EE+S                         V+HE                  K  DT F+ P        + A      +Y+ P  FNP NF+ E K KRS YSFLAFGQGPRNC+GMRFA+LQ+K  L RL+  Y+  +  KTV ++   P   S    GG W+T+  R
Sbjct:  177 DAKLTFTNFTLDTIANCGFGFEARI--LKNPDNQFRTMITKLT--------QPNMILHLAKFMLITMCPWVMKIKEVSFLNEEAGNFILDIFSQSMEERKKSNIKR----NDLLDLLMDTLKADHKGIKQELEKDQFDQDAQVHVSKKNVIPDD-EIDLYLLSNALVLFFAGFETSSTIMSVTSFFLATHEDVQDKVYEEVSEAIAQNSGSDYLDYNHFQGMSYLDKVVHEVLRLYPLTLIERLCVKDYKVPDTNFVIPKGMLVQIPSSAIMRDPQYYDNPSEFNPENFSPEAKAKRSPYSFLAFGQGPRNCVGMRFALLQVKISLIRLLAHYRLEKCAKTVSQLTPDPKSGSAQPKGGVWLTISPR 528          
BLAST of EMLSAG00000004666 vs. nr
Match: gi|675803083|gb|AIL94149.1| (cytochrome P450 CYP3025A1 [Tigriopus japonicus])

HSP 1 Score: 156.377 bits (394), Expect = 5.588e-40
Identity = 117/366 (31.97%), Postives = 181/366 (49.45%), Query Frame = 0
Query:    3 DSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEP--LFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVM-------------FVYLANHPIVQEKL-----FEEISG------VIHE------------------KNNDTLFLFPNDAF------NLCKD--HYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKRRA 316
            D++     +T  +IA  GFG EA     ++K P   F  M+  +TG  G +  Q+  F+     P W  K   +S  D  + +F +++   S+E RKKSKV R D +DLL+     +    + E++N     QF+ DA++ +    V  D+ E+++ L++N  IL  AGFDT+S++M++              F+  +  P++Q        +  I G      V+HE                  K   T F+ P          ++ +D  +Y+ P  FNP NF+ E K KRS YSFLAFGQGPRNC+GMRFA+LQ+K  + RLV  Y+  +  KTV +++  P   S    GG W+++  R A
Sbjct:  177 DAKKTFTNFTLDTIANCGFGFEAR----TLKNPDNQFRAMITKLTG--GNQVLQLAKFVIITMCP-WIMKIKELSFFDEEAGNFILDIFSQSMEERKKSKVKRNDLLDLLMDALEADREGIKQELEND----QFDQDAQVQVSKKSVIPDD-EIDIFLLSNAFILFFAGFDTSSTIMSITSFSWPLMRMSKTKFMKRSLKPLLQNNGSDNLDYNTIQGMSYLDKVVHETLRLYPLTMIERMCVKDYKVPGTDFVIPKGMLVQIPSTDIMRDPQYYDNPNEFNPENFSPEAKAKRSPYSFLAFGQGPRNCVGMRFALLQVKISVIRLVAHYRLEKCAKTVSQLIPDPRSQSLQPKGGIWLSISPRNA 530          
BLAST of EMLSAG00000004666 vs. nr
Match: gi|943942837|ref|XP_014354931.1| (PREDICTED: cytochrome P450 9e2-like, partial [Papilio machaon])

HSP 1 Score: 152.14 bits (383), Expect = 9.152e-40
Identity = 112/371 (30.19%), Postives = 175/371 (47.17%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLF----MEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNNDTLF-----------------------------------------------LFPND-------AFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            +D  D++ RYT   IA   FG + N   +  KE  F      +  + T ++ K    +Y       FP+   K   + + +    SFF N+VK ++E R+K+K+ R D + LL+     N S+K DE             A I  +  K  + +Q+L    VA V +  +AGF+T+++ +++ F  LA +P+VQEKL+ EI   +H+     L+                                               L P D       + +L + HY EP+V+ P  F+EENK +   ++F+ FG GPR CIG RFAML++K  LY L+  +K L+ EKT D I++ P+EL+    GG+WV L+ R
Sbjct:   20 LDVCDLMHRYTNDVIASCAFGCQVN--SVKDKENEFYRTGQSLFELSTLQRTKLILAMY-------FPS-IAKSFGLKVFEEKDLSFFQNLVKDTMEYREKNKIERPDMIQLLIQA--SNGSLKSDE-------------ADIKTEKIKREWSQQDL----VAQVFVFFIAGFETSATTLSLTFHELAVNPLVQEKLYAEIK-TLHDTKGKLLYDNINELKYLDCVINETLRKWSPALIMDRVCTKPYELPPPREGGKPTKLNPGDFVYNMVNSIHLDRKHYPEPDVYKPERFSEENKHEIKPFTFMPFGIGPRTCIGTRFAMLEIKVLLYNLMLNFKILKCEKTTDPIVLKPHELNIFAQGGTWVKLEAR 360          
BLAST of EMLSAG00000004666 vs. nr
Match: gi|675803113|gb|AIL94164.1| (cytochrome P450 CYP3025A3 [Tigriopus japonicus])

HSP 1 Score: 150.214 bits (378), Expect = 9.752e-38
Identity = 111/367 (30.25%), Postives = 174/367 (47.41%), Query Frame = 0
Query:    3 DSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLT---FPNWFTKHS-PISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEIS-GVIHEKNNDTL----------------------------------FLFPNDAFNLCKD---------------HYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKRR 315
            +++D    +T  SIA  GFG EA    L+  E  F  M+  +T        QV  F+ F     FP+          + +  + +F +++++ SI NRK SK+ R    + LL          +  I+   E  Q++ DA +++   K   DE ++E+ L++N  IL  AGFDT+S++M++   +LA H  VQ+KL++EIS  V    NN++L                                  +L P   F + KD               HY   + F+P NF+ E K KR+ Y+FLA GQGPRNC+GMRFA+LQ+KT + RLV  ++  R  KT  E++  P  ++    G   + +  R+
Sbjct:  177 NAKDTFTNFTVDSIASCGFGFEARS--LNNPESQFRSMITKLTD-----VNQVVQFIQFAAVSLFPSVARMLDFEFEIFNKEAGTFVLDVLRQSIANRKSSKIRR----NDLLDLLMDALEADRQGIKQELEKDQYDMDATLHMTRKKNIPDE-DIEMFLLSNAFILFFAGFDTSSTIMSIAAFFLATHQDVQDKLYDEISEAVAQNDNNESLDYNTIQSLPYLDKVVHETLRLYPITIIERLCVKDYLIPGTNFVVPKDMLVQIPSTAIMKDPQHYNNADKFDPENFSTEAKAKRNPYAFLASGQGPRNCVGMRFALLQVKTSIIRLVANFRVDRCAKTPTELIPDPKSITIQPKGELLLAISPRK 531          
BLAST of EMLSAG00000004666 vs. nr
Match: gi|675803087|gb|AIL94151.1| (cytochrome P450 CYP3026A3 [Tigriopus japonicus])

