EMLSAG00000004810, EMLSAG00000004810-687576 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000004810
Unique NameEMLSAG00000004810-687576
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
O F89 UN6 female
  1. PreAdult2
  2. Adult
-Missing-
no visible phenotype
02.12.2013 - 10:45
08.01.2014 (All day)
Homology
BLAST of EMLSAG00000004810 vs. C. finmarchicus
Match: gi|592779103|gb|GAXK01175465.1| (TSA: Calanus finmarchicus comp2670_c3_seq21 transcribed RNA sequence)

HSP 1 Score: 360.533 bits (924), Expect = 4.930e-123
Identity = 165/219 (75.34%), Postives = 197/219 (89.95%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIG 219
            ++K+ETV+S++K+P+LECTHKN E+CHYTY+TQF PSQEEVC+ENFEK C ITFKQQA+NET+ KCY+P+EKVCNGQG E C+T+YESSCTTKYVEKQPGKFVGDT CEKLPIEICGAGCT EEG EECHDK + SLVD PEE+CDLNPQKTCRF TKLVP+L P H+CT +P+ET NLKF+ P++V+KPL+T+WCLD TP  PGE+YDEN+ALG+PIG
Sbjct:  120 VEKEETVTSLEKEPILECTHKNTEQCHYTYVTQFKPSQEEVCEENFEKQCSITFKQQAYNETVNKCYRPVEKVCNGQGEEVCQTVYESSCTTKYVEKQPGKFVGDTGCEKLPIEICGAGCTYEEGAEECHDKVIASLVDTPEEVCDLNPQKTCRFVTKLVPKLSPQHQCTIVPKETCNLKFSTPKQVEKPLQTRWCLDPTPAAPGESYDENDALGSPIG 776          
BLAST of EMLSAG00000004810 vs. C. finmarchicus
Match: gi|592779119|gb|GAXK01175449.1| (TSA: Calanus finmarchicus comp2670_c3_seq5 transcribed RNA sequence)

HSP 1 Score: 360.918 bits (925), Expect = 1.087e-122
Identity = 165/219 (75.34%), Postives = 197/219 (89.95%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIG 219
            ++K+ETV+S++K+P+LECTHKN E+CHYTY+TQF PSQEEVC+ENFEK C ITFKQQA+NET+ KCY+P+EKVCNGQG E C+T+YESSCTTKYVEKQPGKFVGDT CEKLPIEICGAGCT EEG EECHDK + SLVD PEE+CDLNPQKTCRF TKLVP+L P H+CT +P+ET NLKF+ P++V+KPL+T+WCLD TP  PGE+YDEN+ALG+PIG
Sbjct:  242 VEKEETVTSLEKEPILECTHKNTEQCHYTYVTQFKPSQEEVCEENFEKQCSITFKQQAYNETVNKCYRPVEKVCNGQGEEVCQTVYESSCTTKYVEKQPGKFVGDTGCEKLPIEICGAGCTYEEGAEECHDKVIASLVDTPEEVCDLNPQKTCRFVTKLVPKLSPQHQCTIVPKETCNLKFSTPKQVEKPLQTRWCLDPTPAAPGESYDENDALGSPIG 898          
BLAST of EMLSAG00000004810 vs. C. finmarchicus
Match: gi|592779115|gb|GAXK01175453.1| (TSA: Calanus finmarchicus comp2670_c3_seq9 transcribed RNA sequence)

HSP 1 Score: 360.147 bits (923), Expect = 2.149e-122
Identity = 164/219 (74.89%), Postives = 195/219 (89.04%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIG 219
            ++K E V++++KDP+LECTHKN E+CHYTY+TQF PSQEEVC+ENFEK C ITFKQQA+NET+ KCY+P+EKVCNGQG E C+T+YESSCTTKYVEKQPGKFVGDT CEKLPIEICGAGCT EEG EECHDK + SLVD PEE+CDLNPQKTCRF TKLVP+L P H+CT +P+ET NLKF+ P++V+KPL+T+WCLD TP  PGE+YDEN+ALG+PIG
Sbjct:  221 VEKTEEVTTLKKDPILECTHKNTEQCHYTYVTQFKPSQEEVCEENFEKQCSITFKQQAYNETVNKCYRPVEKVCNGQGEEVCQTVYESSCTTKYVEKQPGKFVGDTGCEKLPIEICGAGCTYEEGAEECHDKVIASLVDTPEEVCDLNPQKTCRFVTKLVPKLSPQHQCTIVPKETCNLKFSTPKQVEKPLQTRWCLDPTPAAPGESYDENDALGSPIG 877          
BLAST of EMLSAG00000004810 vs. C. finmarchicus
Match: gi|592938387|gb|GAXK01020166.1| (TSA: Calanus finmarchicus comp12516_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 360.147 bits (923), Expect = 4.431e-122
Identity = 168/209 (80.38%), Postives = 189/209 (90.43%), Query Frame = 0
Query:   12 KDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIGS 220
            K+P+LECTHKNVE+CHYTY+TQF+PSQEEVC+ENFEK C ITFKQQA+NET+KKCYKP+EKVCNGQG EECRT+YESSC+TKYVEKQPGKFVGDTSCEKLPIEICGAGCT EEGPEECHDK + SLVD+PEE+CDLNPQKTCRF TKLVP+LKP H+CT +P+ET  LKFTQP++VDKPL TKWCLD TP  PGE+YDE NA   PIG 
Sbjct:    2 KEPILECTHKNVEQCHYTYVTQFTPSQEEVCEENFEKQCSITFKQQAYNETVKKCYKPVEKVCNGQGEEECRTVYESSCSTKYVEKQPGKFVGDTSCEKLPIEICGAGCTFEEGPEECHDKVIVSLVDVPEEVCDLNPQKTCRFITKLVPKLKPEHQCTIVPKETCTLKFTQPKQVDKPLLTKWCLDPTPVAPGESYDEENAQAPPIGG 628          
BLAST of EMLSAG00000004810 vs. C. finmarchicus
Match: gi|592779113|gb|GAXK01175455.1| (TSA: Calanus finmarchicus comp2670_c3_seq11 transcribed RNA sequence)

HSP 1 Score: 358.607 bits (919), Expect = 5.700e-122
Identity = 163/219 (74.43%), Postives = 195/219 (89.04%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIG 219
            ++K+ETV+S++K+P+LECTHKN E+CHYTY+TQF PSQEEVCDE FEK+C ITFKQQAF + + KCY+P+EKVCNGQG E C+T+YESSCTTKYVEKQPGKFVGDT CEKLPIEICGAGCT EEG EECHDK + SLVD PEE+CDLNPQKTCRF TKLVP+L P H+CT +P+ET NLKF+ P++V+KPL+T+WCLD TP  PGE+YDEN+ALG+PIG
Sbjct:  205 VEKEETVTSLEKEPILECTHKNTEQCHYTYVTQFKPSQEEVCDETFEKTCSITFKQQAFEDVVNKCYRPVEKVCNGQGEEVCQTVYESSCTTKYVEKQPGKFVGDTGCEKLPIEICGAGCTYEEGAEECHDKVIASLVDTPEEVCDLNPQKTCRFVTKLVPKLSPQHQCTIVPKETCNLKFSTPKQVEKPLQTRWCLDPTPAAPGESYDENDALGSPIG 861          
BLAST of EMLSAG00000004810 vs. C. finmarchicus
Match: gi|592779108|gb|GAXK01175460.1| (TSA: Calanus finmarchicus comp2670_c3_seq16 transcribed RNA sequence)

