EMLSAG00000005090, EMLSAG00000005090-687856 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000005090
Unique NameEMLSAG00000005090-687856
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
B F18 EcR female
  1. PreAdult2
No eggstrings
-Missing-
12.03.2012 - 10:23
18.04.2014 (All day)
Molecular characterisation of the salmon louse,... more
J F18 EcR female
  1. PreAdult
  2. Adult
-Missing-
-Missing-
27.02.2013 - 15:02
11.03.2013 (All day)
Molecular characterisation of the salmon louse,... more
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: female reproduction, no eggstrings
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
D F39 EcR female
  1. PreAdult2
No eggstring production
female reproduction, no eggstrings
24.08.2012 - 10:39
Molecular characterisation of the salmon louse,... more
Homology
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:EcR "Ecdysone receptor" species:7227 "Drosophila melanogaster" [GO:0004884 "ecdysteroid hormone receptor activity" evidence=NAS;IDA;IPI] [GO:0005634 "nucleus" evidence=NAS;IDA] [GO:0001077 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription" evidence=IDA;IPI] [GO:0007286 "spermatid development" evidence=IMP] [GO:0000976 "transcription regulatory region sequence-specific DNA binding" evidence=IDA] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IGI;IMP] [GO:0008232 "activator ecdysone receptor complex" evidence=IDA] [GO:0046982 "protein heterodimerization activity" evidence=IDA;IPI] [GO:0008230 "ecdysone receptor holocomplex" evidence=TAS;IPI] [GO:0007291 "sperm individualization" evidence=IMP] [GO:0008231 "repressor ecdysone receptor complex" evidence=IPI] [GO:0070491 "repressing transcription factor binding" evidence=IPI] [GO:0048477 "oogenesis" evidence=NAS;IMP] [GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=IMP] [GO:0007155 "cell adhesion" evidence=IMP] [GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IGI;IMP] [GO:0035076 "ecdysone receptor-mediated signaling pathway" evidence=IMP] [GO:0035073 "pupariation" evidence=IMP] [GO:0007552 "metamorphosis" evidence=IMP] [GO:0018990 "ecdysis, chitin-based cuticle" evidence=IMP] [GO:0035188 "hatching" evidence=IMP] [GO:0035193 "larval central nervous system remodeling" evidence=IMP;TAS] [GO:0003677 "DNA binding" evidence=IDA;NAS] [GO:0005496 "steroid binding" evidence=IEA;NAS] [GO:0005700 "polytene chromosome" evidence=NAS] [GO:0045892 "negative regulation of transcription, DNA-templated" evidence=TAS] [GO:0005737 "cytoplasm" evidence=IDA] [GO:0007298 "border follicle cell migration" evidence=IMP] [GO:0016322 "neuron remodeling" evidence=IMP] [GO:0035072 "ecdysone-mediated induction of salivary gland cell autophagic cell death" evidence=NAS] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=NAS;TAS] [GO:0007561 "imaginal disc eversion" evidence=TAS] [GO:0040034 "regulation of development, heterochronic" evidence=TAS] [GO:0016319 "mushroom body development" evidence=IGI;IMP] [GO:0008340 "determination of adult lifespan" evidence=IMP] [GO:0008258 "head involution" evidence=IMP] [GO:0008362 "chitin-based embryonic cuticle biosynthetic process" evidence=IMP] [GO:0007390 "germ-band shortening" evidence=IMP] [GO:0005515 "protein binding" evidence=IPI] [GO:0043401 "steroid hormone mediated signaling pathway" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0048813 "dendrite morphogenesis" evidence=IMP;NAS] [GO:0006914 "autophagy" evidence=IMP] [GO:0035180 "larval wandering behavior" evidence=IMP] [GO:0007409 "axonogenesis" evidence=IMP] [GO:0010002 "cardioblast differentiation" evidence=IMP] [GO:0035053 "dorsal vessel heart proper cell fate commitment" evidence=IMP] [GO:0048738 "cardiac muscle tissue development" evidence=IMP] [GO:0007422 "peripheral nervous system development" evidence=IMP] [GO:0048666 "neuron development" evidence=IMP] [GO:0007517 "muscle organ development" evidence=IMP] [GO:0030425 "dendrite" evidence=IMP] [GO:0042220 "response to cocaine" evidence=IGI] [GO:0007488 "histoblast morphogenesis" evidence=IMP] [GO:0008544 "epidermis development" evidence=IMP] [GO:0044130 "negative regulation of growth of symbiont in host" evidence=IMP] [GO:0043065 "positive regulation of apoptotic process" evidence=IMP] [GO:0007468 "regulation of rhodopsin gene expression" evidence=IMP] [GO:0045893 "positive regulation of transcription, DNA-templated" evidence=IMP] [GO:0007616 "long-term memory" evidence=IMP] [GO:0035297 "regulation of Malpighian tubule diameter" evidence=IMP] [GO:0007443 "Malpighian tubule morphogenesis" evidence=IMP] [GO:0045938 "positive regulation of circadian sleep/wake cycle, sleep" evidence=IMP] [GO:0035206 "regulation of hemocyte proliferation" evidence=IMP] [GO:0007281 "germ cell development" evidence=IMP] [GO:0035075 "response to ecdysone" evidence=IMP] [GO:0001225 "RNA polymerase II transcription coactivator binding" evidence=IPI] [GO:0010506 "regulation of autophagy" evidence=IMP] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR003069 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PRINTS:PR01283 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 EMBL:AE013599 GO:GO:0005737 GO:GO:0045892 GO:GO:0008340 GO:GO:0006914 GO:GO:0005496 GO:GO:0008362 GO:GO:0042220 GO:GO:0030425 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0016322 GO:GO:0007155 GO:GO:0007616 GO:GO:0007422 GO:GO:0045938 GO:GO:0043065 GO:GO:0048738 GO:GO:0010002 GO:GO:0035053 GO:GO:0001077 GO:GO:0007298 GO:GO:0048813 GO:GO:0016319 GO:GO:0007517 GO:GO:0007291 GO:GO:0044130 GO:GO:0007409 GO:GO:0046982 GO:GO:0035073 GO:GO:0040034 GO:GO:0005700 GO:GO:0035206 GO:GO:0008544 GO:GO:0000976 GO:GO:0007476 GO:GO:0035072 GO:GO:0008258 GO:GO:0018990 GO:GO:0007488 GO:GO:0008231 EMBL:M74078 EMBL:S63761 EMBL:AY075461 EMBL:AY058575 EMBL:BT012469 EMBL:BT015234 PIR:A40709 PIR:A41055 RefSeq:NP_001163061.1 RefSeq:NP_724456.1 RefSeq:NP_724457.1 RefSeq:NP_724458.1 RefSeq:NP_724459.1 RefSeq:NP_724460.1 UniGene:Dm.4159 PDB:1R0N PDB:1R0O PDB:2HAN PDBsum:1R0N PDBsum:1R0O PDBsum:2HAN ProteinModelPortal:P34021 SMR:P34021 BioGrid:61444 DIP:DIP-158N IntAct:P34021 MINT:MINT-294442 ChEMBL:CHEMBL5676 PaxDb:P34021 PRIDE:P34021 EnsemblMetazoa:FBtr0086011 EnsemblMetazoa:FBtr0302439 GeneID:35540 KEGG:dme:Dmel_CG1765 CTD:35540 FlyBase:FBgn0000546 eggNOG:NOG285805 GeneTree:ENSGT00720000108423 HOGENOM:HOG000244965 InParanoid:P34021 KO:K14034 OMA:GCDAKKS OrthoDB:EOG7DC25S PhylomeDB:P34021 SignaLink:P34021 EvolutionaryTrace:P34021 GenomeRNAi:35540 NextBio:793933 Bgee:P34021 GO:GO:0008232 GO:GO:0004884 GO:GO:0007390 GO:GO:0035188 GO:GO:0007561 GO:GO:0035193 GO:GO:0035180 GO:GO:0035297 GO:GO:0007468 Uniprot:P34021)

HSP 1 Score: 374.785 bits (961), Expect = 5.894e-118
Identity = 203/445 (45.62%), Postives = 268/445 (60.22%), Query Frame = 0
Query:  126 SPSSPLENGLRHPNAPLTPTGAVQQYS--QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSIS------------IDMASFPKRLSSTKPLKPEE-----------------EELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQM--VTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            +P S   N +      L+P+ ++  YS  +  + ++ KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TK++ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K    A    D      S+ +G NGS++            +D+ +      +T PL P+E                   +I +L+++Q+ YE PSE DL R+   P    + +ES++D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD  SDSI +A N  +T+++Y  AG+ +  ++L  FCR M  MK                      + + VE IQ  Y+D L+ Y++     + M  V +AKLL +LTELR+LG  N+E+CFSLKLKNRKLP FL EIWD+
Sbjct:  215 TPRSDSVNSISSGRDDLSPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREK---KAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILAKCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQP----DENESQTDVSFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYTRDSYKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQSYYIDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDV 652          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:EcR "Ecdysone receptor" species:7102 "Heliothis virescens" [GO:0005515 "protein binding" evidence=IPI] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR003069 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PRINTS:PR01283 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0005634 GO:GO:0005496 GO:GO:0043565 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0006357 GO:GO:0006366 GO:GO:0004884 EMBL:Y09009 PDB:1R1K PDB:1R20 PDB:2R40 PDBsum:1R1K PDBsum:1R20 PDBsum:2R40 ProteinModelPortal:O18473 SMR:O18473 IntAct:O18473 EvolutionaryTrace:O18473 Uniprot:O18473)