HSP 1 Score: 147.517 bits (371), Expect = 9.635e-37
Identity = 105/351 (29.91%), Postives = 169/351 (48.15%), Query Frame = 0
Query:    3 DSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLT----FPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNN---------------------DTL----------------FLFPNDAFNLCKDH---------------YEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPN 297
            D ++   +++  +IA   FGV A  F+   K    M    +    +  +W  + + +  L     F N+F   SPI+        FF ++++ +IE+R K+K  R D VDL++     +T  ++D+   G    QF+ DAK+N +      DE    + +VA  L++L+AG+DTT+  M +   +LA +P +QEKL++EI   + E  N                     +TL                +L P     L K +               Y +PE ++P  FT+E K  R  Y+FL FGQGPRNCIGMRFA+L+ K  L+ +++KYKF+   +TV+E  + P+
Sbjct:  183 DLKEKFGKFSMDTIATCAFGVNAKSFE-DDKSTFAMNARAVF---RNSRWDVLRIIMALLPGGKEFLNFFG--SPIN--KKHVTLFFYDIIRGTIEHRMKTKTRRNDLVDLMIDAMKADTPPEEDKDTEG----QFDQDAKLNHKVVSKQMDE----ITMVATALVILVAGYDTTAQTMAITSYFLARNPDIQEKLYQEIMECVGEIKNEKGHPDYNQIQSLPYLDMVLHETLRINPALGIITRVCSKDYLIPGTDVLLKKGNEVHINAMAIHNNPNIYPDPEKYDPERFTKEAKANRHPYAFLGFGQGPRNCIGMRFALLEAKLGLFAVLWKYKFVATTETVEEFTLDPS 517          
BLAST of EMLSAG00000004666 vs. nr
Match: gi|675803105|gb|AIL94160.1| (cytochrome P450 CYP3026C1 [Tigriopus japonicus])

HSP 1 Score: 145.591 bits (366), Expect = 4.384e-36
Identity = 105/337 (31.16%), Postives = 156/337 (46.29%), Query Frame = 0
Query:    5 RDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGE-EAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN-------------NDTLFLFPN-------------------------DAF-NLCKDHYE-----EPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAP 296
            +D+  R+T  SI+    G  A  F     E +F++    +  R G  W      L  +   N       IS+  P    FF N++K+SIE R+KS   R D +DL++        +K +EI  GE E  QFE DAK+     K  FDE    L L+AN +++L+AG++TT++ MT     +A    +Q KL+EE+                     N++L  +P                          D + N+   HY+      P  FNP+NFT E K  R  Y+FL FG GPR CIGMRFA+L++K  L+  V  ++ L+ ++T + I   P
Sbjct:  181 KDLCGRFTMDSISSCAIGFNAGSF--HEDETIFVKNAKGLFKRSG--WAMFLFVLSLVPGMNALLGRLGISISRPQETRFFYNLIKASIEARRKSGEQRNDLIDLMI------RIMKDEEITTGEDELDQFENDAKLKGPVKKAEFDE----LTLIANAMVMLLAGYETTATTMTWALFEIARSEEIQRKLWEEVQQFDDPSYTDFMNMPYLDCVVNESLRKYPQATAISRGSQENYILEDVNIPIKKGMDVYVNVVGIHYDPQNYPNPNEFNPDNFTREAKATRHPYAFLPFGHGPRACIGMRFALLELKMALFYAVKNFELLKCDETPEVIEFDP 503          
BLAST of EMLSAG00000004666 vs. nr
Match: gi|909581893|ref|XP_013146951.1| (PREDICTED: probable cytochrome P450 9f2 [Papilio polytes])

HSP 1 Score: 145.206 bits (365), Expect = 4.687e-36
Identity = 109/371 (29.38%), Postives = 173/371 (46.63%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFME----MVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNNDTLF-----------------------------------------------LFPND-------AFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            +D  D++ RY+   IA  GFG + N   ++ KE  F +    +  + T ++ K    +Y       FP+   K+  + + +    SFF N+VK ++E R+K+ + R D + LL+     N  +K DE             ++I+I   K     +  +  LV  V I   AGF+T+++ +++    LA +P+VQEKL+EEI    HE     L+                                               L P D       + +L   HY EPEVFNP  F+EENK +   ++F+ FG GPR CIG RFAML++K  +Y ++  +K L+ +KT + IL+ P+E +    GG+WV L+ R
Sbjct:  170 IDVCDLMRRYSNDVIASCGFGCQVN--SVNDKENEFYKTGQSLFEMTTLQRTKLIISMY-------FPS-IAKNLGLKIFEEKDVSFFQNLVKDTMEYREKNNIERPDMIQLLMQATKGN--LKTDE-------------SEIDIDKIKRGQIREWSQQDLVGQVFIFFFAGFETSAATLSLTVHELAVNPLVQEKLYEEIK-TFHETKGKMLYENVNELKYLDCVINETLRKWSPALIMDRVCTKPYELPPPREGGKPTKLNPGDYVYNMVNSIHLDPRHYPEPEVFNPERFSEENKNEIKPFTFMPFGIGPRTCIGTRFAMLEIKVLIYNIILNFKILKCDKTTEPILLKPHEFNIAALGGTWVKLETR 514          
BLAST of EMLSAG00000004666 vs. nr
Match: gi|909581467|ref|XP_013146721.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC106109682 [Papilio polytes])

HSP 1 Score: 145.976 bits (367), Expect = 2.486e-35
Identity = 115/375 (30.67%), Postives = 177/375 (47.20%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWR--QVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEI-QNGEEAPQFEFDAK-INIQ---DTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN------------------NDTLF-----------------------------LFPND-------AFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKRR 315
            +D  D++ RYT   IA  GFG + N   +  KE +F +     TG+   +    Q    +  + FP    K+    + D    SFF N+VK +IE R+K+ V R D + L++  F      +Q+    N       ++  K + IQ   DT   + +Q+L    V  V I   AGF++++S++++    LA +P+VQEKL+EEI    HE                    N+TL                              L P D       + +L   H+ EPEVFNP  F+EE+K K  +++F  FG GPR CIG RFAML++K  +Y ++  +K L+ +KT + IL  P+E +    GG+WV L+ R+
Sbjct:  170 IDVCDLMRRYTNDVIASCGFGCQVNS--VIDKENVFYK-----TGQTLCEMTILQRMKLILAMEFPR-LAKNLGFKIFDEKDISFFKNLVKDTIEYREKNNVERPDMIQLVMQAFKGRDRNRQNXTWSNQRXGIXIKYSNKYLLIQSDDDTISEWSQQDL----VGQVFIFFFAGFESSASILSLTIHELAVNPLVQEKLYEEIK-TFHETEGKLSYENIKELKYLDCVVNETLRKWTSALIMDRVCSKPYELPPPREGGKPIKLNPGDLVYNMVNSIHLDPRHHPEPEVFNPERFSEESKHKIKSFTFTPFGIGPRTCIGTRFAMLEIKVLIYNIILNFKILKCDKTTEPILWKPHEFNVAALGGTWVKLEARK 531          