HSP 1 Score: 357.836 bits (917), Expect = 1.032e-121
Identity = 163/219 (74.43%), Postives = 194/219 (88.58%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIG 219
            + K+ETV+S++K+P+LECTHKN E+CHYTY+TQF PSQEEVCDE FEK+C ITFKQQAF + + KCY+P+EKVCNGQG E C+T+YESSCTTKYVEKQPGKFVGDT CEKLPIEICGAGCT EEG EECHDK + SLVD PEE+CDLNPQKTCRF TKLVP+L P H+CT +P+ET NLKF+ P++V+KPL+T+WCLD TP  PGE+YDEN+ALG+PIG
Sbjct:  184 VDKEETVTSLEKEPILECTHKNTEQCHYTYVTQFKPSQEEVCDETFEKTCSITFKQQAFEDVVNKCYRPVEKVCNGQGEEVCQTVYESSCTTKYVEKQPGKFVGDTGCEKLPIEICGAGCTYEEGAEECHDKVIASLVDTPEEVCDLNPQKTCRFVTKLVPKLSPQHQCTIVPKETCNLKFSTPKQVEKPLQTRWCLDPTPAAPGESYDENDALGSPIG 840          
BLAST of EMLSAG00000004810 vs. C. finmarchicus
Match: gi|592779117|gb|GAXK01175451.1| (TSA: Calanus finmarchicus comp2670_c3_seq7 transcribed RNA sequence)

HSP 1 Score: 357.066 bits (915), Expect = 4.143e-121
Identity = 163/219 (74.43%), Postives = 195/219 (89.04%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIG 219
            ++K+ETV+S++K+P+LECTHKN E+CHYTY+TQF PSQEEVCDE FEK+C ITFKQQAF + + KCY+P+EKVCNGQG E C+T+YESSCTTKYVEKQPGKFVGDT CEKLPIEICGAGCT EEG EECHDK + SLVD PEE+CDLNPQKTCRF TKLVP+L P H+CT +P+ET NLKF+ P++V+KPL+T+WCLD TP  PGE+YDEN+ALG+PIG
Sbjct:  239 VEKEETVTSLEKEPILECTHKNTEQCHYTYVTQFKPSQEEVCDETFEKTCSITFKQQAFEDVVNKCYRPVEKVCNGQGEEVCQTVYESSCTTKYVEKQPGKFVGDTGCEKLPIEICGAGCTYEEGAEECHDKVIASLVDTPEEVCDLNPQKTCRFVTKLVPKLSPQHQCTIVPKETCNLKFSTPKQVEKPLQTRWCLDPTPAAPGESYDENDALGSPIG 895          
BLAST of EMLSAG00000004810 vs. C. finmarchicus
Match: gi|592913868|gb|GAXK01044507.1| (TSA: Calanus finmarchicus comp243337_c1_seq3 transcribed RNA sequence)

HSP 1 Score: 347.436 bits (890), Expect = 2.817e-114
Identity = 161/231 (69.70%), Postives = 194/231 (83.98%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIGSFSQNSNXFAQP 231
            ++K+E V++++KDP+LECTHKNVE+CHYTY+TQF+P+Q+E+C+ENFEK+C ITFKQQA+NETIKKCY P+EKVCNGQG  +C T+YES+CTTKYVEK PGKFV DT+CEKLP E+CGAGCT EEGPEECHDK VTSLVD+PEE+CDLNPQKTCR+ TKLVPRL P HECT IP+ET  LKFT P++V KPL TKWCLD   P PGE+Y+E NA  AP+ S       +  P
Sbjct:  148 IEKEECVNTLKKDPILECTHKNVEQCHYTYVTQFTPAQQEICEENFEKTCSITFKQQAYNETIKKCYIPIEKVCNGQGETQCTTVYESACTTKYVEKSPGKFVADTNCEKLPTELCGAGCTYEEGPEECHDKIVTSLVDVPEEVCDLNPQKTCRYATKLVPRLAPKHECTIIPKETCTLKFTTPKQVKKPLLTKWCLDPEEPAPGESYEEENAY-APVLSSGSAPQSYGVP 837          
BLAST of EMLSAG00000004810 vs. C. finmarchicus
Match: gi|592913867|gb|GAXK01044508.1| (TSA: Calanus finmarchicus comp243337_c1_seq4 transcribed RNA sequence)

HSP 1 Score: 346.28 bits (887), Expect = 4.738e-114
Identity = 161/231 (69.70%), Postives = 194/231 (83.98%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIGSFSQNSNXFAQP 231
            ++K+E V++++KDP+LECTHKNVE+CHYTY+TQF+P+Q+E+C+ENFEK+C ITFKQQA+NETIKKCY P+EKVCNGQG  +C T+YES+CTTKYVEK PGKFV DT+CEKLP E+CGAGCT EEGPEECHDK VTSLVD+PEE+CDLNPQKTCR+ TKLVPRL P HECT IP+ET  LKFT P++V KPL TKWCLD   P PGE+Y+E NA  AP+ S       +  P
Sbjct:  148 IEKEECVNTLKKDPILECTHKNVEQCHYTYVTQFTPAQQEICEENFEKTCSITFKQQAYNETIKKCYIPIEKVCNGQGETQCTTVYESACTTKYVEKSPGKFVADTNCEKLPTELCGAGCTYEEGPEECHDKIVTSLVDVPEEVCDLNPQKTCRYATKLVPRLAPKHECTIIPKETCTLKFTTPKQVKKPLLTKWCLDPEEPAPGESYEEENAY-APVLSSGSAPQSYGVP 837          
BLAST of EMLSAG00000004810 vs. C. finmarchicus
Match: gi|592779101|gb|GAXK01175467.1| (TSA: Calanus finmarchicus comp2670_c3_seq23 transcribed RNA sequence)

HSP 1 Score: 335.88 bits (860), Expect = 1.109e-113
Identity = 162/219 (73.97%), Postives = 197/219 (89.95%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIG 219
            ++K+ETV+S++K+P+LECTHKN E+CHYTY+TQF PSQEEVC+ENFEK C ITFKQQA+NET+ KCY+P+EKVCNGQG E C+T+YESSCTTKYVEKQPGKFVGDT CEKLP+EICGAGCT EEG EECH+K +TS+VD+PEE+CDLNPQK C+F TKLVP+L P HECT +P+ET  LKFTQP++V+KPL+T+WCLD TP  PGE+YDE +ALGAP+G
Sbjct:  120 VEKEETVTSLEKEPILECTHKNTEQCHYTYVTQFKPSQEEVCEENFEKQCSITFKQQAYNETVNKCYRPVEKVCNGQGEEVCQTVYESSCTTKYVEKQPGKFVGDTGCEKLPVEICGAGCTFEEGEEECHEKVITSVVDVPEEVCDLNPQKICKFVTKLVPKLSPKHECTIVPKETCLLKFTQPKQVEKPLQTRWCLDPTPAAPGESYDEEDALGAPLG 776          
BLAST of EMLSAG00000004810 vs. L. salmonis peptides
Match: EMLSAP00000004810 (pep:novel supercontig:LSalAtl2s:LSalAtl2s2542:14622:15869:1 gene:EMLSAG00000004810 transcript:EMLSAT00000004810 description:"maker-LSalAtl2s2542-snap-gene-0.3")