HSP 1 Score: 358.992 bits (920), Expect = 3.768e-115
Identity = 199/424 (46.93%), Postives = 251/424 (59.20%), Query Frame = 0
Query:  142 LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAA---XXDTTVD-------------PKSNNNGKNGSISIDMASFPK----------RLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKN--QMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P  +V   S   E  R+KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+D+YMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K A           TTVD             P++    +     +     P+          RL +  PL   ++ LI RLV++QE YE PSE DL RV        +S        FR +TEMTILTVQLIVEF+K LPGF  + + DQI LLK CSSEVMMLR ARRYDA +DS+++A N  +T++NY KAG+    ++L  FCR M  M                      ++P  VE+IQ  Y++ L+ Y++     +    V F ++L +LTE+R+LG+ NS +C SLKLKNRKLPPFL EIWD+
Sbjct:  132 LSPASSVNGCSTDGEARRQKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYICKFGHACEMDIYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRKEKKAQREKDKLPVSTTTVDDHMPPIMQCDPPPPEAARILE----CVQHEVVPRFLNEKLMEQNRLKNVPPLTANQKSLIARLVWYQEGYEQPSEEDLKRVTQSDEDDEDSDMP-----FRQITEMTILTVQLIVEFAKGLPGFAKISQSDQITLLKACSSEVMMLRVARRYDAATDSVLFANNQAYTRDNYRKAGMAYVIEDLLHFCRCMYSMMMDNVHYALLTAIVIFSDRPGLEQPLLVEEIQRYYLNTLRVYILNQNSASPRGAVIFGEILGILTEIRTLGMQNSNMCISLKLKNRKLPPFLEEIWDV 546          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:Nr1h3 "Oxysterols receptor LXR-alpha" species:10116 "Rattus norvegicus" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0000790 "nuclear chromatin" evidence=IEA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0010867 "positive regulation of triglyceride biosynthetic process" evidence=IEA] [GO:0010870 "positive regulation of receptor biosynthetic process" evidence=IEA] [GO:0010875 "positive regulation of cholesterol efflux" evidence=IEA] [GO:0010887 "negative regulation of cholesterol storage" evidence=IEA] [GO:0032270 "positive regulation of cellular protein metabolic process" evidence=IEA] [GO:0032369 "negative regulation of lipid transport" evidence=IEA] [GO:0032570 "response to progesterone" evidence=IEA] [GO:0032810 "sterol response element binding" evidence=IEA] [GO:0034145 "positive regulation of toll-like receptor 4 signaling pathway" evidence=IEA] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0043031 "negative regulation of macrophage activation" evidence=IEA] [GO:0043277 "apoptotic cell clearance" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] [GO:0044255 "cellular lipid metabolic process" evidence=IEA] [GO:0045723 "positive regulation of fatty acid biosynthetic process" evidence=IEA] [GO:0045861 "negative regulation of proteolysis" evidence=IEA] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0048550 "negative regulation of pinocytosis" evidence=IEA] [GO:0050728 "negative regulation of inflammatory response" evidence=IEA] [GO:0051006 "positive regulation of lipoprotein lipase activity" evidence=IEA] [GO:0070328 "triglyceride homeostasis" evidence=IEA] [GO:0071222 "cellular response to lipopolysaccharide" evidence=IEA] [GO:0090188 "negative regulation of pancreatic juice secretion" evidence=IEA] [GO:0090341 "negative regulation of secretion of lysosomal enzymes" evidence=IEA] [GO:2000189 "positive regulation of cholesterol homeostasis" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 RGD:61909 GO:GO:0050728 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 GO:GO:0045861 GO:GO:0044255 GO:GO:0071222 GO:GO:0042632 GO:GO:0010887 GO:GO:0010875 GO:GO:0000122 GO:GO:0051006 GO:GO:0000790 GO:GO:0006366 GO:GO:2000189 GO:GO:0070328 GO:GO:0010867 GO:GO:0032570 GO:GO:0032270 GO:GO:0045723 EMBL:CH473949 GO:GO:0043031 GO:GO:0043277 GO:GO:0048550 GeneTree:ENSGT00720000108423 OrthoDB:EOG7DC25S GO:GO:0010870 GO:GO:0032369 GO:GO:0034145 HOVERGEN:HBG108655 InterPro:IPR023257 PRINTS:PR02034 TreeFam:TF352167 CTD:10062 KO:K08536 OMA:CILREEA GO:GO:0032810 GO:GO:0090188 GO:GO:0090341 UniGene:Rn.11209 EMBL:AABR06024710 EMBL:BC088750 RefSeq:NP_113815.2 RefSeq:XP_006234595.1 RefSeq:XP_006234596.1 RefSeq:XP_006234597.1 RefSeq:XP_006234598.1 STRING:10116.ENSRNOP00000018154 Ensembl:ENSRNOT00000018154 GeneID:58852 KEGG:rno:58852 InParanoid:Q5I035 NextBio:611435 PRO:PR:Q5I035 Genevestigator:Q5I035 Uniprot:Q5I035)

HSP 1 Score: 266.929 bits (681), Expect = 2.732e-81
Identity = 159/420 (37.86%), Postives = 232/420 (55.24%), Query Frame = 0
Query:  125 ESPSSPLENGLR--HPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            +S    L  GL    P A L     + + +++   +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ K + Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T+V P+             ++S P+ L     L PE+  +I +LV  Q++    S +D  RV   P+     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F R+M+ +                       ++  +VE++Q  YV+AL AYV  N   ++++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   46 QSTGGALRIGLESSEPTALLPRAETLPEPTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGARYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAQA-----TSVSPR-------------VSSPPQVLPQ---LSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPIAPDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRSMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSINHPHDRLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 443          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:NR1H3 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0000790 "nuclear chromatin" evidence=IEA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0010867 "positive regulation of triglyceride biosynthetic process" evidence=IEA] [GO:0010870 "positive regulation of receptor biosynthetic process" evidence=IEA] [GO:0010875 "positive regulation of cholesterol efflux" evidence=IEA] [GO:0010887 "negative regulation of cholesterol storage" evidence=IEA] [GO:0032270 "positive regulation of cellular protein metabolic process" evidence=IEA] [GO:0032369 "negative regulation of lipid transport" evidence=IEA] [GO:0032570 "response to progesterone" evidence=IEA] [GO:0032810 "sterol response element binding" evidence=IEA] [GO:0034145 "positive regulation of toll-like receptor 4 signaling pathway" evidence=IEA] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0043031 "negative regulation of macrophage activation" evidence=IEA] [GO:0043277 "apoptotic cell clearance" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] [GO:0044255 "cellular lipid metabolic process" evidence=IEA] [GO:0045723 "positive regulation of fatty acid biosynthetic process" evidence=IEA] [GO:0045861 "negative regulation of proteolysis" evidence=IEA] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0048550 "negative regulation of pinocytosis" evidence=IEA] [GO:0050728 "negative regulation of inflammatory response" evidence=IEA] [GO:0051006 "positive regulation of lipoprotein lipase activity" evidence=IEA] [GO:0070328 "triglyceride homeostasis" evidence=IEA] [GO:0071222 "cellular response to lipopolysaccharide" evidence=IEA] [GO:0090188 "negative regulation of pancreatic juice secretion" evidence=IEA] [GO:0090341 "negative regulation of secretion of lysosomal enzymes" evidence=IEA] [GO:2000189 "positive regulation of cholesterol homeostasis" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0050728 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 GO:GO:0045861 GO:GO:0044255 GO:GO:0071222 GO:GO:0042632 GO:GO:0010887 GO:GO:0010875 GO:GO:0000122 GO:GO:0051006 GO:GO:0000790 GO:GO:0006366 GO:GO:2000189 GO:GO:0070328 GO:GO:0010867 GO:GO:0032570 GO:GO:0032270 GO:GO:0045723 GO:GO:0043031 GO:GO:0043277 GO:GO:0048550 GeneTree:ENSGT00720000108423 OrthoDB:EOG7DC25S GO:GO:0010870 GO:GO:0032369 GO:GO:0034145 InterPro:IPR023257 PRINTS:PR02034 TreeFam:TF352167 OMA:CILREEA GO:GO:0032810 GO:GO:0090188 GO:GO:0090341 EMBL:AAEX03011491 ProteinModelPortal:E2RS27 Ensembl:ENSCAFT00000014022 Uniprot:E2RS27)