HSP 2 Score: 131.724 bits (330), Expect = 1.864e-30
Identity = 96/369 (26.02%), Postives = 176/369 (47.70%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLT--FPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTK-VTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISG-------VIHEKNNDTLFL----------------------------FPNDAFNLCK------------------DHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            +D  D++ RYT   IA   FG++ N   +  K+  F +     TG+   K      F  FL   FP  F K   + + +    +FF N+V +++++R+K  + R D + LL+     N  +K +++ + +       D  I  +  K ++  +Q  +  L + V +  +AGF+T+++ +T+ F  LA +P +Q +L+EEI         + ++  ND  +L                             P++    CK                  +HY +PEVF+P+ F ++ K +   ++F+ FG GPR CIG RFA+L++K  +Y ++  +  L+ EKT D I++ P++ +    GG+W+ L++R
Sbjct:  723 IDVSDLMRRYTNDVIASTAFGIQVNS--VQDKDNDFYK-----TGQSMFKMSAQQRFKFFLANQFPA-FAKLLKLKIFEDKYMNFFDNIVTTTMQHREKHNIERPDIIQLLMQAHKGN--LKAEDVDSKD-------DVVIEAERLKHLSSAKQWSQRELASQVFLFFLAGFETSATALTMCFHELAINPKIQNRLYEEIKSFKEKHERITYDNINDMKYLDCVINETLRRWAPALIMDRVCTKAYELPPPHEGGKPCKLNPGDVVYNVVNSIHLDPEHYPDPEVFDPDRFADDRKHEIKPFTFMPFGIGPRVCIGSRFALLELKVLIYDVLLNFNILKCEKTSDPIVLEPHDFNIKAAGGTWIQLERR 1074          
BLAST of EMLSAG00000004666 vs. nr
Match: gi|930677619|gb|KPJ17676.1| (putative cytochrome P450 9f2 [Papilio machaon])

HSP 1 Score: 142.51 bits (358), Expect = 4.021e-35
Identity = 104/368 (28.26%), Postives = 181/368 (49.18%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLT--FPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISG-------VIHEKNNDTLFL----------------------------FPNDAFNLCK------------------DHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            +D  D++ RYT   IA   FG++ N   L  K+  F +     TG+   K   +  F  F    FP  F+K   + + D    +FF N+V +++E+R K+ + R D + LL+  +  N S+K +++ + ++    E D ++N Q +    D+Q  +  LV+ V +  +AGF+ +++ +T+    LA +P +Q++L+EEI         + ++  ND  FL                             P++    CK                   HY +PEVF+P+ F++E K +   ++F+ FG GPR CIG RFA+L++K  +Y +V  +  L+ EKT D I + P++ +    GG+WV L++R
Sbjct:  153 IDVCDVMRRYTNDVIASTAFGIQVNS--LQDKDNDFYK-----TGQSLFKMSPLQRFKFFFVNQFPA-FSKLLNLKIFDDKYTTFFENIVTNTMEHRYKNNIERPDMIQLLMQAY--NGSLKAEDVDSNDDV-IIEAD-RLNPQSS----DKQWTQRELVSQVFLFFLAGFEVSANALTMCIHELAINPKIQDRLYEEIKSFKEKHDRLTYDNINDLKFLDCVINESLRRWAPALILDRVCTKAYELPPPHEGGKPCKLNPGDVVYNVVNSIHLDPQHYPDPEVFDPDRFSDERKHEIKPFTFMPFGIGPRLCIGSRFALLELKVLMYDIVLNFNILKCEKTSDPITLDPSDFNLKAAGGTWVHLERR 504          
BLAST of EMLSAG00000004666 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold832_size90819-snap-gene-0.17 (protein:Tk09603 transcript:maker-scaffold832_size90819-snap-gene-0.17-mRNA-1 annotation:"cytochrome p450")

HSP 1 Score: 168.318 bits (425), Expect = 3.127e-48
Identity = 112/366 (30.60%), Postives = 181/366 (49.45%), Query Frame = 0
Query:    3 DSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEP--LFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQD--EIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNN---------DTL---------------------------------FLFPNDAF------NLCKD--HYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            +++++   +T  SI   GFG+EA     ++K P  LF +MV  +T     K + V  FL  +T   W TK   ++  D  +  FF+++++ ++ +R+K+K+ R D +DLLL       + KQD  +I +  E   ++ DA +++   + +  ++++E+ +++N  +L  AGFDTTSS M ++  +LA H  VQE+L  EI   + + N           TL                                 F  P          N+ KD  ++  P  FNP NF+ E K +R+ Y++LAFGQGPRNC+GMRFA+LQ+K  L RL+  YK   + +T  ++   P   S    GG WV    R
Sbjct:  184 NAKEVYTNFTLDSIGTCGFGLEAE----TLKHPNNLFRQMVRRLTDMDQVK-QMVKFFL--ITICPWITKFIRLNFFDAKATEFFLDIIERTMNDRRKNKIRRNDLIDLLL------DAAKQDSADIPSEVETDLYDLDAAVHVT-RRASIPDEDIEIFILSNAFLLFFAGFDTTSSQMAIITYFLAKHQDVQERLAAEIQEAVRDNNGREQLDYNTIQTLPYLDQVVHEATRMYPLTLLERLCVKDYKIPGVNFTIPAGMLVEIPSPNIMKDPKYFPNPHEFNPENFSPEAKAQRTPYAYLAFGQGPRNCVGMRFALLQLKLSLVRLLSHYKVETSARTPTQLKPDPRSSSLQPLGGVWVQATAR 535          
BLAST of EMLSAG00000004666 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold248_size238799-snap-gene-0.14 (protein:Tk02149 transcript:maker-scaffold248_size238799-snap-gene-0.14-mRNA-1 annotation:"cytochrome p450-like protein partial")