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 295/295 (100.00%), Postives = 295/295 (100.00%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIGSFSQNSNXFAQPDNSVGSQQQSSSSSSSFGPQQQSSSFGGSSSSSFGPQQSSSFGSQSSSGGLQQVSSFGQQGSSF 295
            MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIGSFSQNSNXFAQPDNSVGSQQQSSSSSSSFGPQQQSSSFGGSSSSSFGPQQSSSFGSQSSSGGLQQVSSFGQQGSSF
Sbjct:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIGSFSQNSNXFAQPDNSVGSQQQSSSSSSSFGPQQQSSSFGGSSSSSFGPQQSSSFGSQSSSGGLQQVSSFGQQGSSF 295          
BLAST of EMLSAG00000004810 vs. L. salmonis peptides
Match: EMLSAP00000005864 (pep:novel supercontig:LSalAtl2s:LSalAtl2s317:796700:797727:-1 gene:EMLSAG00000005864 transcript:EMLSAT00000005864 description:"maker-LSalAtl2s317-augustus-gene-7.13")

HSP 1 Score: 411.379 bits (1056), Expect = 5.966e-144
Identity = 188/231 (81.39%), Postives = 211/231 (91.34%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIGSFSQNSNXFAQP 231
            ++K+E++SSIQKDP+LECTHKNVEKCHYTY+TQF+PSQEE+C+ENFEK CQITFK QAFNET++KC KPLEKVCNGQGPEECRTLYESSC+TKYVEKQPGKFVGDTSCEKLPIEICGAGC TEEGPEECHDK +TS +DIPEEICDLNPQK CRF+TKLVPRL+PAHECTTIPQET NLKFT P++VDK +KTKWCLDDTP VPGETYDE+N+LGAPIG     +N    P
Sbjct:   63 IEKEESISSIQKDPVLECTHKNVEKCHYTYVTQFAPSQEEICEENFEKKCQITFKLQAFNETVQKCXKPLEKVCNGQGPEECRTLYESSCSTKYVEKQPGKFVGDTSCEKLPIEICGAGCVTEEGPEECHDKVITSFIDIPEEICDLNPQKICRFETKLVPRLRPAHECTTIPQETCNLKFTSPQRVDKKIKTKWCLDDTPAVPGETYDESNSLGAPIGGALSTNNIVQTP 293          
BLAST of EMLSAG00000004810 vs. L. salmonis peptides
Match: EMLSAP00000005853 (pep:novel supercontig:LSalAtl2s:LSalAtl2s317:196616:199534:-1 gene:EMLSAG00000005853 transcript:EMLSAT00000005853 description:"maker-LSalAtl2s317-augustus-gene-3.12")

HSP 1 Score: 362.459 bits (929), Expect = 3.781e-124
Identity = 162/211 (76.78%), Postives = 191/211 (90.52%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDEN 211
            ++K+E  +S+QKDP+LECTHKNVEKCHYTY+TQF+PSQEEVC+ENFEK+CQ+TFKQQAFN+TI+KCYKPLEK+CNGQGPEEC+T+YESSCTTKYVEK+PGK+VGDT CEKLPIEICGAGC T EGPEECH+K +TSL+D+PEE+CDLNPQKTCRFQTKLVP+L P HECT  PQE  +LKF+Q   V K L+TKWC D TPP PGE+Y+EN
Sbjct:   77 IEKEEPFTSLQKDPILECTHKNVEKCHYTYVTQFTPSQEEVCEENFEKTCQVTFKQQAFNDTIRKCYKPLEKICNGQGPEECKTVYESSCTTKYVEKKPGKYVGDTKCEKLPIEICGAGCVTSEGPEECHNKVITSLIDVPEEVCDLNPQKTCRFQTKLVPKLSPKHECTVFPQEICHLKFSQAAPVTKTLRTKWCQDPTPPSPGESYEEN 287          
BLAST of EMLSAG00000004810 vs. L. salmonis peptides
Match: EMLSAP00000011660 (pep:novel supercontig:LSalAtl2s:LSalAtl2s80:816431:818367:1 gene:EMLSAG00000011660 transcript:EMLSAT00000011660 description:"maker-LSalAtl2s80-augustus-gene-8.34")

HSP 1 Score: 349.362 bits (895), Expect = 1.237e-119
Identity = 159/216 (73.61%), Postives = 188/216 (87.04%), Query Frame = 0
Query:    3 KDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPI 218
            K++++ S++K P+LECTHKNVEKCHYTY+TQF PSQE+VC+ENFEK CQITFK+QA  ET+KKCYKPL+KVCNGQG E+CRT+YESSC+TKYVEKQPGKFVGDT C+KLPI+ICG GC T+EG EECHDK + ++ DIPEEICDLNPQ+TC  QTKLVP+LKP HECT +PQE  N+KFT P    K LKTKWCLDD+P +PGETYDE NALG+PI
Sbjct:   68 KEDSIDSLEKRPILECTHKNVEKCHYTYVTQFDPSQEKVCEENFEKVCQITFKKQAQEETVKKCYKPLKKVCNGQGEEQCRTVYESSCSTKYVEKQPGKFVGDTRCQKLPIKICGRGCITQEGKEECHDKKIVTMTDIPEEICDLNPQRTCSRQTKLVPKLKPEHECTIVPQEVCNIKFTSPTIQKKALKTKWCLDDSPVIPGETYDEANALGSPI 283          
BLAST of EMLSAG00000004810 vs. L. salmonis peptides
Match: EMLSAP00000006363 (pep:novel supercontig:LSalAtl2s:LSalAtl2s348:125017:171411:1 gene:EMLSAG00000006363 transcript:EMLSAT00000006363 description:"maker-LSalAtl2s348-snap-gene-1.8")

HSP 1 Score: 282.337 bits (721), Expect = 3.417e-90
Identity = 136/220 (61.82%), Postives = 160/220 (72.73%), Query Frame = 0
Query:    7 VSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEE--------CRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPI 218
            + SI KDP+LEC HK VEKCHYTY+TQF  SQEE+CDENFEK CQITFKQ A  E IKKCYKP+ K C  +   E        C T+YE+SCTT+YV+K+ GKFVGDT+CEK+PIE+CG GCT  EGPEECHDK + SL       CDLNPQKTCRF TKLVP+LKP HECTTIP+E   LKF+QP++V KPL TKWC+D       +T     + GAP+
Sbjct:   58 IQSISKDPILECNHKQVEKCHYTYVTQFESSQEEICDENFEKKCQITFKQVAVKEKIKKCYKPMIKKCGKEAALEYNRNVETKCETVYETSCTTRYVQKRSGKFVGDTNCEKIPIELCGKGCTITEGPEECHDKVLDSLA------CDLNPQKTCRFATKLVPKLKPKHECTTIPKEVCALKFSQPKQVPKPLTTKWCIDPNGQTIKDTGSYAESEGAPL 271          
BLAST of EMLSAG00000004810 vs. L. salmonis peptides
Match: EMLSAP00000011641 (pep:novel supercontig:LSalAtl2s:LSalAtl2s80:222871:263126:1 gene:EMLSAG00000011641 transcript:EMLSAT00000011641 description:"maker-LSalAtl2s80-snap-gene-2.13")