HSP 1 Score: 266.929 bits (681), Expect = 2.934e-81
Identity = 152/386 (39.38%), Postives = 223/386 (57.77%), Query Frame = 0
Query:  158 ERKKKGSSSRP-AEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            +++KKG + +    ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ K ++Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T++ P+             ++S P+ L     L PE+  +I +LV  Q++    S +D  RV   PM     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F RAM+ +                       ++  +VE++Q  YV+AL AYV  +   ++++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   85 QKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAQA-----TSMPPR-------------VSSPPQVLPQ---LSPEQRGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 448          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:Nr1h3 "nuclear receptor subfamily 1, group H, member 3" species:10090 "Mus musculus" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IDA] [GO:0000790 "nuclear chromatin" evidence=ISO] [GO:0003677 "DNA binding" evidence=IDA] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IDA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IDA] [GO:0005515 "protein binding" evidence=IPI] [GO:0005634 "nucleus" evidence=ISO;IDA] [GO:0005737 "cytoplasm" evidence=ISO] [GO:0006351 "transcription, DNA-templated" evidence=IEA] [GO:0006355 "regulation of transcription, DNA-templated" evidence=IDA] [GO:0006366 "transcription from RNA polymerase II promoter" evidence=IDA] [GO:0006633 "fatty acid biosynthetic process" evidence=TAS] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0010867 "positive regulation of triglyceride biosynthetic process" evidence=ISO] [GO:0010870 "positive regulation of receptor biosynthetic process" evidence=ISO] [GO:0010875 "positive regulation of cholesterol efflux" evidence=ISO;IDA] [GO:0010887 "negative regulation of cholesterol storage" evidence=ISO;IGI] [GO:0030522 "intracellular receptor signaling pathway" evidence=IDA] [GO:0032270 "positive regulation of cellular protein metabolic process" evidence=ISO] [GO:0032369 "negative regulation of lipid transport" evidence=ISO] [GO:0032376 "positive regulation of cholesterol transport" evidence=ISO] [GO:0032570 "response to progesterone" evidence=ISO] [GO:0032810 "sterol response element binding" evidence=ISO] [GO:0034145 "positive regulation of toll-like receptor 4 signaling pathway" evidence=ISO] [GO:0042632 "cholesterol homeostasis" evidence=IGI] [GO:0043031 "negative regulation of macrophage activation" evidence=IDA] [GO:0043277 "apoptotic cell clearance" evidence=ISO] [GO:0043401 "steroid hormone mediated signaling pathway" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=ISO] [GO:0044212 "transcription regulatory region DNA binding" evidence=ISO;IDA] [GO:0044255 "cellular lipid metabolic process" evidence=IDA] [GO:0045723 "positive regulation of fatty acid biosynthetic process" evidence=ISO] [GO:0045861 "negative regulation of proteolysis" evidence=IMP] [GO:0045892 "negative regulation of transcription, DNA-templated" evidence=IMP] [GO:0045893 "positive regulation of transcription, DNA-templated" evidence=ISO;IMP] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=ISO;IDA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0046965 "retinoid X receptor binding" evidence=ISO] [GO:0046982 "protein heterodimerization activity" evidence=ISO] [GO:0048550 "negative regulation of pinocytosis" evidence=ISO] [GO:0050728 "negative regulation of inflammatory response" evidence=IDA] [GO:0051006 "positive regulation of lipoprotein lipase activity" evidence=ISO] [GO:0055088 "lipid homeostasis" evidence=IGI;IMP] [GO:0055092 "sterol homeostasis" evidence=IMP] [GO:0070328 "triglyceride homeostasis" evidence=IGI;IMP] [GO:0071222 "cellular response to lipopolysaccharide" evidence=ISO;IDA] [GO:0090188 "negative regulation of pancreatic juice secretion" evidence=IMP] [GO:0090341 "negative regulation of secretion of lysosomal enzymes" evidence=IMP] [GO:2000189 "positive regulation of cholesterol homeostasis" evidence=ISO] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 MGI:MGI:1352462 GO:GO:0005634 GO:GO:0003677 GO:GO:0050728 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 GO:GO:0045861 GO:GO:0006633 GO:GO:0071222 GO:GO:0042632 GO:GO:0010887 GO:GO:0010875 GO:GO:0000122 GO:GO:0051006 GO:GO:0000790 GO:GO:2000189 GO:GO:0070328 GO:GO:0010867 GO:GO:0032570 GO:GO:0032270 GO:GO:0045723 GO:GO:0043031 GO:GO:0043277 GO:GO:0048550 eggNOG:NOG285805 GeneTree:ENSGT00720000108423 OrthoDB:EOG7DC25S GO:GO:0010870 GO:GO:0032369 GO:GO:0034145 EMBL:AL691450 HOVERGEN:HBG108655 InterPro:IPR023257 PRINTS:PR02034 HOGENOM:HOG000220845 TreeFam:TF352167 CTD:10062 KO:K08536 OMA:CILREEA GO:GO:0032810 GO:GO:0090188 GO:GO:0090341 EMBL:AJ132599 EMBL:AJ132600 EMBL:AJ132601 EMBL:AF085745 RefSeq:NP_001171201.1 RefSeq:NP_038867.2 RefSeq:XP_006499229.1 RefSeq:XP_006499230.1 RefSeq:XP_006499231.1 UniGene:Mm.22690 PDB:2ACL PDB:3FAL PDB:3FC6 PDBsum:2ACL PDBsum:3FAL PDBsum:3FC6 ProteinModelPortal:Q9Z0Y9 SMR:Q9Z0Y9 BioGrid:204449 IntAct:Q9Z0Y9 ChEMBL:CHEMBL2189152 PhosphoSite:Q9Z0Y9 PRIDE:Q9Z0Y9 Ensembl:ENSMUST00000002177 Ensembl:ENSMUST00000111354 Ensembl:ENSMUST00000111356 GeneID:22259 KEGG:mmu:22259 UCSC:uc008kvc.2 InParanoid:Q9Z0Y9 EvolutionaryTrace:Q9Z0Y9 NextBio:302349 PRO:PR:Q9Z0Y9 ArrayExpress:Q9Z0Y9 Bgee:Q9Z0Y9 CleanEx:MM_NR1H3 Genevestigator:Q9Z0Y9 Uniprot:Q9Z0Y9)

HSP 1 Score: 266.544 bits (680), Expect = 3.135e-81
Identity = 156/405 (38.52%), Postives = 226/405 (55.80%), Query Frame = 0
Query:  138 PNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P A L     + + +++   +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ K + Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T+V P+             ++S P+ L     L PE+  +I +LV  Q++    S +D  RV   P+     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F RAM+ +                       ++  +VE++Q  YV+AL AYV  N   + ++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   61 PTALLPRAETLPEPTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAQA-----TSVSPR-------------VSSPPQVLPQ---LSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPIAPDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSINHPHDPLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 443          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:LXRA "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0000790 "nuclear chromatin" evidence=IEA] [GO:0003677 "DNA binding" evidence=ISS] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=ISS] [GO:0005634 "nucleus" evidence=ISS] [GO:0006351 "transcription, DNA-templated" evidence=ISS] [GO:0006355 "regulation of transcription, DNA-templated" evidence=ISS] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0010867 "positive regulation of triglyceride biosynthetic process" evidence=IEA] [GO:0010870 "positive regulation of receptor biosynthetic process" evidence=IEA] [GO:0010875 "positive regulation of cholesterol efflux" evidence=IEA] [GO:0010887 "negative regulation of cholesterol storage" evidence=IEA] [GO:0032270 "positive regulation of cellular protein metabolic process" evidence=IEA] [GO:0032369 "negative regulation of lipid transport" evidence=IEA] [GO:0032570 "response to progesterone" evidence=IEA] [GO:0032810 "sterol response element binding" evidence=IEA] [GO:0034145 "positive regulation of toll-like receptor 4 signaling pathway" evidence=IEA] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0043031 "negative regulation of macrophage activation" evidence=IEA] [GO:0043277 "apoptotic cell clearance" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=ISS] [GO:0044255 "cellular lipid metabolic process" evidence=ISS] [GO:0045723 "positive regulation of fatty acid biosynthetic process" evidence=IEA] [GO:0045861 "negative regulation of proteolysis" evidence=IEA] [GO:0045892 "negative regulation of transcription, DNA-templated" evidence=ISS] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0046965 "retinoid X receptor binding" evidence=ISS] [GO:0048550 "negative regulation of pinocytosis" evidence=IEA] [GO:0050728 "negative regulation of inflammatory response" evidence=IEA] [GO:0051006 "positive regulation of lipoprotein lipase activity" evidence=IEA] [GO:0070328 "triglyceride homeostasis" evidence=IEA] [GO:0071222 "cellular response to lipopolysaccharide" evidence=IEA] [GO:0090188 "negative regulation of pancreatic juice secretion" evidence=IEA] [GO:0090341 "negative regulation of secretion of lysosomal enzymes" evidence=IEA] [GO:2000189 "positive regulation of cholesterol homeostasis" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0005634 GO:GO:0045892 GO:GO:0050728 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 GO:GO:0045861 GO:GO:0044255 GO:GO:0071222 GO:GO:0042632 GO:GO:0010887 GO:GO:0010875 GO:GO:0000122 GO:GO:0051006 GO:GO:0000790 GO:GO:2000189 GO:GO:0070328 GO:GO:0010867 GO:GO:0032570 GO:GO:0032270 GO:GO:0045723 GO:GO:0046965 GO:GO:0043031 GO:GO:0043277 GO:GO:0048550 GeneTree:ENSGT00720000108423 OrthoDB:EOG7DC25S GO:GO:0010870 GO:GO:0032369 GO:GO:0034145 HOVERGEN:HBG108655 InterPro:IPR023257 PRINTS:PR02034 TreeFam:TF352167 CTD:10062 KO:K08536 OMA:CILREEA GO:GO:0032810 GO:GO:0090188 GO:GO:0090341 EMBL:CU469364 EMBL:DQ059138 EMBL:AB254406 RefSeq:NP_001095284.1 RefSeq:XP_005660976.1 UniGene:Ssc.48215 ProteinModelPortal:Q4TU03 SMR:Q4TU03 Ensembl:ENSSSCT00000014461 GeneID:397553 KEGG:ssc:397553 ArrayExpress:Q4TU03 Uniprot:Q4TU03)