HSP 1 Score: 145.976 bits (367), Expect = 2.632e-39
Identity = 90/259 (34.75%), Postives = 137/259 (52.90%), Query Frame = 0
Query:   74 ISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEE-----------------ISGVIHE------------KNNDTLFLFP---------NDAF-NLCKDH-----YEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKT 288
            ISL  P    FF N+VKS+IE RKKS  +R D VDL++     +  + +D  + G E  QFE DA++N +  K  FDE    + +VAN +++L+AG+DTTS+ +  +F  +  +P +QE+LF+E                 +  V++E            +  +  ++ P         ND + NL   H     Y  PE FNP+NF+ E K  R  Y+FL FG GPR CIGMRFA+L+MK  ++ ++  ++ L   +T
Sbjct:  504 ISLNKPEPTRFFYNIVKSAIEARKKSGETRNDLVDLMIKCMKADAVLDEDPSEEGLE--QFEKDAQLNFKGPKKQFDE----VTVVANAMVMLLAGYDTTSNTLAWLFYEVTRNPDIQERLFQETERFEEPTYSDFTDMPYLECVVNEALRMYPQATAISRGANQDYVLPGVNIPIKKGNDIYVNLAGIHFDPKYYPNPETFNPDNFSAEAKASRHPYAFLTFGHGPRACIGMRFALLEMKMAVFHVIKNFELLPCAET 756          

HSP 2 Score: 103.605 bits (257), Expect = 9.182e-25
Identity = 82/284 (28.87%), Postives = 129/284 (45.42%), Query Frame = 0
Query:    5 RDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEE-----------------ISGVIHE------------KNNDTLFLFP---------NDAF-NLCKDH-----YEEPEVFNPNNFTEENKIKR 244
            +D+  R T   I+   FGV A  F     E +F++    +     +      M +   +          ISL  P    FF N+VKS+IE RKKS  +R D VDL++     +  + +D  + G E  QFE DA++N +  K  FDE    + +VAN +++L+AG+DTTS+ +  +F  +  +P +QE+LF+E                 +  V++E            +  +  ++ P         ND + NL   H     Y  PE FNP+NF+ E K  R
Sbjct:  208 KDLCGRLTMDGISSCAFGVHAGSF--KEDETMFVKQAKALFSNSFRS--NFVMLIALFSGMTRVLGFFDISLNKPEPTRFFYNIVKSAIEARKKSGETRNDLVDLMIKCMKADAVLDEDPSEEGLE--QFEKDAQLNFKGPKKQFDE----VTVVANAMVMLLAGYDTTSNTLAWLFYEVTRNPDIQERLFQETERFEEPTYSDFTDMPYLECVVNEALRMYPQATAISRGANQDYVLPGVNIPIKKGNDIYVNLAGIHFDPKYYPNPETFNPDNFSAEAKASR 481          
BLAST of EMLSAG00000004666 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold13_size735724-snap-gene-0.13 (protein:Tk03451 transcript:maker-scaffold13_size735724-snap-gene-0.13-mRNA-1 annotation:"cytochrome p450 6j1-like isoform 5")

HSP 1 Score: 133.265 bits (334), Expect = 8.756e-36
Identity = 93/299 (31.10%), Postives = 150/299 (50.17%), Query Frame = 0
Query:    4 SRDIVVRYTTQSIAKAGFGVEANCFDLSVKEP--LFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNNDTLFLFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELS 300
            ++D++  YTT  IA   FG+EAN    ++K+P  LF  M+  +TG  G K     + + FL       K   +SLL+  S  +F+ ++K ++++R++SKV R D +D+++           + +Q+ +     +      IQD       Q L   +V  +  L M   +T    +    + +A    V++  F    G         L   P+ A  +   ++  P+ FNP NF+E +K  RS Y+FLAFGQGPRNC+GMRFA+LQ+K  + R V  Y+  R  KT+D   V+P+  S
Sbjct:  149 AKDVMTNYTTDVIANCAFGIEAN----ALKDPNSLFKRMILGLTG--GVKGMCRVLTILFLPPVARLLK---LSLLNEESTDYFVKVLKKTMKDRRESKVKRNDLMDMII-----------EALQDSKTNEDVQERLLTEIQDIIEEHGSQHLPYDVVQTLPYLDMVINET----LRHYPLAVAERECVKDYTF---PGEKLTVTQGMLVQVPSPAIMMDSQYFPNPKTFNPENFSEASKATRSPYAFLAFGQGPRNCVGMRFALLQVKIAMIRTVANYQIHRCSKTIDSFRVSPSSAS 420          
BLAST of EMLSAG00000004666 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold1362_size45580-processed-gene-0.12 (protein:Tk10797 transcript:snap_masked-scaffold1362_size45580-processed-gene-0.12-mRNA-1 annotation:"cytochrome p450-like protein partial")

HSP 1 Score: 134.42 bits (337), Expect = 8.993e-36
Identity = 94/327 (28.75%), Postives = 147/327 (44.95%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEI-------------------------SGVIHEK---------------------------NNDTLFLFPNDAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRL 276
            +D++D+  +++  +IA   FGV+A  F+    E  F++    I          + M   F    N+  K   +    P    F  N++ ++I++R +S+  + D +DL++    +      ++I + E   Q+E D+ +  +  K   DE    L++V+  LI++ AG+DTTS  +T     LA HP VQEK+ +EI                           VIHE                               T    P  A +    +Y +PE FNP+NFT E K  RS YSFLAFGQGPR+CIGMRFA+++ K   + L
Sbjct:  182 IDTKDVFSKFSMDTIATCAFGVDAGSFEEDNSE--FLQHARKIF--INSALDNLKMVASFTPGLNFLLKSLRMKFFKPKETLFMYNVITATIKHRIESQTRKNDLIDLMIDAINETNPENIEDIHSQE---QYEIDSNLEHKAQKDKLDE----LIIVSTALIIMAAGYDTTSMTLTYCAYELAQHPEVQEKVLQEIDEVMVNLEDGQDFPDYNILQGMRYLDAVIHETLRFHTPVPVARRICLQDYTPPGYDLTIEKGTYISVPIYAIHRDAQYYPDPEEFNPDNFTAEGKKSRSPYSFLAFGQGPRSCIGMRFALMEAKLSAHLL 497          
BLAST of EMLSAG00000004666 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold352_size199037-snap-gene-0.47 (protein:Tk08720 transcript:maker-scaffold352_size199037-snap-gene-0.47-mRNA-1 annotation:"PREDICTED: uncharacterized protein LOC103580177")