HSP 1 Score: 188.734 bits (478), Expect = 2.207e-54
Identity = 92/211 (43.60%), Postives = 133/211 (63.03%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEE------CRTLYESSCTTKYVEKQ------PGKFVGDTSCEKLPIEICGAG-CTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLD 198
            + K+ T+   +++ LLEC H  +  CHYTY+T+F+  + E CD+++EK C+I FK    NET+K CY+P+ K C  +          C+T++E+ C+T+YVEKQ      P K+VG T+C+KLPIE+CG+  C    G E CH+KTVTS++ +PEE CDL PQ+TC+   KLVP L P  +C  +P+E         R  +KP+ TKWC D
Sbjct:   53 VNKESTIQKKEQERLLECVHSKINVCHYTYVTRFTSQRVEKCDDHYEKICRIIFKDLPTNETVKHCYRPMVKECRSKDENVDDDNLICKTVFETECSTRYVEKQSKDEKAPKKYVGLTACKKLPIELCGSQYCDFVPGDETCHNKTVTSIIPVPEESCDLVPQETCKGVYKLVPYLVPESQCKDVPREVCTYGVKSTRLGEKPIVTKWCYD 263          
BLAST of EMLSAG00000004810 vs. L. salmonis peptides
Match: EMLSAP00000011985 (pep:novel supercontig:LSalAtl2s:LSalAtl2s853:228352:229792:1 gene:EMLSAG00000011985 transcript:EMLSAT00000011985 description:"augustus-LSalAtl2s853-processed-gene-2.5")

HSP 1 Score: 173.711 bits (439), Expect = 4.040e-51
Identity = 98/240 (40.83%), Postives = 129/240 (53.75%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVE-------------------------------------------KQPGKFVGDTSCEKLPIEICG-AGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWC 196
            + K   V   + D  +EC H   E+CH TY T F P QEE C+ENF+KSC I +K+ A +ETIK C+ P   +C G+GPEEC+T+YES CTT+Y E                                           K   K+   T C+K+P E+CG +GC  + GPEEC DK  T + ++PEE C+L PQK+C+  TKLVP LKP  EC  +P+E  +     PRKV KP+  KWC
Sbjct:  103 IDKVVVVEETEYDDHIECHHSYSERCHTTYTTDFEPQQEEKCEENFKKSCFIEYKKVAIDETIKFCHTPF--ICEGEGPEECKTVYESECTTRYHEHDVEDDVVNCETIQEEKCEDVTQGYTTEQKCTKWPRQVCTSEKKNVLKYSPQTECKKVPRELCGPSGCVLQPGPEECFDKKETIVQEVPEENCNLEPQKSCKQVTKLVPSLKPVEECVDVPKEVCSRSRKNPRKVQKPVVKKWC 340          
BLAST of EMLSAG00000004810 vs. L. salmonis peptides
Match: EMLSAP00000008231 (pep:novel supercontig:LSalAtl2s:LSalAtl2s496:244858:246035:-1 gene:EMLSAG00000008231 transcript:EMLSAT00000008231 description:"snap-LSalAtl2s496-processed-gene-2.2")

HSP 1 Score: 168.703 bits (426), Expect = 1.197e-49
Identity = 92/186 (49.46%), Postives = 122/186 (65.59%), Query Frame = 0
Query:   13 DPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEK-QPGKFVGDTSCEKLPIEICG-AGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWC 196
            D  +EC H   E+CH TYIT F P QEE C+ENF+KSC I +K+ A +ET+K C+ P   VC G+GPEEC+T+YE+ C T+Y E     K+   T C+K+P ++CG +GC  + GPEEC DK    + ++PEE C+L PQK C+  TKLVP LKP  EC  +P+E  +     PRKV KP+  KWC
Sbjct:  105 DDHIECHHSYSERCHTTYITDFEPQQEEECEENFKKSCFIEYKKVAVDETVKFCHTPF--VCEGEGPEECKTVYETECETRYHEHDNVKKYSPITECKKVPRQLCGPSGCVPQPGPEECFDKNEVIVQEVPEEQCNLEPQKACKQVTKLVPSLKPVEECVDVPKEVCSRSRKNPRKVQKPVVKKWC 288          
BLAST of EMLSAG00000004810 vs. L. salmonis peptides
Match: EMLSAP00000007535 (pep:novel supercontig:LSalAtl2s:LSalAtl2s433:58038:59212:-1 gene:EMLSAG00000007535 transcript:EMLSAT00000007535 description:"augustus-LSalAtl2s433-processed-gene-1.3")

HSP 1 Score: 162.925 bits (411), Expect = 4.467e-47
Identity = 91/240 (37.92%), Postives = 126/240 (52.50%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVE-------------------------------------------KQPGKFVGDTSCEKLPIEICG-AGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWC 196
            + K   V   + D  +EC H   E+CH TY T F P QEE C+ENF+K C I +K+ A +E ++ C+ PL  +C G+GPEEC+T+YES C T+Y E                                           K   K+  +T C+K+P E+CG  GC  + GPEEC +K  T + ++PEE+C L PQK+C+  TKL+P LKP  EC  +P+E  +     PR V KP+  KWC
Sbjct:   96 IDKVVMVEETEYDDHIECHHSYSERCHTTYTTDFEPQQEEDCEENFKKDCFIEYKKIAVDEPVEFCHTPL--ICEGEGPEECKTVYESECRTRYHEHDVEDDVVNCETIQEEKXEDVTQGYTTEQKCTKWPKQVCTNEKKNVKKYSPETDCKKIPRELCGPTGCVPQAGPEECFEKKETIVQEVPEELCYLEPQKSCKQVTKLIPTLKPVEECVDVPKEICSRSRKNPRVVKKPVIKKWC 333          
BLAST of EMLSAG00000004810 vs. L. salmonis peptides
Match: EMLSAP00000012697 (pep:novel supercontig:LSalAtl2s:LSalAtl2s963:82712:83816:-1 gene:EMLSAG00000012697 transcript:EMLSAT00000012697 description:"augustus-LSalAtl2s963-processed-gene-0.9")

HSP 1 Score: 155.992 bits (393), Expect = 2.204e-44
Identity = 98/240 (40.83%), Postives = 128/240 (53.33%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVE-------------------------------------------KQPGKFVGDTSCEKLPIEICG-AGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWC 196
            + K   V   + D  +EC H   E+CH TY T F P QEE C+ENF+KSC I +K+ A  ET+K C+ PL  VC G+GPEEC+T+YES C TKY E                                           K   K+   T C+K+P ++CG +GC  + GPEEC DK  T + ++PEE C+L PQK+C+  TKLVP LKP  EC  +P+E  +     PRKV KP+  KWC
Sbjct:  100 IDKVVMVEETEYDDHIECHHSYSERCHTTYTTDFEPQQEEECEENFKKSCFIEYKKVAVEETVKFCHTPL--VCEGEGPEECKTVYESECETKYHEHDVEDDVVNCETIQEEKCEDVTQGYTTEQKCTKWPKQVCTNEKKNVKKYSPQTECKKVPRQLCGPSGCVPQPGPEECFDKKETIVQEVPEENCNLEPQKSCKQVTKLVPSLKPVEECVDVPKEVCSRSRKNPRKVQKPVVKKWC 337          
BLAST of EMLSAG00000004810 vs. nr
Match: gi|155966163|gb|ABU41036.1| (hypothetical protein [Lepeophtheirus salmonis])