HSP 1 Score: 266.159 bits (679), Expect = 4.945e-81
Identity = 153/386 (39.64%), Postives = 222/386 (57.51%), Query Frame = 0
Query:  158 ERKKKGSSSRP-AEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            +++KKG + +    ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ K + Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T+V P+++             S P+ L     L PE+  +I +LV  Q++    S +D  RV   PM     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F RAM+ +                       ++  +VE++Q  YV+AL AYV  +   ++++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   82 QKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAQA-----TSVPPRAS-------------SPPQVLPQ---LSPEQLGMIEKLVAAQQQCNRRSFSDQLRVTPWPMAPDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 445          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:NR1H3 "Oxysterols receptor LXR-alpha" species:9606 "Homo sapiens" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=ISS] [GO:0000790 "nuclear chromatin" evidence=IDA] [GO:0003677 "DNA binding" evidence=TAS] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0003713 "transcription coactivator activity" evidence=TAS] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IEA] [GO:0005515 "protein binding" evidence=IPI] [GO:0005634 "nucleus" evidence=TAS] [GO:0005654 "nucleoplasm" evidence=TAS] [GO:0006367 "transcription initiation from RNA polymerase II promoter" evidence=TAS] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0010467 "gene expression" evidence=TAS] [GO:0010745 "negative regulation of macrophage derived foam cell differentiation" evidence=IC] [GO:0010867 "positive regulation of triglyceride biosynthetic process" evidence=IMP] [GO:0010870 "positive regulation of receptor biosynthetic process" evidence=IDA] [GO:0010875 "positive regulation of cholesterol efflux" evidence=IMP;IDA] [GO:0010887 "negative regulation of cholesterol storage" evidence=IMP] [GO:0015485 "cholesterol binding" evidence=TAS] [GO:0032270 "positive regulation of cellular protein metabolic process" evidence=IMP] [GO:0032369 "negative regulation of lipid transport" evidence=IMP] [GO:0032376 "positive regulation of cholesterol transport" evidence=IDA] [GO:0032570 "response to progesterone" evidence=IDA] [GO:0032810 "sterol response element binding" evidence=IDA] [GO:0034145 "positive regulation of toll-like receptor 4 signaling pathway" evidence=IDA] [GO:0042632 "cholesterol homeostasis" evidence=ISS] [GO:0042752 "regulation of circadian rhythm" evidence=TAS] [GO:0043031 "negative regulation of macrophage activation" evidence=ISS] [GO:0043277 "apoptotic cell clearance" evidence=IMP] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] [GO:0044212 "transcription regulatory region DNA binding" evidence=IDA] [GO:0044255 "cellular lipid metabolic process" evidence=IEA] [GO:0045723 "positive regulation of fatty acid biosynthetic process" evidence=IMP] [GO:0045861 "negative regulation of proteolysis" evidence=IEA] [GO:0045893 "positive regulation of transcription, DNA-templated" evidence=IMP] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP;IDA] [GO:0048550 "negative regulation of pinocytosis" evidence=IMP] [GO:0050728 "negative regulation of inflammatory response" evidence=ISS] [GO:0051006 "positive regulation of lipoprotein lipase activity" evidence=IMP] [GO:0055088 "lipid homeostasis" evidence=ISS] [GO:0055092 "sterol homeostasis" evidence=ISS] [GO:0060336 "negative regulation of interferon-gamma-mediated signaling pathway" evidence=NAS] [GO:0070328 "triglyceride homeostasis" evidence=ISS] [GO:0071222 "cellular response to lipopolysaccharide" evidence=IDA] [GO:0090188 "negative regulation of pancreatic juice secretion" evidence=ISS] [GO:0090341 "negative regulation of secretion of lysosomal enzymes" evidence=ISS] [GO:2000188 "regulation of cholesterol homeostasis" evidence=ISS] [GO:2000189 "positive regulation of cholesterol homeostasis" evidence=IDA] Reactome:REACT_71 InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0005654 EMBL:CH471064 GO:GO:0050728 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 GO:GO:0045861 GO:GO:0044255 GO:GO:0042752 GO:GO:0015485 GO:GO:0071222 GO:GO:0042632 GO:GO:0010887 GO:GO:0010745 GO:GO:0010875 GO:GO:0000122 GO:GO:0051006 GO:GO:0000790 GO:GO:0003713 GO:GO:2000189 GO:GO:0070328 GO:GO:0010867 GO:GO:0032570 GO:GO:0032270 GO:GO:0006367 GO:GO:0045723 GO:GO:0043031 GO:GO:0043277 GO:GO:0048550 GO:GO:0060336 eggNOG:NOG285805 GO:GO:0010870 GO:GO:0032369 GO:GO:0034145 EMBL:AC018410 PDB:3IPQ PDB:3IPS PDB:3IPU PDBsum:3IPQ PDBsum:3IPS PDBsum:3IPU PDB:1UHL PDBsum:1UHL HOVERGEN:HBG108655 InterPro:IPR023257 PRINTS:PR02034 HOGENOM:HOG000220845 TreeFam:TF352167 CTD:10062 KO:K08536 OMA:CILREEA GO:GO:0032810 GO:GO:0090188 GO:GO:0090341 EMBL:U22662 EMBL:AK290614 EMBL:BC008819 EMBL:BC041172 PIR:I38975 RefSeq:NP_001123573.1 RefSeq:NP_001123574.1 RefSeq:NP_005684.2 RefSeq:XP_005252762.1 RefSeq:XP_005252763.1 RefSeq:XP_005252764.1 RefSeq:XP_005252766.1 RefSeq:XP_005252767.1 RefSeq:XP_005252768.1 RefSeq:XP_005252769.1 RefSeq:XP_005252770.1 RefSeq:XP_005252774.1 UniGene:Hs.438863 ProteinModelPortal:Q13133 SMR:Q13133 BioGrid:115373 IntAct:Q13133 MINT:MINT-3027136 STRING:9606.ENSP00000342470 BindingDB:Q13133 ChEMBL:CHEMBL2808 GuidetoPHARMACOLOGY:602 PhosphoSite:Q13133 DMDM:23503089 PaxDb:Q13133 PRIDE:Q13133 DNASU:10062 Ensembl:ENST00000395397 Ensembl:ENST00000405853 Ensembl:ENST00000407404 Ensembl:ENST00000441012 Ensembl:ENST00000467728 GeneID:10062 KEGG:hsa:10062 UCSC:uc001nek.3 UCSC:uc001nen.4 GeneCards:GC11P047269 HGNC:HGNC:7966 HPA:CAB037109 HPA:HPA036443 MIM:602423 neXtProt:NX_Q13133 PharmGKB:PA31751 InParanoid:Q13133 PhylomeDB:Q13133 SignaLink:Q13133 EvolutionaryTrace:Q13133 GeneWiki:Liver_X_receptor_alpha GenomeRNAi:10062 NextBio:38029 PRO:PR:Q13133 ArrayExpress:Q13133 Bgee:Q13133 CleanEx:HS_NR1H3 Genevestigator:Q13133 Uniprot:Q13133)

HSP 1 Score: 266.159 bits (679), Expect = 5.381e-81
Identity = 156/405 (38.52%), Postives = 228/405 (56.30%), Query Frame = 0
Query:  138 PNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P A LT      + +++   +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ K ++Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T++ P+++             S P+ L     L PE+  +I +LV  Q++    S +D  RV   PM     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F RAM+ +                       ++  +VE++Q  YV+AL AYV  +   ++++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   63 PTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAHA-----TSLPPRAS-------------SPPQILPQ---LSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 445          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:NR1H3 "Oxysterols receptor LXR-alpha" species:9913 "Bos taurus" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0000790 "nuclear chromatin" evidence=IEA] [GO:0003677 "DNA binding" evidence=ISS] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=ISS] [GO:0005634 "nucleus" evidence=ISS] [GO:0006351 "transcription, DNA-templated" evidence=ISS] [GO:0006355 "regulation of transcription, DNA-templated" evidence=ISS] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0010867 "positive regulation of triglyceride biosynthetic process" evidence=IEA] [GO:0010870 "positive regulation of receptor biosynthetic process" evidence=IEA] [GO:0010875 "positive regulation of cholesterol efflux" evidence=IEA] [GO:0010887 "negative regulation of cholesterol storage" evidence=IEA] [GO:0032270 "positive regulation of cellular protein metabolic process" evidence=IEA] [GO:0032369 "negative regulation of lipid transport" evidence=IEA] [GO:0032570 "response to progesterone" evidence=IEA] [GO:0032810 "sterol response element binding" evidence=IEA] [GO:0034145 "positive regulation of toll-like receptor 4 signaling pathway" evidence=IEA] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0043031 "negative regulation of macrophage activation" evidence=IEA] [GO:0043277 "apoptotic cell clearance" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=ISS] [GO:0044255 "cellular lipid metabolic process" evidence=ISS] [GO:0045723 "positive regulation of fatty acid biosynthetic process" evidence=IEA] [GO:0045861 "negative regulation of proteolysis" evidence=IEA] [GO:0045892 "negative regulation of transcription, DNA-templated" evidence=ISS] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0046965 "retinoid X receptor binding" evidence=ISS] [GO:0048550 "negative regulation of pinocytosis" evidence=IEA] [GO:0050728 "negative regulation of inflammatory response" evidence=IEA] [GO:0051006 "positive regulation of lipoprotein lipase activity" evidence=IEA] [GO:0070328 "triglyceride homeostasis" evidence=IEA] [GO:0071222 "cellular response to lipopolysaccharide" evidence=IEA] [GO:0090188 "negative regulation of pancreatic juice secretion" evidence=IEA] [GO:0090341 "negative regulation of secretion of lysosomal enzymes" evidence=IEA] [GO:2000188 "regulation of cholesterol homeostasis" evidence=ISS] [GO:2000189 "positive regulation of cholesterol homeostasis" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0005634 GO:GO:0045892 GO:GO:0050728 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 GO:GO:0045861 GO:GO:0044255 GO:GO:0071222 GO:GO:0042632 GO:GO:0010887 GO:GO:0010875 GO:GO:0000122 GO:GO:0051006 GO:GO:0000790 GO:GO:2000189 GO:GO:0070328 GO:GO:0010867 GO:GO:0032570 GO:GO:0032270 GO:GO:0045723 GO:GO:0046965 GO:GO:0043031 GO:GO:0043277 GO:GO:0048550 eggNOG:NOG285805 GeneTree:ENSGT00720000108423 OrthoDB:EOG7DC25S GO:GO:0010870 GO:GO:0032369 GO:GO:0034145 HOVERGEN:HBG108655 InterPro:IPR023257 PRINTS:PR02034 HOGENOM:HOG000220845 TreeFam:TF352167 EMBL:BT021004 EMBL:BC103207 RefSeq:NP_001014861.1 UniGene:Bt.88106 ProteinModelPortal:Q5E9B6 SMR:Q5E9B6 STRING:9913.ENSBTAP00000014131 PRIDE:Q5E9B6 Ensembl:ENSBTAT00000014131 GeneID:507176 KEGG:bta:507176 CTD:10062 InParanoid:Q5E9B6 KO:K08536 OMA:CILREEA NextBio:20867938 GO:GO:0032810 GO:GO:0090188 GO:GO:0090341 Uniprot:Q5E9B6)