HSP 1 Score: 129.413 bits (324), Expect = 1.668e-33
Identity = 100/347 (28.82%), Postives = 158/347 (45.53%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLC-FLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIH--EKNNDTLFLFPN----------DAF---------------NLCKDHYE-----------------------------EPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDE 291
            +D +++  +Y+  +IA  GFGV+A  F  +  E  F+E       RKG      + FLC  L   N F K   +    P    FF +++   I +R +SK  + D VDL++       ++  DE +    + Q++ DAK+   D KV    Q  E ++V+N L++L+AG+DTT+  MT     LA  P +Q++L  EI   +   E+  D    FP+          DA                 +C + Y+                              P+ F+P +F+ E K KR+ Y+FL FGQGPR CIGMRFA+L+ K  L  ++ +++     +T  E
Sbjct:  185 IDLKELFAKYSMDTIATCGFGVDAGSF-TATGESKFVEHARNTFARKGI---DNFKFLCSALPGVNGFCKMLGMPFFKPEETQFFYDIIMQVIRHRMESKERKNDLVDLMIDAIKFEKTLTPDETETDSHS-QYDQDAKL---DHKVKKTAQFDETLVVSNSLLILIAGYDTTAMTMTYCAYELARQPNLQDRLLSEIDEALEGLEEGQD----FPDYQVIQELPYLDAVLQETLRLHAPIPLVSRVCANDYKIPGHDHVIPKGTEVNMYSYCIMRDERHFPNPDKFDPEHFSREAKAKRNPYAFLPFGQGPRACIGMRFALLEAKIGLIAILSRFRITTCPETPKE 519          

HSP 2 Score: 112.079 bits (279), Expect = 1.315e-27
Identity = 94/345 (27.25%), Postives = 155/345 (44.93%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLC-FLTFPNWFTKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKN---------------------NDTLFLF-PNDAFN-LCKDHYEEP----------------------EVFNPN-------NFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEIL 293
            +D +++  +Y+  +IA  GFGV+A  F    +    +   NI   RKG      +M LC  +   N F K   +    P    FF +++   I +R +SK  + D VDL++       ++  DE      + +++ DAK+   D KV    Q  E ++V+N L++L+AG+DTT+  M+     LA  P +Q++L  EI   + E                       ++TL L  P    N +    Y+ P                      E + PN       +F+ + K +R+ Y+FL FGQGPR CIGMRFA+L+ K  L  ++ +++     +T  E +
Sbjct:  700 IDLKELFSKYSMDTIATCGFGVDAGSFSCEGESKFVVNAKNIF-ARKGV---DNFMLLCSAMPGVNGFCKLLGLPFFKPRETQFFYDIIMQVIRHRMESKERKNDLVDLMIDAIKFEKTLASDETGIDSHS-KYDQDAKL---DHKVKQTAQFDETLVVSNSLLMLVAGYDTTAMTMSYCTYELARQPDLQDRLMNEIDAAMDELEEGQDFPDYQVIQELPYLDAVLHETLRLHAPIPVINRVAGKDYQIPGHTTVIPKGTEISMYSYCIMRDERYFPNPEKFDPEHFSRKAKGQRNPYAFLPFGQGPRACIGMRFALLEAKIGLIAILSRFRITTCPETPKEAI 1036          
BLAST of EMLSAG00000004666 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold362_size196086-snap-gene-0.31 (protein:Tk09343 transcript:maker-scaffold362_size196086-snap-gene-0.31-mRNA-1 annotation:"low quality protein: cytochrome p450 3a28-like")

HSP 1 Score: 111.694 bits (278), Expect = 6.850e-29
Identity = 73/278 (26.26%), Postives = 120/278 (43.17%), Query Frame = 0
Query:   74 ISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNND---------------------TL----------------FLFPNDAFNLCK---------------DHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNEL 299
            I ++      FF+ +++ S+ +R  +K  R D +DL++    +N +    E                         D    EL +VA  +++L+ G+DTT+  M +   YLA +P  QEKL++EI   + E ++D                     TL                + FP   + + K               D Y  PE F+P  F++E K +R  Y+FL F QGPR+C+GMRFA+L+ K  L+ ++ KYK     +TV+   + P  +
Sbjct:    3 IPVMKSPETEFFVKIIRDSMAHRLLTKTRRNDLIDLMIDAMNENRTKGAGE-------------------------DHDSDELSIVATAMVILVGGYDTTAHTMALASYYLAKNPDCQEKLYQEIMDAVSEMDDDDKHPDYNLVQGLPYLDMVVHETLRIMPPVGVITRGCSKDYPFPGIDYVIAKGKELHIYVWGIHMNPDIYPNPEKFDPERFSKEAKAERHPYAFLGFSQGPRSCMGMRFALLEAKLTLFAMLRKYKLKTCPETVEAYTLDPTPI 255          
BLAST of EMLSAG00000004666 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold362_size196086-snap-gene-0.24 (protein:Tk09339 transcript:maker-scaffold362_size196086-snap-gene-0.24-mRNA-1 annotation:"cytochrome p450 isoform 1-like partial")

HSP 1 Score: 113.62 bits (283), Expect = 1.959e-28
Identity = 90/367 (24.52%), Postives = 151/367 (41.14%), Query Frame = 0
Query:    2 VDSRDIVVRYTTQSIAKAGFGVEANCFDLSVKEPLFMEMVNIITGRKGKKWRQVYMFLCFLTFPNWF--TKHSPISLLDPGSKSFFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNND---------------------TLFLFPN-------------------------------DAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            V+ +D     +  +I+    G+ AN F+   K P F      I    GK    V+  LC +  P      +   I ++      FF+ +++ S+ +R  +K  R D +DL++    +N +    E                         D    EL +VA  +++L+ G+DTT+  M +   YLA +P  QEKL++EI   + E ++D                     TL + P                                   ++  D Y  PE F+P  F++E K +R  Y+FL F QGPR+C+GMRFA+L+ K  L+ ++ KYK     +TV+   + P  +  ++     + L+ R
Sbjct:  205 VNLKDKFGNMSMDAISSCALGLNANSFN-DKKSP-FQRHARQIFRSSGK---DVFKLLCAM-MPGGLKLMELMNIPVMKGPETEFFVKIIRDSMAHRLLTKTRRNDLIDLMIDAMNENRTKGAGE-------------------------DHDSDELSIVATAMVILVGGYDTTAHTMALASYYLAKNPDCQEKLYQEIMDAVSEMDDDDEHPDYNLVQGLPYLDMVVHETLRIMPPVGVITRGCSKDYPFPGIDYVIPKGTELHIYVGGIHMNPDIYPNPEKFDPERFSKEAKAERHPYAFLGFSQGPRSCMGMRFALLEAKLTLFAMLRKYKLKTCPETVEAYTLDPTPILANLKEDLLIKLEAR 540          
BLAST of EMLSAG00000004666 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1362_size45580-snap-gene-0.16 (protein:Tk10796 transcript:maker-scaffold1362_size45580-snap-gene-0.16-mRNA-1 annotation:"cytochrome p450 isoform 1-like partial")