HSP 1 Score: 156.762 bits (395), Expect = 5.184e-42
Identity = 99/240 (41.25%), Postives = 129/240 (53.75%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVE-------------------------------------------KQPGKFVGDTSCEKLPIEICG-AGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWC 196
            + K   V   + D  +EC H   E+CH TY T F P QEE C+ENF+KSC I +K+ A +ET+K C+ PL  VC G+GPEEC+T+YES C TKY E                                           K   K+   T C+K+P ++CG +GC  + GPEEC DK  T + ++PEE C+L PQK+C+  TKLVP LKP  EC  IP+E  +     PRKV KP+  KWC
Sbjct:   96 IDKVVMVEETEYDDHIECHHSYSERCHTTYTTDFEPQQEEECEENFKKSCFIEYKKVAVDETVKFCHTPL--VCEGEGPEECKTVYESECETKYHEHDVEDDVVNCEXIQEEKCEDVTQGYTTEQKCTKWPKQVCTNEKKNVKKYSPQTECKKVPRQLCGPSGCVPQPGPEECFDKKETIVQEVPEENCNLEPQKSCKQVTKLVPSLKPVEECVDIPKEVCSRSRKNPRKVQKPVVKKWC 333          
BLAST of EMLSAG00000004810 vs. nr
Match: gi|155966261|gb|ABU41084.1| (hypothetical protein [Lepeophtheirus salmonis])

HSP 1 Score: 156.377 bits (394), Expect = 9.872e-42
Identity = 99/240 (41.25%), Postives = 127/240 (52.92%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVE-------------------------------------------KQPGKFVGDTSCEKLPIEICG-AGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWC 196
            + K   V   + D  +EC H   E+CH TY T F P QEE C+ENF+KSC I +K+ A  ET+K C+ PL  VC G+GPEEC+T+YES C TKY E                                           K   K+   T C+K+P ++CG +GC  + GPEEC DK  T + ++PEE C+L PQK C+  TKLVP LKP  EC  IP+E  +     PRKV KP+  KWC
Sbjct:  100 IDKVVMVEETEYDDHIECHHSYSERCHTTYTTDFEPQQEEECEENFKKSCFIEYKKVAVEETVKFCHTPL--VCEGEGPEECKTVYESECETKYHEHDVEDDVVNCETIQEEKCEDVTQGYTTEQKCTKWPKQVCTNEKKNVKKYSPQTECKKVPRQLCGPSGCVPQPGPEECFDKKETIVQEVPEENCNLEPQKACKQVTKLVPSLKPVEECVDIPKEVCSRSRKNPRKVQKPVVKKWC 337          
BLAST of EMLSAG00000004810 vs. nr
Match: gi|155966212|gb|ABU41060.1| (hypothetical protein, partial [Lepeophtheirus salmonis])

HSP 1 Score: 122.865 bits (307), Expect = 1.317e-30
Identity = 73/187 (39.04%), Postives = 96/187 (51.34%), Query Frame = 0
Query:   54 FKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVE-------------------------------------------KQPGKFVGDTSCEKLPIEICG-AGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWC 196
            +K+ A +ET+K C+ PL  VC G GPEEC+T+YES C TKY E                                           K   K+   T C+K+P ++CG +GC  + GPEEC DK  T + ++PEE C+L PQK C+  TKLVP LKP  EC  +P+E  +     PRKV KP+  KWC
Sbjct:    1 YKKVAVDETVKFCHTPL--VCEGDGPEECKTVYESECETKYHEHDVEDDVVNCETIQEEKCEDVTQGYTTEQKCTKWPKQVCTSEKKNVKKYSPQTECKKVPRQLCGPSGCIPQPGPEECFDKKETIVQEVPEENCNLEPQKACKQVTKLVPSLKPVEECVDVPKEVCSRSRKNPRKVQKPVVKKWC 185          
BLAST of EMLSAG00000004810 vs. nr
Match: gi|155966139|gb|ABU41024.1| (hypothetical protein [Lepeophtheirus salmonis])

HSP 1 Score: 112.464 bits (280), Expect = 1.257e-26
Identity = 67/171 (39.18%), Postives = 85/171 (49.71%), Query Frame = 0
Query:   70 LEKVCNGQGPEECRTLYESSCTTKYVE-------------------------------------------KQPGKFVGDTSCEKLPIEICG-AGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWC 196
            L  VC G+GPEEC+T+YES C TKY E                                           K   K+   T C+K+P ++CG +GC  + GPEEC DK  T + ++PEE C+L PQK C+  TKLVP LKP  EC  IP+E  +     PRKV KP+  KWC
Sbjct:    9 LPLVCEGEGPEECKTVYESECETKYHEHDVEDDVVNCETIQEEKCEDVTQGYTTEQKCTKWPKQVCTNEKKNVKKYSPQTECKKVPRQLCGPSGCVPQPGPEECFDKKETIVQEVPEENCNLEPQKACKQVTKLVPSLKPVEECVDIPKEVCSRSRKNPRKVQKPVVKKWC 179          
BLAST of EMLSAG00000004810 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold2574_size14355-snap-gene-0.2 (protein:Tk08805 transcript:maker-scaffold2574_size14355-snap-gene-0.2-mRNA-1 annotation:"hypothetical protein")

HSP 1 Score: 387.111 bits (993), Expect = 1.533e-136
Identity = 178/232 (76.72%), Postives = 207/232 (89.22%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIG-SFSQNSNXFAQP 231
            ++KDE V+SIQKDP+LECTHKNVEKCHYTY+TQF  +QEEVC+ENFEK+CQITFKQQA  ET++KCYKPLEKVCNGQGPEECRT+YESSC+TKY+EKQPGKFVGDTSCEKLP+EICGAGC TEEG EECHDKT+TSL+D+PEE+CDLNPQKTCRFQTKLVPRLKP HECT IP+ET NLKF+ P++V+KPL+TKWCLD + PVP +TYDEN A  AP+G + S     + QP
Sbjct:   54 VEKDEVVTSIQKDPILECTHKNVEKCHYTYVTQFEAAQEEVCEENFEKTCQITFKQQATEETVRKCYKPLEKVCNGQGPEECRTVYESSCSTKYIEKQPGKFVGDTSCEKLPVEICGAGCVTEEGIEECHDKTITSLLDVPEEVCDLNPQKTCRFQTKLVPRLKPEHECTIIPRETCNLKFSSPQQVEKPLRTKWCLDPSAPVPDQTYDENQAGAAPLGFAASAPQATYVQP 285          
BLAST of EMLSAG00000004810 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold228_size248166-snap-gene-0.9 (protein:Tk04317 transcript:maker-scaffold228_size248166-snap-gene-0.9-mRNA-1 annotation:"hypothetical protein")

HSP 1 Score: 386.726 bits (992), Expect = 5.722e-136
Identity = 178/232 (76.72%), Postives = 207/232 (89.22%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIG-SFSQNSNXFAQP 231
            ++KDE V+SIQKDP+LECTHKNVEKCHYTY+TQF  +QEEVC+ENFEK+CQITFKQQA  ET++KCYKPLEKVCNGQGPEECRT+YESSC+TKY+EKQPGKFVGDTSCEKLP+EICGAGC TEEG EECHDKT+TSL+D+PEE+CDLNPQKTCRFQTKLVPRLKP HECT IP+ET NLKF+ P++V+KPL+TKWCLD + PVP +TYDEN A  AP+G + S     + QP
Sbjct:   89 VEKDEVVTSIQKDPILECTHKNVEKCHYTYVTQFEAAQEEVCEENFEKTCQITFKQQATEETVRKCYKPLEKVCNGQGPEECRTVYESSCSTKYIEKQPGKFVGDTSCEKLPVEICGAGCVTEEGIEECHDKTITSLLDVPEEVCDLNPQKTCRFQTKLVPRLKPEHECTIIPRETCNLKFSSPQQVEKPLRTKWCLDPSAPVPDQTYDENQAGAAPLGFAASAPQATYVQP 320          
BLAST of EMLSAG00000004810 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold546_size140615-processed-gene-0.15 (protein:Tk00848 transcript:snap_masked-scaffold546_size140615-processed-gene-0.15-mRNA-1 annotation:"hypothetical protein")