HSP 1 Score: 265.774 bits (678), Expect = 6.240e-81
Identity = 156/405 (38.52%), Postives = 225/405 (55.56%), Query Frame = 0
Query:  138 PNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P A L    A  + +++   +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ K + Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T+  P+++             S P+ L     L PE+  +I +LV  Q+     S +D  RV   PM     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F RAM+ +                       ++  +VE++Q  YV+AL AYV  +   ++++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   63 PTALLPGVEAPPESTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKMKRQEEEQAQA-----TSAPPRAS-------------SPPQVLPQ---LSPEQLGMIEKLVAAQQLCNRRSFSDQLRVTPWPMAPDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 445          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:Nr1h3 "Oxysterols receptor LXR-alpha" species:10116 "Rattus norvegicus" [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA] [GO:0006351 "transcription, DNA-templated" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 RGD:61909 GO:GO:0005634 GO:GO:0005737 GO:GO:0008286 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0006629 GO:GO:0003700 GO:GO:0006351 GO:GO:0046982 eggNOG:NOG285805 HOVERGEN:HBG108655 InterPro:IPR023257 PRINTS:PR02034 HOGENOM:HOG000220845 EMBL:U11685 PIR:A56043 UniGene:Rn.11209 ProteinModelPortal:Q62685 SMR:Q62685 PhosphoSite:Q62685 PRIDE:Q62685 UCSC:RGD:61909 InParanoid:Q62685 PRO:PR:Q62685 Genevestigator:Q62685 Uniprot:Q62685)

HSP 1 Score: 263.848 bits (673), Expect = 3.175e-80
Identity = 158/420 (37.62%), Postives = 231/420 (55.00%), Query Frame = 0
Query:  125 ESPSSPLENGLR--HPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            +S    L  GL    P A L     + + +++   +RKK  +      ELC VCGD+AS +HYN L+CEGCKGFFRRS+ K + Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T+V P+             ++S P+ L     L PE+  +I +LV  Q++    S +D  RV   P+     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F R+M+ +                       ++  +VE++Q  YV+AL AYV  N   ++++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   46 QSTGGALRIGLESSEPTALLPRAETLPEPTELRPQKRKKGPAPKMLGNELCSVCGDKASAFHYNVLSCEGCKGFFRRSVIKGARYICHSGGHCPMDTYMRRKCQECRLRKCRHAGMREECVLSEEQIRLKKLKRQEEEQAQA-----TSVSPR-------------VSSPPQVLPQ---LSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPIAPDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRSMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSINHPHDRLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 443          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:Nr1h3 "nuclear receptor subfamily 1, group H, member 3" species:10116 "Rattus norvegicus" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA;ISO] [GO:0000790 "nuclear chromatin" evidence=IEA;ISO] [GO:0003677 "DNA binding" evidence=ISO] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISO] [GO:0003707 "steroid hormone receptor activity" evidence=IEA;TAS] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IEA;ISO] [GO:0005634 "nucleus" evidence=ISO;IDA] [GO:0005737 "cytoplasm" evidence=IDA] [GO:0006351 "transcription, DNA-templated" evidence=IEA] [GO:0006355 "regulation of transcription, DNA-templated" evidence=ISO] [GO:0006366 "transcription from RNA polymerase II promoter" evidence=ISO] [GO:0006629 "lipid metabolic process" evidence=IEP] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0008286 "insulin receptor signaling pathway" evidence=IEP] [GO:0010867 "positive regulation of triglyceride biosynthetic process" evidence=IEA;ISO] [GO:0010870 "positive regulation of receptor biosynthetic process" evidence=IEA;ISO] [GO:0010875 "positive regulation of cholesterol efflux" evidence=IEA;ISO] [GO:0010887 "negative regulation of cholesterol storage" evidence=IEA;ISO] [GO:0030522 "intracellular receptor signaling pathway" evidence=ISO] [GO:0032270 "positive regulation of cellular protein metabolic process" evidence=IEA;ISO] [GO:0032369 "negative regulation of lipid transport" evidence=IEA;ISO] [GO:0032376 "positive regulation of cholesterol transport" evidence=ISO] [GO:0032570 "response to progesterone" evidence=IEA;ISO] [GO:0032810 "sterol response element binding" evidence=IEA;ISO] [GO:0034145 "positive regulation of toll-like receptor 4 signaling pathway" evidence=IEA;ISO] [GO:0042632 "cholesterol homeostasis" evidence=IEA;ISO] [GO:0043031 "negative regulation of macrophage activation" evidence=IEA;ISO] [GO:0043277 "apoptotic cell clearance" evidence=IEA;ISO] [GO:0043565 "sequence-specific DNA binding" evidence=IEA;IDA] [GO:0044212 "transcription regulatory region DNA binding" evidence=ISO] [GO:0044255 "cellular lipid metabolic process" evidence=IEA;ISO] [GO:0045723 "positive regulation of fatty acid biosynthetic process" evidence=IEA;ISO] [GO:0045861 "negative regulation of proteolysis" evidence=IEA;ISO] [GO:0045892 "negative regulation of transcription, DNA-templated" evidence=ISO] [GO:0045893 "positive regulation of transcription, DNA-templated" evidence=ISO] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA;ISO] [GO:0046965 "retinoid X receptor binding" evidence=IPI] [GO:0046982 "protein heterodimerization activity" evidence=IDA] [GO:0048550 "negative regulation of pinocytosis" evidence=IEA;ISO] [GO:0050728 "negative regulation of inflammatory response" evidence=IEA;ISO] [GO:0051006 "positive regulation of lipoprotein lipase activity" evidence=IEA;ISO] [GO:0055088 "lipid homeostasis" evidence=ISO] [GO:0055092 "sterol homeostasis" evidence=ISO] [GO:0070328 "triglyceride homeostasis" evidence=IEA;ISO] [GO:0071222 "cellular response to lipopolysaccharide" evidence=IEA;ISO] [GO:0090188 "negative regulation of pancreatic juice secretion" evidence=IEA;ISO] [GO:0090341 "negative regulation of secretion of lysosomal enzymes" evidence=IEA;ISO] [GO:2000188 "regulation of cholesterol homeostasis" evidence=ISS] [GO:2000189 "positive regulation of cholesterol homeostasis" evidence=IEA;ISO] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 RGD:61909 GO:GO:0005634 GO:GO:0005737 GO:GO:0008286 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0006629 GO:GO:0003700 GO:GO:0006351 GO:GO:0046982 eggNOG:NOG285805 HOVERGEN:HBG108655 InterPro:IPR023257 PRINTS:PR02034 HOGENOM:HOG000220845 EMBL:U11685 PIR:A56043 UniGene:Rn.11209 ProteinModelPortal:Q62685 SMR:Q62685 PhosphoSite:Q62685 PRIDE:Q62685 UCSC:RGD:61909 InParanoid:Q62685 PRO:PR:Q62685 Genevestigator:Q62685 Uniprot:Q62685)

HSP 1 Score: 263.848 bits (673), Expect = 3.175e-80
Identity = 158/420 (37.62%), Postives = 231/420 (55.00%), Query Frame = 0
Query:  125 ESPSSPLENGLR--HPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            +S    L  GL    P A L     + + +++   +RKK  +      ELC VCGD+AS +HYN L+CEGCKGFFRRS+ K + Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T+V P+             ++S P+ L     L PE+  +I +LV  Q++    S +D  RV   P+     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F R+M+ +                       ++  +VE++Q  YV+AL AYV  N   ++++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   46 QSTGGALRIGLESSEPTALLPRAETLPEPTELRPQKRKKGPAPKMLGNELCSVCGDKASAFHYNVLSCEGCKGFFRRSVIKGARYICHSGGHCPMDTYMRRKCQECRLRKCRHAGMREECVLSEEQIRLKKLKRQEEEQAQA-----TSVSPR-------------VSSPPQVLPQ---LSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPIAPDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRSMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSINHPHDRLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 443          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592844279|gb|GAXK01113265.1| (TSA: Calanus finmarchicus comp95139_c2_seq2 transcribed RNA sequence)

HSP 1 Score: 112.464 bits (280), Expect = 3.810e-25
Identity = 96/363 (26.45%), Postives = 158/363 (43.53%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQXXXXXXXXXXXDTTVDPXXXXXXXXXXXXXDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMV-TFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLME 509
            LC VCGD A+  HY    CEGCKGFF+R++ KN+ Y C  + +C +D   R +CQ CR +KC   GM  E V      ++ R+ +  +   +  +T   P  +         +D          T P      +L N L Y Q  Y   SE DL          +   E+E+ ++ +    +T  ++ +I  F + +PG   L   D+  L +    E+  LR A R   ES    + +     + N A++  G+  + +    R++  M+                      EPK VE +Q   +++L+ +V  N    +    F+++L  L +LRSL +   +  F LKL++    P L+E
Sbjct: 1832 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLTVGMVKEVV--RTDSLKGRRGRLPSKPKSPQETPPSPPVSLITALVRAHVD----------TNP------DLSN-LDYSQ--YVEISEEDLET-------KSGLMENEAAKITQFYNLLTT-SIDVIRNFCERIPGISELSNKDRELLFQSACLELFTLRLAYRTQPESLKFTFCSGLVLHR-NQARSTFGDWLNGIIELSRSLHSMELDVSAFSCLAALTLVNERHGLSEPKIVENLQNKIINSLRDHVTYNSDAQRKPHYFSRILDKLPQLRSLSVQGLQRIFYLKLEDLVQAPPLIE 2830          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592844280|gb|GAXK01113264.1| (TSA: Calanus finmarchicus comp95139_c2_seq1 transcribed RNA sequence)