HSP 1 Score: 113.235 bits (282), Expect = 3.568e-28
Identity = 72/266 (27.07%), Postives = 119/266 (44.74%), Query Frame = 0
Query:   84 FFINMVKSSIENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNND-------------------TLFLFPN-------------------------------DAFNLCKDHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNEL 299
            FF+ +++ +I +R  +K  R D VDL++    +N +    E Q+ +E                         L + A  L++L+AG+DTT+  M +   YLA +P  QEKL++EI   + E +++                   TL + P                                   ++  D Y +PE F+P  F+++ K +R  Y+FL FGQGPR+CIGMRFA+L+ K  L+  + KYK     +TV+   + P+ +
Sbjct:  297 FFLKIIRDTIAHRLLTKTRRNDLVDLMIDAMNENRTKGAREDQDSDE-------------------------LSIGATALVILVAGYDTTAQTMALTSYYLAKNPDCQEKLYQEIMDAVSEMDDEHPDYNLVQGLPYLDMVVHETLRIMPALGVITRGCSKDYPFPGIDYVIPKGTELHIYVGGIHMNPDIYPDPEKFDPERFSKDAKAERHPYAFLGFGQGPRSCIGMRFALLEAKLALFATLRKYKLKTCPETVEAFTLDPSAI 537          
BLAST of EMLSAG00000004666 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold362_size196086-processed-gene-0.20 (protein:Tk09344 transcript:snap_masked-scaffold362_size196086-processed-gene-0.20-mRNA-1 annotation:"low quality protein: probable cytochrome p450 6a13")

HSP 1 Score: 101.679 bits (252), Expect = 1.196e-25
Identity = 71/274 (25.91%), Postives = 116/274 (42.34%), Query Frame = 0
Query:   93 IENRKKSKVSRGDFVDLLLAEFYKNTSIKQDEIQNGEEAPQFEFDAKINIQDTKVTFDEQELELVLVANVLILLMAGFDTTSSMMTVMFVYLANHPIVQEKLFEEISGVIHEKNND---------------------TL----------------FLFPNDAFNLCK---------------DHYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            + +R  +K  R D +DL++    +N +    E                         D    EL +VA  +++L+ G+DTT+  M +   YLA +P  QEKL++EI   + E ++D                     TL                + FP   + + K               D Y  PE F+P  F++E K +R  Y+FL F QGPR+C+GMRFA+L+ K  L+ ++ KYK     +TV+   + P  +  ++     + L+ R
Sbjct:    1 MAHRLLTKTRRNDLIDLMIDAMNENRTKGAGE-------------------------DHDSDELSIVATAMVILVGGYDTTAHTMALASYYLAKNPDCQEKLYQEIMDAVSEMDDDDKHPDYNLVQGLPYLDMVVHETLRIMPPVGVITRGCSKDYPFPGIDYVIAKGKELHIYVWGIHMNPDIYPNPEKFDPERFSKEAKAERHPYAFLGFSQGPRSCMGMRFALLEAKLTLFAMLRKYKLKTCPETVEAYTLDPTPILANLKEDLLIKLEAR 249          
BLAST of EMLSAG00000004666 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold832_size90819-processed-gene-0.9 (protein:Tk09608 transcript:snap_masked-scaffold832_size90819-processed-gene-0.9-mRNA-1 annotation:"cytochrome P450 ")

HSP 1 Score: 93.5893 bits (231), Expect = 9.920e-24
Identity = 44/98 (44.90%), Postives = 60/98 (61.22%), Query Frame = 0
Query:  219 NLCKD--HYEEPEVFNPNNFTEENKIKRSTYSFLAFGQGPRNCIGMRFAMLQMKTCLYRLVYKYKFLRNEKTVDEILVAPNELSPDITGGSWVTLKKR 314
            N+ KD  ++  P  FNP NF+ E K +R+ Y++LAFGQGPRNC+GMRFA+LQ+K  L RL+  YK   + +T  ++   P   S    GG WV    R
Sbjct:   36 NIMKDPKYFPNPHEFNPENFSPEAKAQRTPYAYLAFGQGPRNCVGMRFALLQLKLSLVRLLSHYKVETSARTPTQLKPDPRSSSLQPLGGVWVQATAR 133          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000004666 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-2.858e-2428.13symbol:Cyp6a17 "Cytochrome P450-6a17" species:7227... [more]
-8.351e-2425.57symbol:Cyp6a9 "Cytochrome P450-6a9" species:7227 "... [more]
-9.914e-2423.85symbol:Cyp6a18 "Cyp6a18" species:7227 "Drosophila ... [more]
-1.199e-2325.00symbol:Cyp6a13 "Cyp6a13" species:7227 "Drosophila ... [more]
-3.681e-2223.43symbol:Cyp9f2 "Cyp9f2" species:7227 "Drosophila me... [more]
-4.789e-2223.31symbol:Cyp6a8 "Cytochrome P450-6a8" species:7227 "... [more]
-3.767e-2131.17symbol:CYP3A12 "Cytochrome P450 3A12" species:9615... [more]
-4.440e-2133.68symbol:CYP3A4 "Cytochrome P450 3A4" species:9606 "... [more]
-4.576e-2132.75symbol:Cyp3a2 "Cytochrome P450 3A2" species:10116 ... [more]
-4.576e-2132.75symbol:Cyp3a2 "cytochrome P450, family 3, subfamil... [more]

Pages

back to top
BLAST of EMLSAG00000004666 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592781400|gb|GAXK01173168.1|2.054e-3327.35TSA: Calanus finmarchicus comp133932_c1_seq3 trans... [more]
gi|592781401|gb|GAXK01173167.1|3.332e-3327.35TSA: Calanus finmarchicus comp133932_c1_seq2 trans... [more]
gi|592781402|gb|GAXK01173166.1|3.663e-3327.35TSA: Calanus finmarchicus comp133932_c1_seq1 trans... [more]
gi|592792800|gb|GAXK01161768.1|6.700e-3027.09TSA: Calanus finmarchicus comp35684_c1_seq2 transc... [more]
gi|592792801|gb|GAXK01161767.1|1.142e-2926.76TSA: Calanus finmarchicus comp35684_c1_seq1 transc... [more]
gi|592841635|gb|GAXK01115909.1|2.168e-2825.21TSA: Calanus finmarchicus comp168525_c0_seq1 trans... [more]
gi|592792798|gb|GAXK01161770.1|2.801e-2826.35TSA: Calanus finmarchicus comp35684_c1_seq4 transc... [more]
gi|592777364|gb|GAXK01177204.1|5.229e-2826.91TSA: Calanus finmarchicus comp141722_c2_seq1 trans... [more]
gi|592792799|gb|GAXK01161769.1|5.914e-2726.35TSA: Calanus finmarchicus comp35684_c1_seq3 transc... [more]
gi|592872005|gb|GAXK01085557.1|2.084e-2628.47TSA: Calanus finmarchicus comp78114_c0_seq1 transc... [more]