HSP 1 Score: 384.03 bits (985), Expect = 1.404e-135
Identity = 175/219 (79.91%), Postives = 200/219 (91.32%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIG 219
            ++ +E V +++KDP+LECTHKN+EKCHYTY+TQF P+QEEVC+ENFEKSCQITFKQQA  E +KKCY+PLEKVCNGQGPEECRT+YESSCTTKY+EKQPGKFVGDTSCEKLPIEICGAGC TEEGPEECHDKTVTSL+D+PEE+CDLNPQKTC+FQTKLVP+LKP HECT IPQE  NLKFT P++VD+PLKTKWCLD TP   GETYDEN+A  AP+G
Sbjct:   59 VESEEIVQTLKKDPILECTHKNIEKCHYTYVTQFEPAQEEVCEENFEKSCQITFKQQAVEEQVKKCYRPLEKVCNGQGPEECRTVYESSCTTKYIEKQPGKFVGDTSCEKLPIEICGAGCVTEEGPEECHDKTVTSLIDVPEEVCDLNPQKTCKFQTKLVPKLKPEHECTIIPQEICNLKFTSPQQVDQPLKTKWCLDPTPAAAGETYDENSAGAAPLG 277          
BLAST of EMLSAG00000004810 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold546_size140615-snap-gene-0.28 (protein:Tk00842 transcript:maker-scaffold546_size140615-snap-gene-0.28-mRNA-1 annotation:"pbcv-specific basic adaptor domain-containing protein")

HSP 1 Score: 380.948 bits (977), Expect = 6.737e-133
Identity = 188/275 (68.36%), Postives = 217/275 (78.91%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIGSFSQNSNXF-----AQPDNSVGSQQQSSSSSSSFGPQQQSSSFGGSSSSS--FGPQ 268
            ++K ETV+S+QKDP+LECTHKNVEKCHYTY+TQF P+QEEVC+ENFEKSCQ+TFKQQA  ET+KKCY+PLEKVCNGQGPEECRT+YESSCTTKY+EKQPGKFVGDTSCEKLPIEICGAGC TEEGP+ECHDKT+TSL+D+PEE CDLNPQKTCRFQTKLVP+L+P HECT IPQE  NLKFT P++V+KPLKTKWC D   P+P +TYDE NA GAP   F Q           +P  +   Q Q   +   F PQ     F   ++S   F PQ
Sbjct:   62 IEKFETVTSLQKDPILECTHKNVEKCHYTYVTQFEPAQEEVCEENFEKSCQVTFKQQAIEETVKKCYRPLEKVCNGQGPEECRTVYESSCTTKYIEKQPGKFVGDTSCEKLPIEICGAGCVTEEGPQECHDKTITSLLDVPEEACDLNPQKTCRFQTKLVPKLEPKHECTIIPQEICNLKFTSPQQVEKPLKTKWCQDPAAPIPDQTYDEFNA-GAPPIQFPQTQTGSRPQGQPRPQPTSRPQFQPQPTRPQFQPQPTRPQFQPQTTSRPQFQPQ 335          
BLAST of EMLSAG00000004810 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold546_size140615-snap-gene-0.34 (protein:Tk00847 transcript:maker-scaffold546_size140615-snap-gene-0.34-mRNA-1 annotation:"adhesive plaque matrix partial")

HSP 1 Score: 382.489 bits (981), Expect = 1.601e-132
Identity = 189/278 (67.99%), Postives = 219/278 (78.78%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGAGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLDDTPPVPGETYDENNALGAPIGSFSQNSNXF-----AQPDNSVGSQQQSSSSSSSFGPQQQSSSFGGSSSSS--FGPQQSS 271
            ++K ETV+S+QKDP+LECTHKNVEKCHYTY+TQF P+QEEVC+ENFEKSCQ+TFKQQA  ET+KKCY+PLEKVCNGQGPEECRT+YESSCTTKY+EKQPGKFVGDTSCEKLPIEICGAGC TEEGP+ECHDKT+TSL+D+PEE CDLNPQKTCRFQTKLVP+L+P HECT IPQE  NLKFT P++V+KPLKTKWC D   P+P +TYDE NA GAP   F Q           +P  +   Q Q   +   F PQ     F   ++S   F PQ +S
Sbjct:   85 IEKFETVTSLQKDPILECTHKNVEKCHYTYVTQFEPAQEEVCEENFEKSCQVTFKQQAIEETVKKCYRPLEKVCNGQGPEECRTVYESSCTTKYIEKQPGKFVGDTSCEKLPIEICGAGCVTEEGPQECHDKTITSLLDVPEEACDLNPQKTCRFQTKLVPKLEPKHECTIIPQEICNLKFTSPQQVEKPLKTKWCQDPAAPIPDQTYDEFNA-GAPPIQFPQTQTGSRPQGQPRPQPTSRPQFQPQPTRPQFQPQPTRPQFQPQTTSRPQFQPQPTS 361          
BLAST of EMLSAG00000004810 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold546_size140615-snap-gene-0.29 (protein:Tk00843 transcript:maker-scaffold546_size140615-snap-gene-0.29-mRNA-1 annotation:"---NA---")

HSP 1 Score: 229.18 bits (583), Expect = 2.929e-68
Identity = 120/259 (46.33%), Postives = 153/259 (59.07%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVC---NGQGPEE-CRTLYESSCTTKYVEKQPGKFVGDTSCEKLPIEICGA-GCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWCLD--DTPPVPGETYDENNALGAPIGSFSQNSNXFAQPDNSVGSQQQSSSSSSSFGPQQ 252
            M K  TV + +++ LLECTH  V  CHYTY T+F   +EE C +N+EK C I FKQQA NET++KCY+P+ K C   +  G E  C+T++ES C+T+YVEK PGKFVG+T+C K+P E+CG   CT   GPEECH+KTV +LVD+PEE CDL PQKTCR   KLVP L P HEC   P+E  +         +K + TKWC D  +T P  G     N         F   S       ++ G  Q S  + S  G  Q
Sbjct:   78 MDKSATVKTQERERLLECTHSLVNLCHYTYETKFKSQREEECQDNYEKICSIVFKQQATNETLEKCYQPMVKQCSEASSNGNELICQTVFESECSTRYVEKSPGKFVGETTCSKIPKELCGTNACTFVPGPEECHNKTVANLVDVPEENCDLVPQKTCRGAVKLVPYLSPTHECANFPKEVCSFGVKGTIFGEKAIVTKWCFDPTETDPFQGSQGTRNGGTQGSGAGFQGTSGGIGASQSAGGGFQGSRGTGSGIGGSQ 336          
BLAST of EMLSAG00000004810 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold961_size76351-processed-gene-0.8 (protein:Tk11636 transcript:snap_masked-scaffold961_size76351-processed-gene-0.8-mRNA-1 annotation:"hypothetical protein")