HSP 1 Score: 112.464 bits (280), Expect = 3.840e-25
Identity = 96/363 (26.45%), Postives = 158/363 (43.53%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQXXXXXXXXXXXDTTVDPXXXXXXXXXXXXXDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMV-TFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLME 509
            LC VCGD A+  HY    CEGCKGFF+R++ KN+ Y C  + +C +D   R +CQ CR +KC   GM  E V      ++ R+ +  +   +  +T   P  +         +D          T P      +L N L Y Q  Y   SE DL          +   E+E+ ++ +    +T  ++ +I  F + +PG   L   D+  L +    E+  LR A R   ES    + +     + N A++  G+  + +    R++  M+                      EPK VE +Q   +++L+ +V  N    +    F+++L  L +LRSL +   +  F LKL++    P L+E
Sbjct: 1832 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLTVGMVKEVV--RTDSLKGRRGRLPSKPKSPQETPPSPPVSLITALVRAHVD----------TNP------DLSN-LDYSQ--YVEISEEDLET-------KSGLMENEAAKITQFYNLLTT-SIDVIRNFCERIPGISELSNKDRELLFQSACLELFTLRLAYRTQPESLKFTFCSGLVLHR-NQARSTFGDWLNGIIELSRSLHSMELDVSAFSCLAALTLVNERHGLSEPKIVENLQNKIINSLRDHVTYNSDAQRKPHYFSRILDKLPQLRSLSVQGLQRIFYLKLEDLVQAPPLIE 2830          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592853768|gb|GAXK01103776.1| (TSA: Calanus finmarchicus comp167181_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 108.997 bits (271), Expect = 4.169e-24
Identity = 43/71 (60.56%), Postives = 55/71 (77.46%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAE 241
            ELC+VCGDRASG HY A++CEGCKGFF+RSI K   Y C+ N +CE+  + R +CQ CRL+KC A GMR++
Sbjct: 2397 ELCVVCGDRASGRHYGAISCEGCKGFFKRSIRKQLGYQCRGNKECEVTKHARNRCQYCRLQKCLAMGMRSD 2609          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592874334|gb|GAXK01083228.1| (TSA: Calanus finmarchicus comp389578_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 104.375 bits (259), Expect = 9.736e-23
Identity = 50/127 (39.37%), Postives = 73/127 (57.48%), Query Frame = 0
Query:  135 LRHPNAPLTPTGAV--------QQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKR 253
            L HP AP +P  +V         +       + +  GS S    + C +CGDRA+G HY A +C+GCKGFFRRS+ K   Y+C+++ +C +D   R +C+ CRL+KC+  GM+ + V  ER  I KR
Sbjct:  515 LLHPPAPPSPINSVPSLVNDDIAELDHSHSPDLQCNGSQSGVIPQNCAICGDRATGKHYGAASCDGCKGFFRRSVRKKHAYSCRFSRNCTVDKDKRNQCRYCRLRKCFKAGMKKDAVQNERDRISKR 895          

HSP 2 Score: 41.2022 bits (95), Expect = 8.057e-3
Identity = 27/107 (25.23%), Postives = 53/107 (49.53%), Query Frame = 0
Query:  360 LIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATN--YPFTKENYAKAGLG--NDELFR--FCRAMSRMKEPKRVEKIQEIYVDALQAYV 460
            ++VE++KH+P F  L  DDQ+ LL+  + E ++L  ARR     + ++   +   P    ++  A +    D + R    R M+ + +P +  ++ +     L+A V
Sbjct: 1088 ILVEWAKHIPAFSELVLDDQVALLRAHAGEHLLLGLARRSMNLQNILLLGNDMIIPRDIRDWGTAWITEPQDTVVRDIGIRVMNELVQPFKAIQMDDTEFACLKAIV 1408          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592874006|gb|GAXK01083556.1| (TSA: Calanus finmarchicus comp176094_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 104.375 bits (259), Expect = 1.268e-22
Identity = 50/116 (43.10%), Postives = 68/116 (58.62%), Query Frame = 0
Query:  133 NGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEEL-CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPER 247
            +GL  P     P+  + Q S   + +          A++L C+VCGD++SG HY  + CEGCK FF+RS+ +N  Y C+ N +C ID + R +CQ CRLKKCY  GMR E V P R
Sbjct:  700 SGLISPTTTCIPSSNMSQSS---DGDSTNLKDGDLGADDLQCVVCGDKSSGKHYGQVTCEGCKSFFKRSVRRNLTYQCRGNKNCPIDQHHRNQCQHCRLKKCYKMGMRKEAVQPGR 1038          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592848671|gb|GAXK01108873.1| (TSA: Calanus finmarchicus comp297344_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 102.834 bits (255), Expect = 1.669e-22
Identity = 40/71 (56.34%), Postives = 54/71 (76.06%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAE 241
            E C+VCGDRASG HY  ++CEGCKGFF+RS+ K+  Y C+ N DC+++   R +CQ CRL+KC A GMR++
Sbjct: 1186 EFCVVCGDRASGRHYGVVSCEGCKGFFKRSMRKDQGYRCRLNKDCDVNKNYRNRCQYCRLQKCLAMGMRSD 1398          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592848672|gb|GAXK01108872.1| (TSA: Calanus finmarchicus comp297344_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 102.834 bits (255), Expect = 2.270e-22
Identity = 40/71 (56.34%), Postives = 54/71 (76.06%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAE 241
            E C+VCGDRASG HY  ++CEGCKGFF+RS+ K+  Y C+ N DC+++   R +CQ CRL+KC A GMR++
Sbjct: 1344 EFCVVCGDRASGRHYGVVSCEGCKGFFKRSMRKDQGYRCRLNKDCDVNKNYRNRCQYCRLQKCLAMGMRSD 1556          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592848673|gb|GAXK01108871.1| (TSA: Calanus finmarchicus comp297344_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 102.834 bits (255), Expect = 2.450e-22
Identity = 40/71 (56.34%), Postives = 54/71 (76.06%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAE 241
            E C+VCGDRASG HY  ++CEGCKGFF+RS+ K+  Y C+ N DC+++   R +CQ CRL+KC A GMR++
Sbjct: 1407 EFCVVCGDRASGRHYGVVSCEGCKGFFKRSMRKDQGYRCRLNKDCDVNKNYRNRCQYCRLQKCLAMGMRSD 1619          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592878692|gb|GAXK01079209.1| (TSA: Calanus finmarchicus comp267685_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 103.219 bits (256), Expect = 3.160e-22
Identity = 90/365 (24.66%), Postives = 156/365 (42.74%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQXXXXXXXXXXXDTTVDPXXXXXXXXXXXXXDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN-----DELFRFCRAMS-------------------RMKEPKRVEKIQEIYVDALQAYVMAN---RKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLME 509
            LC VCGD A+  HY    CEGCKGFF+R++ KN+ Y C  + +C +D   R +CQ CR +KC A GM  E V  +   ++ R+ +      +  D    P            ++     + L  ++ ++  +EE+ ++      E      A +++ Y +   S        D +F+               F   +PGF +LC+ D+  L +    E+  LR + R    S  + +  N      N  ++  G+      EL +  +A+                     + EPK+VE +Q   +++L+ +V  N   ++K Q   F+++L  L  LRSL     +  F L+L+     P ++E
Sbjct: 1161 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDG--LKGRRGRLPTKPRSNQDPPPSPPVAMITSLVRAHVESTPKLESLDYSQYVEMNDEEMDSKAGLIALE-----AARISQFYSLLTSSI-------DVIFK---------------FCDKIPGFNDLCKQDRELLFRSACLELFTLRLSHRTLPNSMKLTFC-NGTVLHRNQVRSTFGDWLNGITELSKSLQAIDIDASAYACLSALTLVNERHGLLEPKKVENLQTKIINSLRDHVTYNPDAQRKPQY--FSRILDKLQVLRSLSQQALQRIFYLRLEGLVPEPPIIE 2159          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592814756|gb|GAXK01139812.1| (TSA: Calanus finmarchicus comp832560_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 99.7525 bits (247), Expect = 8.878e-22
Identity = 48/102 (47.06%), Postives = 63/102 (61.76%), Query Frame = 0
Query:  150 QYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITK----NSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPER 247
            QY +M+  ERK         + LC VCGD+ASG HY   +C+GC+GFF+RSI +    N +Y CK NG C +D+  R +CQ+CR KKC A  M+ E V  ER
Sbjct:  730 QYIKMLSLERK--------GDILCQVCGDKASGKHYGVPSCDGCRGFFKRSIRRLAAGNLDYMCKENGRCIVDVTRRNQCQSCRFKKCLAVNMKKEAVQHER 1011          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000005090 (pep:novel supercontig:LSalAtl2s:LSalAtl2s269:306853:308464:-1 gene:EMLSAG00000005090 transcript:EMLSAT00000005090 description:"augustus_masked-LSalAtl2s269-processed-gene-3.0")