Pages

back to top
BLAST of EMLSAG00000004666 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 6
Match NameE-valueIdentityDescription
EMLSAP000000046660.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s242:96944... [more]
EMLSAP000000060581.072e-7156.82pep:novel supercontig:LSalAtl2s:LSalAtl2s327:9124:... [more]
EMLSAP000000094053.419e-1323.97pep:novel supercontig:LSalAtl2s:LSalAtl2s5:994028:... [more]
EMLSAP000000120883.191e-1125.51pep:novel supercontig:LSalAtl2s:LSalAtl2s865:17115... [more]
EMLSAP000000052691.386e-1027.98pep:novel supercontig:LSalAtl2s:LSalAtl2s281:23745... [more]
EMLSAP000000108297.837e-923.47pep:novel supercontig:LSalAtl2s:LSalAtl2s71:248776... [more]
back to top
BLAST of EMLSAG00000004666 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|6166033|sp|P05183.2|CP3A2_RAT2.961e-2132.75RecName: Full=Cytochrome P450 3A2; AltName: Full=C... [more]
gi|11386701|sp|Q9V773.2|C6A20_DROME3.012e-2125.38RecName: Full=Probable cytochrome P450 6a20; AltNa... [more]
gi|12644217|sp|P33270.2|CP6A2_DROME4.242e-2122.87RecName: Full=Cytochrome P450 6a2; AltName: Full=C... [more]
gi|2506240|sp|P51538.2|CP3A9_RAT7.641e-2126.99RecName: Full=Cytochrome P450 3A9; AltName: Full=3... [more]
gi|116241312|sp|P08684.4|CP3A4_HUMAN9.599e-2133.68RecName: Full=Cytochrome P450 3A4; AltName: Full=1... [more]
gi|3913302|sp|O18993.1|CP3AL_CALJA1.681e-2033.16RecName: Full=Cytochrome P450 3A21; AltName: Full=... [more]
gi|117162|sp|P24463.1|CP3AC_CANFA2.052e-2033.16RecName: Full=Cytochrome P450 3A12; AltName: Full=... [more]
gi|341940389|sp|Q64481.2|CP3AG_MOUSE2.513e-2028.91RecName: Full=Cytochrome P450 3A16; AltName: Full=... [more]
gi|5921922|sp|O70537.1|CP3AV_MESAU2.868e-2027.05RecName: Full=Cytochrome P450 3A31; AltName: Full=... [more]
gi|5921921|sp|P79401.1|CP3AT_PIG5.097e-2028.83RecName: Full=Cytochrome P450 3A29; AltName: Full=... [more]

Pages

back to top
BLAST of EMLSAG00000004666 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
gb|EFA12635.1|3.689e-3429.51cytochrome P450 6BK3 [Tribolium castaneum][more]
EAA08231.21.769e-3327.55AGAP002869-PA [Anopheles gambiae str. PEST][more]
EAL40825.16.192e-3327.07AGAP002868-PA [Anopheles gambiae str. PEST][more]
gb|KYB25678.1|1.130e-3228.61putative cytochrome P450 9f2-like Protein [Triboli... [more]
gb|KFM82631.1|3.838e-3229.12Cytochrome P450 3A13, partial [Stegodyphus mimosar... [more]
gb|EFA02824.1|2.200e-3127.32cytochrome P450 6BQ11 [Tribolium castaneum][more]
gb|EEZ99338.1|2.913e-3127.70cytochrome P450 6BQ13 [Tribolium castaneum][more]
gb|EFA02825.1|3.109e-3128.07cytochrome P450 6BQ12 [Tribolium castaneum][more]
EEB15938.11.631e-2925.61cytochrome P-450, putative [Pediculus humanus corp... [more]
gb|EFA12634.1|2.222e-2925.48cytochrome P450 6BK4 [Tribolium castaneum][more]

Pages

back to top
BLAST of EMLSAG00000004666 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|675803099|gb|AIL94157.1|8.570e-4932.96cytochrome P450 CYP3025B1 [Tigriopus japonicus][more]
gi|675803107|gb|AIL94161.1|2.264e-4231.88cytochrome P450 CYP3025A2 [Tigriopus japonicus][more]
gi|675803083|gb|AIL94149.1|5.588e-4031.97cytochrome P450 CYP3025A1 [Tigriopus japonicus][more]
gi|943942837|ref|XP_014354931.1|9.152e-4030.19PREDICTED: cytochrome P450 9e2-like, partial [Papi... [more]
gi|675803113|gb|AIL94164.1|9.752e-3830.25cytochrome P450 CYP3025A3 [Tigriopus japonicus][more]
gi|675803087|gb|AIL94151.1|9.635e-3729.91cytochrome P450 CYP3026A3 [Tigriopus japonicus][more]
gi|675803105|gb|AIL94160.1|4.384e-3631.16cytochrome P450 CYP3026C1 [Tigriopus japonicus][more]
gi|909581893|ref|XP_013146951.1|4.687e-3629.38PREDICTED: probable cytochrome P450 9f2 [Papilio p... [more]
gi|909581467|ref|XP_013146721.1|2.486e-3530.67PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|930677619|gb|KPJ17676.1|4.021e-3528.26putative cytochrome P450 9f2 [Papilio machaon][more]