HSP 1 Score: 154.451 bits (389), Expect = 8.959e-45
Identity = 92/214 (42.99%), Postives = 121/214 (56.54%), Query Frame = 0
Query:   18 CTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVE----------------------------------KQPGKFVGDTSCEKLPIEICG-AGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWC 196
            C H   E+CH TY T F P QEE C+ENF+KSC I +++ AF E I  C+ PL  +C G+GPEEC+T+YES C T+Y E                                  K   K+  +T C+K+  E+CG +GC  + GPEEC DK  T + ++PEE C+L PQ++C+  TKLVP LKPA EC  IP+E  +     PRKV KP+  KWC
Sbjct:  139 CHHSYSERCHTTYTTDFEPQQEEECEENFKKSCFIEYRKVAFEEPITFCHTPL--ICEGEGPEECKTVYESQCETRYHEHEVEDDVVECETIQEEKCEDKCTKWPKQVCKNEKKTVKKYTPETECKKVGRELCGPSGCLLQPGPEECFDKKETVVQEVPEETCNLEPQRSCKHVTKLVPLLKPAEECVDIPKEVCSRSRKNPRKVQKPVVKKWC 350          
BLAST of EMLSAG00000004810 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold804_size94796-processed-gene-0.10 (protein:Tk06341 transcript:snap_masked-scaffold804_size94796-processed-gene-0.10-mRNA-1 annotation:"hypothetical protein")

HSP 1 Score: 153.295 bits (386), Expect = 7.088e-43
Identity = 87/234 (37.18%), Postives = 115/234 (49.15%), Query Frame = 0
Query:    7 VSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVE-------------------------------------------KQPGKFVGDTSCEKLPIEICGAG-CTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWC 196
            V  +  D  +EC H   ++CH TY T + P QEE CD+NF K+C I +K  AF+E +K C + L + C+  GPE C T+YES C T Y E                                           K   K+  +T C K P  +CG G C  E GPEEC ++  T + +IP+E CDL PQK C+  TKL+P LKP   C  IP+E        PRK++KP+  KWC
Sbjct:  239 VEELVYDEQIECHHSYDQRCHTTYTTDYEPQQEEECDDNFIKNCYIEYKTVAFDEPVKICNENLIRNCDKPGPEVCETVYESECETSYHEHELEEDVPACRTMQVEKCRDVTVGYTTEQQCDKWPKQVCELESKTVKKYSPETQCRKTPRTVCGPGPCPIEAGPEECREEKKTVVQEIPQENCDLTPQKVCKHVTKLIPVLKPKQNCVDIPKEVCTRARRNPRKINKPVIKKWC 472          

HSP 2 Score: 68.5514 bits (166), Expect = 3.526e-13
Identity = 61/236 (25.85%), Postives = 94/236 (39.83%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPE--------------ECRTLYESSCTTKYV--------EKQPGKFVGDTSCE------KLPIEICGAGCTT---EEGPEEC------------HDKTVTSLVDIP-------------------EEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQ 174
            ++K   V  +  D  +EC H   ++CH TY T + P QEE CD+NF K+C I +K  AF+E +K C + L + C+  G E              EC   Y+  C T Y         E+    F+ +   E        P++IC         + GPE C            H+  +    D+P                   E+ CD  P++ C  ++K V +  P  +C   P+
Sbjct:  155 IEKVMMVEELVYDEQIECHHSYDQRCHTTYTTDYEPQQEEECDDNFIKNCYIEYKTVAFDEPVKICNENLIRNCDKPGKETVMMVEELVYDEQIECHHSYDQRCHTTYTTDYEPQQEEECDDNFIKNCYIEYKTVAFDEPVKICNENLIRNCDKPGPEVCETVYESECETSYHEHELEE--DVPACRTMQVEKCRDVTVGYTTEQQCDKWPKQVCELESKTVKKYSPETQCRKTPR 388          
BLAST of EMLSAG00000004810 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold90_size386344-snap-gene-1.24 (protein:Tk12048 transcript:maker-scaffold90_size386344-snap-gene-1.24-mRNA-1 annotation:"hypothetical protein")

HSP 1 Score: 145.206 bits (365), Expect = 8.541e-41
Identity = 93/240 (38.75%), Postives = 129/240 (53.75%), Query Frame = 0
Query:    1 MKKDETVSSIQKDPLLECTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVE--------------------------------KQPG-----------KFVGDTSCEKLPIEICG-AGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWC 196
            + K   V   + D  ++C H   E+CH TY T F P+QEE C+ENF+K C I +K+ AF+E ++ C+ P   VC G+GP EC+T+YES C T+Y E                                K P            K+  +T C+K+  E+CG +GC  + GPEEC DK  T + ++PEE C+L PQ++C+  TKLVP LKP+ EC  IP+E  +     PRKV KP+  KWC
Sbjct:  168 IDKVVMVEETEYDEQIQCHHSYTERCHTTYTTDFEPTQEEECEENFKKDCFIDYKKIAFDEAVRFCHTPF--VCEGEGPVECKTVYESQCETRYHEHDVEDDVVECETVQEEKCEDISLGYTTEQKCTKWPKQVCNTQRQNVKKYTPETDCKKVARELCGPSGCLPQPGPEECFDKKETVVQEVPEETCNLEPQRSCKHVTKLVPVLKPSEECVDIPKEVCSRSRANPRKVKKPVVKKWC 405          
BLAST of EMLSAG00000004810 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold961_size76351-snap-gene-0.22 (protein:Tk11635 transcript:maker-scaffold961_size76351-snap-gene-0.22-mRNA-1 annotation:"hypothetical protein")

HSP 1 Score: 144.05 bits (362), Expect = 9.505e-40
Identity = 88/223 (39.46%), Postives = 118/223 (52.91%), Query Frame = 0
Query:   18 CTHKNVEKCHYTYITQFSPSQEEVCDENFEKSCQITFKQQAFNETIKKCYKPLEKVCNGQGPEECRTLYESSCTTKYVE-------------------------------------------KQPGKFVGDTSCEKLPIEICG-AGCTTEEGPEECHDKTVTSLVDIPEEICDLNPQKTCRFQTKLVPRLKPAHECTTIPQETXNLKFTQPRKVDKPLKTKWC 196
            C H   E+CH T     SP+  E C+ENF+KSC I +++ AF E I  C+ PL  +C G+GPEEC+T+YES C T+Y E                                           K   K+  +T C+K+  E+CG +GC  + GPEEC DK  T + ++PEE C+L PQ++C+  TKLVP LKPA EC  IP+E  +     PRKV KP+  KWC
Sbjct:  260 CHHSYSERCHTTTPPTLSPTGGE-CEENFKKSCFIEYRKVAFEEPITFCHTPL--ICEGEGPEECKTVYESQCETRYHEHEVEDDVVECETIQEEKCEDVTQGYTTEQKCTKWPKQVCKNEKKTVKKYTPETECKKVGRELCGPSGCLLQPGPEECFDKKETVVQEVPEETCNLEPQRSCKHVTKLVPLLKPAEECVDIPKEVCSRSRKNPRKVQKPVVKKWC 479          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000004810 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000004810 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592779103|gb|GAXK01175465.1|4.930e-12375.34TSA: Calanus finmarchicus comp2670_c3_seq21 transc... [more]
gi|592779119|gb|GAXK01175449.1|1.087e-12275.34TSA: Calanus finmarchicus comp2670_c3_seq5 transcr... [more]
gi|592779115|gb|GAXK01175453.1|2.149e-12274.89TSA: Calanus finmarchicus comp2670_c3_seq9 transcr... [more]
gi|592938387|gb|GAXK01020166.1|4.431e-12280.38TSA: Calanus finmarchicus comp12516_c0_seq1 transc... [more]
gi|592779113|gb|GAXK01175455.1|5.700e-12274.43TSA: Calanus finmarchicus comp2670_c3_seq11 transc... [more]
gi|592779108|gb|GAXK01175460.1|1.032e-12174.43TSA: Calanus finmarchicus comp2670_c3_seq16 transc... [more]
gi|592779117|gb|GAXK01175451.1|4.143e-12174.43TSA: Calanus finmarchicus comp2670_c3_seq7 transcr... [more]
gi|592913868|gb|GAXK01044507.1|2.817e-11469.70TSA: Calanus finmarchicus comp243337_c1_seq3 trans... [more]
gi|592913867|gb|GAXK01044508.1|4.738e-11469.70TSA: Calanus finmarchicus comp243337_c1_seq4 trans... [more]
gi|592779101|gb|GAXK01175467.1|1.109e-11373.97TSA: Calanus finmarchicus comp2670_c3_seq23 transc... [more]