HSP 1 Score: 1059.28 bits (2738), Expect = 0.000e+0
Identity = 514/514 (100.00%), Postives = 514/514 (100.00%), Query Frame = 0
Query:    1 MSTTQYTAIIQPRPXHDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            MSTTQYTAIIQPRPXHDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE
Sbjct:    1 MSTTQYTAIIQPRPXHDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000001919 (pep:novel supercontig:LSalAtl2s:LSalAtl2s132:616435:622808:1 gene:EMLSAG00000001919 transcript:EMLSAT00000001919 description:"augustus_masked-LSalAtl2s132-processed-gene-6.5")

HSP 1 Score: 110.153 bits (274), Expect = 2.612e-26
Identity = 91/358 (25.42%), Postives = 148/358 (41.34%), Query Frame = 0
Query:  169 AEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE--RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPK--------------------------RVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKL 498
            ++  C +CGDRASG HY   +CEGCKGFF+R++ K   Y C+ N DC ID   R +CQ CR  KC  TGM+ E V  E  R                    + + +S+ +G  G + I+      R+   + +   +++    L+            D N          +          + +    I   +L+  FS+       L  +DQ+ L++G  +E+++   A      +D I+       T+EN  +AG+G+         +++MKE +                          +VE ++E     L+ Y  +   +N+   FAKLL  L  LRS+G+   E  F  KL
Sbjct:   87 SKHFCSICGDRASGKHYGVYSCEGCKGFFKRTVRKELTYACRENRDCVIDKRQRNRCQYCRYMKCLDTGMKREAVQEERHRGSNGPNHNNNNNNNNNNSRNSEEVESSTSGGGGDMPIE------RIIEAEDVGEMKQDTSEFLLL-----------DNNSSMSGGGSIGDMEIQRFGLAKKRIIHQLIEWAKLVPHFSE-------LKVEDQVTLIRGGWNELLVAGLAFXSIKLNDGILLGNGTIVTRENAHEAGVGHIFDRVLVELIAKMKEMQMDKAELGCLRAIILFNPDAKGLSDVTKVENLREKVYATLEEYTRSVH-ENEPSRFAKLLLRLPALRSIGLKCLEHLFFYKL 419          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000007361 (pep:novel supercontig:LSalAtl2s:LSalAtl2s418:374353:376789:1 gene:EMLSAG00000007361 transcript:EMLSAT00000007361 description:"maker-LSalAtl2s418-augustus-gene-3.13")

HSP 1 Score: 110.153 bits (274), Expect = 6.362e-26
Identity = 82/291 (28.18%), Postives = 125/291 (42.96%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFR--FCRAMSRMKEPKRVEKIQEIYVDALQAYVM 461
            C VCGDRA+G HY A +C+GCKGFFRRS+ K   Y C+ N  C ++   R  C+ CRLK C   GM+   V  ER  I  R+  +A    +  + TV    N + K G  S+ + S      +T     EE  L N+ +   E+  H                              M E  I    ++VE++KH+  F  L  DDQ+ LL+  S E +++  A+R    +  ++   +    K+         D   R    R M+ + +  +   I +  +  L+A V 
Sbjct:  151 CAVCGDRATGKHYGAASCDGCKGFFRRSVRKERVYGCRQNRACIVNKDKRNNCRYCRLKMCIKAGMKKSAVQNERDRISCRKKTSAKDMNSANELTVTALLNAD-KVGQKSL-LNSIVGGNINTNNFITEENVLANKQLASIEDIGHS-----------------------------MKEQLI----VLVEWAKHIKAFCELSVDDQVRLLRAHSGEHLLMGVAKRSMNLNGILLLGNDMIIVKDERKWNSESQDAAVRSIGVRVMNELVDTFKRINIDDAELACLKAIVF 406          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000012486 (pep:novel supercontig:LSalAtl2s:LSalAtl2s91:348479:353390:-1 gene:EMLSAG00000012486 transcript:EMLSAT00000012486 description:"maker-LSalAtl2s91-snap-gene-4.8")

HSP 1 Score: 107.842 bits (268), Expect = 5.626e-25
Identity = 58/146 (39.73%), Postives = 79/146 (54.11%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRA------ECVVPERTCIQ--KRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELIN 308
            E C+VCGDRASG HY A++CEGCKGFF+RSI K   Y C+ N DCE+  + R +CQ CRL+KC A GMR         + P  + +Q  +R    A  + A      +  S +N KN S    +   P  LS    L P  + +++
Sbjct:  218 EACVVCGDRASGRHYGAISCEGCKGFFKRSIRKQLGYQCRGNKDCEVTKHHRNRCQYCRLQKCLAMGMRIMKQIYESYLAPRVSAVQSERRPIVPANVSNAVTAALAENISISNAKNSSPVYHIYDSPTLLSRNS-LGPSSDSILS 362          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000009941 (pep:novel supercontig:LSalAtl2s:LSalAtl2s649:484085:485655:-1 gene:EMLSAG00000009941 transcript:EMLSAT00000009941 description:"maker-LSalAtl2s649-snap-gene-4.11")

HSP 1 Score: 103.99 bits (258), Expect = 1.734e-24
Identity = 92/352 (26.14%), Postives = 147/352 (41.76%), Query Frame = 0
Query:  158 ERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSE----VMMLRGARRYDAE----SDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNR 501
            E  K    S  ++  C+VCGD++SG HY    CEGCK FF+RS+ +N  Y C+ + +C +D + R +CQ CRLKKC+  GMR E V       Q+ +             + DP S     +  IS+ + + P                            +P+    +R   +PM +      E      ++ E     +   VE+++ +PGF  L   DQ+ LL+   SE    V  L+G     AE       +++ T+ P         GL + ++               +E++QE    AL+ Y   ++  NQ   F KLL  L  LR++     E  F ++L  +
Sbjct:   68 EHAKPSELSESSDINCVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYQCRGSKNCPVDQHHRNQCQHCRLKKCFKMGMRREAV-------QRGRVPPTPQGVFGLGFSSDPLSGTTYLSSYISMLLRAEP----------------------------YPT----SRYGQMPMPTNGMIGIE------NICEFAARLLFSAVEWTRSIPGFPELQVTDQVALLRLVWSELFEQVEKLKGLHVDSAEYVCMKAIVLFTTDAP---------GLCDMQV---------------IEQLQEKSQCALEEYC-RSQYPNQPTRFGKLLLRLPSLRTVSSTVIEQLFFVRLVGK 349          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000013004 (pep:novel supercontig:LSalAtl2s:LSalAtl2s98:942409:953748:1 gene:EMLSAG00000013004 transcript:EMLSAT00000013004 description:"augustus_masked-LSalAtl2s98-processed-gene-9.1")

HSP 1 Score: 103.99 bits (258), Expect = 1.292e-23
Identity = 96/389 (24.68%), Postives = 155/389 (39.85%), Query Frame = 0
Query:  169 AEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAK-------------------AAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPF----TKENYAKAGLGNDELFRFCRAMS----------------------RMKEPKRVEKIQEIYVDALQAYVMAN---RKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLME 509
            A  LC VCGD A+  HY    CEGCKGFF+R++ KN+ Y C  + +C +D   R +CQ CR +KC A GM  E V  +   ++ R+ +                     A   A  DT+  P  NN        +D + F +  S       +E  L N  +             + + YHV   S                      +++I  F + +PG   L  +D+  L +    E+ +LR A R + +SD   +           ++ +     G +E  R   +M                        + +PK+VE I+   +++L+ +V  N   +KK   +T  ++L  L  LRSL +   +  F LK ++    P L+E
Sbjct:  405 ASLLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDS--LKGRRGRLPSKPKSPTESPPSPPVSLITALVRAHIDTS--PDMNN--------LDYSQFVET-SIEDERDSKENMLANEAI------------KIGQFYHVLTSS----------------------IEVIRNFCERIPGISELSLNDRDLLFQTSCLELFVLRLAYRSNPDSDRYTFCNGVVLHVSQCEQTFGDWLNGINEFARGLHSMELDISAFSCLCGLILVNGKDERHGLSDPKKVESIENKIINSLKDHVTYNPEAQKKEHYMT--RILDRLPALRSLSMQGLQRIFFLKWEDLVPAPPLIE 744          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000008071 (pep:novel supercontig:LSalAtl2s:LSalAtl2s47:304551:317770:1 gene:EMLSAG00000008071 transcript:EMLSAT00000008071 description:"snap_masked-LSalAtl2s47-processed-gene-3.10")

HSP 1 Score: 98.2117 bits (243), Expect = 5.852e-22
Identity = 70/252 (27.78%), Postives = 107/252 (42.46%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGL 424
            CLVCGD ASG+HY   +CE CK FF+R+I  N  YT   + +CEI+   R+ CQACR +KC   GM  E V  +R     R  +            + P                  PK+         E+ +L+  L + +     P    +N    +P +   +  + SD   R +           +E++K +PGF NL  +DQ+ LL+   SE+++L    R    +  I    N+   +      GL
Sbjct:  271 CLVCGDIASGFHYGVSSCEACKAFFKRTIQGNIEYTXPASNECEINKRRRKACQACRFQKCLRMGMLKEGVRLDRV----RGGRQKYRRMIESSPYIQPP-----------------PKK-------TLEDNKLLQVLRHCE-----PEAFLVNMDMTLPNYKIRTISTLSDFYNRELIGT--------IEWAKQIPGFSNLTINDQMKLLQSSWSEILVLSLVYRSLPYNGKISLTNNFSLDESQARLCGL 481          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000009969 (pep:novel supercontig:LSalAtl2s:LSalAtl2s651:302705:304416:-1 gene:EMLSAG00000009969 transcript:EMLSAT00000009969 description:"maker-LSalAtl2s651-augustus-gene-2.5")