Pages

back to top
BLAST of EMLSAG00000004666 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 21
Match NameE-valueIdentityDescription
maker-scaffold832_size90819-snap-gene-0.173.127e-4830.60protein:Tk09603 transcript:maker-scaffold832_size9... [more]
maker-scaffold248_size238799-snap-gene-0.142.632e-3934.75protein:Tk02149 transcript:maker-scaffold248_size2... [more]
maker-scaffold13_size735724-snap-gene-0.138.756e-3631.10protein:Tk03451 transcript:maker-scaffold13_size73... [more]
snap_masked-scaffold1362_size45580-processed-gene-0.128.993e-3628.75protein:Tk10797 transcript:snap_masked-scaffold136... [more]
maker-scaffold352_size199037-snap-gene-0.471.668e-3328.82protein:Tk08720 transcript:maker-scaffold352_size1... [more]
maker-scaffold362_size196086-snap-gene-0.316.850e-2926.26protein:Tk09343 transcript:maker-scaffold362_size1... [more]
maker-scaffold362_size196086-snap-gene-0.241.959e-2824.52protein:Tk09339 transcript:maker-scaffold362_size1... [more]
maker-scaffold1362_size45580-snap-gene-0.163.568e-2827.07protein:Tk10796 transcript:maker-scaffold1362_size... [more]
snap_masked-scaffold362_size196086-processed-gene-0.201.196e-2525.91protein:Tk09344 transcript:snap_masked-scaffold362... [more]
snap_masked-scaffold832_size90819-processed-gene-0.99.920e-2444.90protein:Tk09608 transcript:snap_masked-scaffold832... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s242supercontigLSalAtl2s242:969444..971852 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionaugustus_masked-LSalAtl2s242-processed-gene-9.0
Biotypeprotein_coding
EvidenceIEA
NoteCytochrome P450 9e2
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000004666 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000004666EMLSAT00000004666-700513Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s242:969444..971852+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000004666-687432 ID=EMLSAG00000004666-687432|Name=EMLSAG00000004666|organism=Lepeophtheirus salmonis|type=gene|length=2409bp|location=Sequence derived from alignment at LSalAtl2s242:969444..971852+ (Lepeophtheirus salmonis)
ATGGTCGATTCTCGAGATATTGTAGTTAGATATACTACTCAAAGTATTGC AAAGGCTGGGTTCGGTGTAGAAGCGAATTGCTTCGATTTAAGTGTGAAAG AACCATTATTCATGGAAATGGTCAACATCATTACTGGTAGAAAAGGGAAA AAGTGGAGACAAGTCTACATGTTCCTCTGCTTTCTTACCTTCCCCAATTG GTTTACCAAACATTCACCTATATCATTATTGGATCCAGGGAGTAAGAGTT TTTTTATCAACATGGTAAAGTCATCCATTGAAAATCGAAAGAAGAGCAAA GTCTCGCGAGGAGACTTTGTGGATCTCTTACTCGCAGAGTTTTATAAAAA CACAAGCATCAAACAAGATGAAATACAAAATGGAGAGGAGGCACCACAAT TTGAATTTGATGCAAAGATCAATATCCAAGACACAAAAGTAACGTTTGAT GAACAAGAGCTGGAACTTGTTTTGGTTGCAAATGTTCTTATACTTTTAAT GGCTGGSTTTGATACGACTTCTTCCATGATGACCGTCATGTTTGTATATC TAGCAAATCATCCCATTGTGCAAGAGAAATTGTTTGAGGAGATAAGTGGA GTCATTCATGAGAAAAACAATGGTGATGAAAAGTTAAACTATATGGACAT TAGAAGCTTGAAGTACCTGGATATGTTTATTCATGAAGTTCTTCGACATT TCCCCTTTATAAATTTGGAGAGGACTTGCATAAAGAAATATAAAATGCCA GGAACGGATTTGGACATTGAAAAAAGTAAGCAAACATAATAGATATGTAA GGAAGATCGGCGCACTTTCTTCCAACATTAAGAAATCACAATCACAAAAT TTATATTACAATTGTAGAAGTAATTAGAGCGTAAAAGTATGACGATATTT GGCGTGTGATAATCTTTTAAGTTGGGCAATCAAAATAGTGTTTTTTTACT TTTGAATGCGTTTATGGTTATTATTTTATATTTGTAGAGGGAACATCTAT TAGATAAAATAATCACAAATGCGTGACACACGAAGAGAAACACTTAGGAT TTCTTTCAAATGCAAGTTCTTCTAGGATTAAAAGTAGAATTGAAGATACA CATTGGGGTAATTACTGCAAAGGCCTTAGCCCAATAGTGAGTACGATTTG TCTTTTTTTTTTCTTCATCTCATAGCTGCTCTTAATTATTTCAATAAAAT GTCATGGAAGCTCAGTGTCTATCTTCGAATTTCAGTTGATTTAAAAAAAA TTAAAACAAACAAAAAACATTGAAAATTAATACAAAATTACAATAATACA AGTTGTTTTGTGCAATGACAAGGCAACAAGCATGCAAACAATMCCTCCGC CACTTCACAAAGCATTAAGGCCAAAAACTTAAAACTGAACCCCAGACCCA GGAGTTGATTAAGGCTACTTCGAAGGCACCAAGCAGGCTAAAAATCATGG GCCTAGAGGTTAATTTTGAAGCATTAGCAAGGGAATTAAATGCTTTGTCT TCACAAAGCATGTTGGCGGKGGTTTTTAACCTGTATGGTGTTACTGAAGT ATTTTTAAATGACTCATGGGCTTTGAAAGTTTGAAAGAGCCTAATTGTTT TGAGAAGTGGCATCATTAGTTTTTAACCTGCTTGATGGCTCTGCCATGGC ACAAAACAAATTTTAGGGAACCTGTATTCCGATTATGTTAGTAAATAATG GAAAAATTTCCTTTGGGAATTTTCCACACTACCAATTTTCTCCTGCTCAA TTTTTTTCAATGAGAATTGTCTTTATTGTAATTTTCTTTATGTCAACTTT GCATTTACTATTATCTCCATGCTAATTTTCCGTGTACTCGAATATAGTGT TAAATTTTGACGGGTCTAGTAATTGAGGCAAAAAGTAAAACTGTTTCAAC TCATTCCGATATCTCTTTTCACTTCGATTCTATCCATATCTGTTTTTCCA GATACGCTCTTTTTATTTCCAAACGATGCTTTTAACCTTTGTAAAGACCA CTATGAAGAGCCTGAGGTATTCAATCCAAACAACTTTACGGAGGAAAATA AAATAAAAAGGAGTACGTATTCCTTCTTAGCATTTGGACAAGGACCAAGG AACTGCATAGGAATGAGATTTGCAATGCTTCAAATGAAAACATGCCTATA CAGGTATTTGATAATCTCATCTTCTGATGATTATGTTATGATTATTCATT TTTCAGACTTGTGTACAAATATAAGTTTTTAAGAAATGAAAAAACAGTGG ATGAAATCCTGGTTGCTCCAAATGAACTAAGTCCAGATATAACTGGAGGA TCTTGGGTTACATTAAAAAAACGAAGAGCTTAAGATTTAAAAAAATATAT TATTTTTTTCTAGATTACATATTTTATTCGTTTTAAATCATTATTCCCGG GGTTTCCCA
back to top
Add to Basket