Pages

back to top
BLAST of EMLSAG00000004810 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 25
Match NameE-valueIdentityDescription
EMLSAP000000048100.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s2542:1462... [more]
EMLSAP000000058645.966e-14481.39pep:novel supercontig:LSalAtl2s:LSalAtl2s317:79670... [more]
EMLSAP000000058533.781e-12476.78pep:novel supercontig:LSalAtl2s:LSalAtl2s317:19661... [more]
EMLSAP000000116601.237e-11973.61pep:novel supercontig:LSalAtl2s:LSalAtl2s80:816431... [more]
EMLSAP000000063633.417e-9061.82pep:novel supercontig:LSalAtl2s:LSalAtl2s348:12501... [more]
EMLSAP000000116412.207e-5443.60pep:novel supercontig:LSalAtl2s:LSalAtl2s80:222871... [more]
EMLSAP000000119854.040e-5140.83pep:novel supercontig:LSalAtl2s:LSalAtl2s853:22835... [more]
EMLSAP000000082311.197e-4949.46pep:novel supercontig:LSalAtl2s:LSalAtl2s496:24485... [more]
EMLSAP000000075354.467e-4737.92pep:novel supercontig:LSalAtl2s:LSalAtl2s433:58038... [more]
EMLSAP000000126972.204e-4440.83pep:novel supercontig:LSalAtl2s:LSalAtl2s963:82712... [more]

Pages

back to top
BLAST of EMLSAG00000004810 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000004810 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000004810 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 4
Match NameE-valueIdentityDescription
gi|155966163|gb|ABU41036.1|5.184e-4241.25hypothetical protein [Lepeophtheirus salmonis][more]
gi|155966261|gb|ABU41084.1|9.872e-4241.25hypothetical protein [Lepeophtheirus salmonis][more]
gi|155966212|gb|ABU41060.1|1.317e-3039.04hypothetical protein, partial [Lepeophtheirus salm... [more]
gi|155966139|gb|ABU41024.1|1.257e-2639.18hypothetical protein [Lepeophtheirus salmonis][more]
back to top
BLAST of EMLSAG00000004810 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 25
Match NameE-valueIdentityDescription
maker-scaffold2574_size14355-snap-gene-0.21.533e-13676.72protein:Tk08805 transcript:maker-scaffold2574_size... [more]
maker-scaffold228_size248166-snap-gene-0.95.722e-13676.72protein:Tk04317 transcript:maker-scaffold228_size2... [more]
snap_masked-scaffold546_size140615-processed-gene-0.151.404e-13579.91protein:Tk00848 transcript:snap_masked-scaffold546... [more]
maker-scaffold546_size140615-snap-gene-0.286.737e-13368.36protein:Tk00842 transcript:maker-scaffold546_size1... [more]
maker-scaffold546_size140615-snap-gene-0.341.601e-13267.99protein:Tk00847 transcript:maker-scaffold546_size1... [more]
maker-scaffold546_size140615-snap-gene-0.292.929e-6846.33protein:Tk00843 transcript:maker-scaffold546_size1... [more]
snap_masked-scaffold961_size76351-processed-gene-0.88.959e-4542.99protein:Tk11636 transcript:snap_masked-scaffold961... [more]
snap_masked-scaffold804_size94796-processed-gene-0.107.088e-4337.18protein:Tk06341 transcript:snap_masked-scaffold804... [more]
maker-scaffold90_size386344-snap-gene-1.248.541e-4138.75protein:Tk12048 transcript:maker-scaffold90_size38... [more]
maker-scaffold961_size76351-snap-gene-0.229.505e-4039.46protein:Tk11635 transcript:maker-scaffold961_size7... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s2542supercontigLSalAtl2s2542:14622..15869 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s2542-snap-gene-0.3
Biotypeprotein_coding
EvidenceIEA
Notehypothetical protein [Lepeophtheirus salmonis]
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000004810 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000004810EMLSAT00000004810-700657Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s2542:14622..15869+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000004810-687576 ID=EMLSAG00000004810-687576|Name=EMLSAG00000004810|organism=Lepeophtheirus salmonis|type=gene|length=1248bp|location=Sequence derived from alignment at LSalAtl2s2542:14622..15869+ (Lepeophtheirus salmonis)
AAGGTTTATAAGATCCTTTATTTGAGCATAGTTACTTATAAACTCTCAAG CCTTCATCAACAAGTTATTTCATCAAAGCACTATGAAGGTATATATATAT ATATAAACCTTGAAATTCGTTTTTACGGAAGAAATATCTAAGAAGTAAAC TCATTTTTATTTCTTTTCTAGGTGTTTATTGCTTTTTGCCTCATTGGTGT GGCACTAGTCCACTCACAAAACTTTGGAAGGCAGAACTTCAGATCTTCTG GGAATCGAAACTTTAGAAAGGGTCGTCAATTCAATACACAACCTCCCATT CCTACGGGAGGTGGAATTGACTTCAGTGGATGTCAAAATGACATTGAAAC TGGATTGTGTTGTATTGAGAAGGACGAAACTGTTTCAAGTATCCAAAAGG ATCCCCTTCTTGAATGTACTCACAAGAATGTCGAAAAGTGTCACTATACC TACATCACACAATTTTCTCCTTCTCAAGAGGAAGTATGCGATGAAAATTT TGAAAAAAGCTGTCAAATCACCTTCAAACAACAAGCCTTTAATGAAACCA TCAAGAAATGCTACAAGCCCCTTGAAAAGGTATGTAATGGACAAGGTCCA GAAGAGTGTCGTACACTCTATGAATCCTCCTGTACCACCAAGTACGTTGA GAAGCAACCTGGTAAGTTTGTTGGTGATACAAGCTGTGAAAAGCTACCAA TCGAGATCTGTGGGGCTGGATGTACTACTGAAGAAGGTCCTGAAGAATGT CACGACAAAACTGTTACTTCTCTTGTTGATATCCCAGAAGAAATCTGTGA TTTGAACCCCCAAAAGACCTGTAGATTCCAAACAAAGTTAGTCCCTAGAC TTAAGCCTGCCCACGAATGTACCACAATTCCTCAAGAGACATGRAACTTG AAATTTACTCAACCCAGGAAGGTGGATAAGCCATTGAAGACCAAGTGGTG TTTGGATGATACTCCCCCCGTCCCAGGAGAGACCTATGATGAAAACAATG CTCTTGGTGCTCCCATTGGATCCTTTAGTCAAAACAGCAATAMCTTTGCT CAACCTGATAACTCTGTTGGCTCCCAACAACAATCCTCTTCTTCTTCCTC CTCCTTTGGCCCACAACAACAGTCCTCTTCCTTTGGTGGATCATCATCAT CTTCTTTCGGGCCACAACAATCATCTTCCTTCGGATCCCAAAGTTCTTCC GGTGGTTTACAACAAGTCTCCTCTTTCGGTCAACAAGGCTCTTCTTTC
back to top
Add to Basket