HSP 1 Score: 97.0561 bits (240), Expect = 1.198e-21
Identity = 64/228 (28.07%), Postives = 101/228 (44.30%), Query Frame = 0
Query:  170 EELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGAR 397
            E LC+VCGD++SG HY    CEGCK FF+R + ++  + C+    C +D + R +CQ CR KKC   GM+ E V   RT            +A   + + D  S N G     S  ++++   L   +P             Y   +Y     A  N +  +     N  E  +  LF              +E+++++PGF  L   DQ+ LL+   SE+ +L  ++
Sbjct:   72 EILCVVCGDKSSGKHYGQFTCEGCKSFFKRCVRRSLTFQCRSKKSCPVDQHHRNQCQHCRFKKCLNMGMKKEAVQKGRT---------TTTSAPIFNYSNDLFSPNTG-----SSYLSTYISLLLRAEP-------------YTTSQYGQLQMAASNNIIGI----DNICEFAARLLFS------------AIEWARNIPGFPELQITDQVGLLRMVWSELFVLNASQ 256          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000008902 (pep:novel supercontig:LSalAtl2s:LSalAtl2s554:572309:581835:1 gene:EMLSAG00000008902 transcript:EMLSAT00000008902 description:"maker-LSalAtl2s554-snap-gene-5.6")

HSP 1 Score: 94.7449 bits (234), Expect = 7.072e-21
Identity = 39/78 (50.00%), Postives = 49/78 (62.82%), Query Frame = 0
Query:  170 EELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPER 247
            EELC VCGD+ SGYHY  L CE CKGFF+R++     YTC  +  C ID   R++C  CR +KC   GM+ E V  +R
Sbjct:  183 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDR 260          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000004451 (pep:novel supercontig:LSalAtl2s:LSalAtl2s231:945915:949068:1 gene:EMLSAG00000004451 transcript:EMLSAT00000004451 description:"snap_masked-LSalAtl2s231-processed-gene-9.18")

HSP 1 Score: 94.7449 bits (234), Expect = 8.139e-21
Identity = 60/229 (26.20%), Postives = 101/229 (44.10%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERT--------CIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMML 393
            C VCGD+ SG+HY   +CE CKGFF+R++    NY C     C + +  R+KC ACR  KC   GM+ E +  +RT        C          +  +    T+  +S  +  N    ++        SS  P+   E   +  L ++       S +  +   +    +T++S+       + +T +    +  +V + K LP F+N+  DDQI LL     E+++ 
Sbjct:  155 CPVCGDKISGFHYGIFSCESCKGFFKRTVQNKKNYVCLRGSQCPVTISTRKKCPACRFDKCLNIGMKLEAIREDRTRGGRSTYQCSYNLPTTGVCSTNSTTIPTIKRESRGDDHNTETKVNQ-------SSGIPVLLHEIMSVEHLWFW-------STSMPSLSLNNSSSNTDTSQESPSNPVQTLTLLADKRLYKLVRWCKSLPLFKNILVDDQITLLINAWCELLVF 369          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|205371750|sp|P49880.2|ECR_AEDAE (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; Short=AaEcR; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 380.178 bits (975), Expect = 1.228e-122
Identity = 221/525 (42.10%), Postives = 292/525 (55.62%), Query Frame = 0
Query:   42 PPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAP--------LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSI-SIDMASFP----------------KRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSR----------------------MKEPKRVEKIQEIYVDALQAYVMANRKKNQ---MVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            P PP ++    S++ S  ++   ++ L     SN    S+PSP    +     P  P P   +TT            Y        SSP+  G   P +P        L+P+ ++  Y+   + +++KKG + R  EELCLVCGDR SGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K A        T     + N+     I  I M   P                 RL +   L   +  +I +L+++Q+ YE PSE DL R+    + S N  E + D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYDA +DSI++A N  +T+++Y  AG+ +  ++L  FCR M                        +++ + VE IQ  Y+D L+ Y++ NR        V FAKLL +LTELR+LG  NSE+CFSLKLKNRKLP FL EIWD++
Sbjct:  170 PMPPVAAGTNVSSNGSVTVYASGKRRL----ESNEEWISSPSP--GSVPGSAPPLSPSPGSQSTT------------YTTTMSNGYSSPMSTGSYDPYSPNGKMGREDLSPSSSLNGYTDGSDAKKQKKGPTPRQQEELCLVCGDRESGYHYNALTCEGCKGFFRRSVTKNAVYCCKFGHACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAIKRKEKKAQKEKDKVQTNATVSTTNSTYRSEILPILMKCDPPPHQAIPLLPEKLLQENRLRNIPLLTANQMAVIYKLIWYQDGYEQPSEEDLKRIM---IGSPNEEEDQHDVHFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDAATDSILFANNRSYTRDSYRMAGMADTIEDLLHFCRQMFSLTVDNVEYALLTAIVIFSDRPGLEQAELVEHIQSYYIDTLRIYIL-NRHAGDPKCSVIFAKLLSILTELRTLGNQNSEMCFSLKLKNRKLPRFLEEIWDVQ 672          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|1706576|sp|P49883.1|ECR_MANSE (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 365.925 bits (938), Expect = 8.847e-120
Identity = 203/415 (48.92%), Postives = 248/415 (59.76%), Query Frame = 0
Query:  142 LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAA---AAAAAXXDTTVD----------PKSNNNGKNGSIS----IDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQ--MVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P  ++   S   E  R+KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE TC  KR+ K A           TTVD          P      +   +      +      RL +  PL   ++ LI RLV++QE YE PSE DL RV           E E+D  FR +TEMTILTVQLIVEF+K LPGF  + + DQI LLK  SSEVMMLR ARRYDA +DS+++A N  +T++NY KAG+    ++L  FCR M  M                      ++P  VE+IQ  Y+  L+ Y++     +    V F K+L VLTELR+LG  NS +C SLKLKNRKLPPFL EIWD+
Sbjct:  116 LSPASSINGCSTDGEPRRQKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYICKFGHACEMDMYMRRKCQECRLKKCLAVGMRPECVVPESTCKNKRREKEAQREKDKLPVSTTTVDDHMPAIMQCDPPPPEAARIHEVVPRFLTEKLMEQNRLKNVTPLSANQKSLIARLVWYQEGYEQPSEEDLKRVTQT-WQLEEEEEEETDMPFRQITEMTILTVQLIVEFAKGLPGFSKISQSDQITLLKASSSEVMMLRVARRYDAATDSVLFANNQAYTRDNYRKAGMSYVIEDLLHFCRCMYSMSMDNVHYALLTAIVIFSDRPGLEQPLLVEEIQRYYLKTLRVYILNQHSASPRCAVLFGKILGVLTELRTLGTQNSNMCISLKLKNRKLPPFLEEIWDV 529          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|461984|sp|P34021.1|ECR_DROME (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 374.785 bits (961), Expect = 1.542e-119
Identity = 203/445 (45.62%), Postives = 268/445 (60.22%), Query Frame = 0
Query:  126 SPSSPLENGLRHPNAPLTPTGAVQQYS--QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSIS------------IDMASFPKRLSSTKPLKPEE-----------------EELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQM--VTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            +P S   N +      L+P+ ++  YS  +  + ++ KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TK++ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K    A    D      S+ +G NGS++            +D+ +      +T PL P+E                   +I +L+++Q+ YE PSE DL R+   P    + +ES++D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD  SDSI +A N  +T+++Y  AG+ +  ++L  FCR M  MK                      + + VE IQ  Y+D L+ Y++     + M  V +AKLL +LTELR+LG  N+E+CFSLKLKNRKLP FL EIWD+
Sbjct:  215 TPRSDSVNSISSGRDDLSPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREK---KAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILAKCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQP----DENESQTDVSFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYTRDSYKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQSYYIDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDV 652          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|146328613|sp|O18531.2|ECR_LUCCU (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 369.007 bits (946), Expect = 1.693e-118
Identity = 204/433 (47.11%), Postives = 260/433 (60.05%), Query Frame = 0
Query:  126 SPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKK--KGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEE-----------------EELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQM--VTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            +P S   N +      L+P+ ++  +S    ++ KK  KG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K A        T+V            ++ +  S P     T PL PE+                   +I +L+++Q+ YE PSE DL R+    M S + +ES+ D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD  SDSI +A N  +T+++Y  AG+ +  ++L  FCR M  MK                      E + VE IQ  Y+D L+ Y++     + M  V FAKLL +LTELR+LG  N+E+CFSLKLKNRKLP FL EIWD+
Sbjct:  252 TPRSESANSISSGRDDLSPSSSLNGFSTSDASDVKKIKKGPAPRLQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYCCKFGHACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREKKAQKEKDKIQTSVCATEIKKEILDLMTCEPPSHP-----TCPLLPEDILAKCQARNIPPLSYNQLAVIYKLIWYQDGYEQPSEEDLKRI----MSSPDENESQHDASFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHNSDSIFFANNRSYTRDSYKMAGMADNIEDLLHFCRQMYSMKVDNVEYALLTAIVIFSDRPGLEEAELVEAIQSYYIDTLRIYILNRHCGDPMSLVFFAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDV 675          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|6015050|sp|O18473.1|ECR_HELVI (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=HvEcR; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 358.992 bits (920), Expect = 8.147e-117
Identity = 199/424 (46.93%), Postives = 251/424 (59.20%), Query Frame = 0
Query:  142 LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAA---XXDTTVD-------------PKSNNNGKNGSISIDMASFPK----------RLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKN--QMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P  +V   S   E  R+KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+D+YMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K A           TTVD             P++    +     +     P+          RL +  PL   ++ LI RLV++QE YE PSE DL RV        +S        FR +TEMTILTVQLIVEF+K LPGF  + + DQI LLK CSSEVMMLR ARRYDA +DS+++A N  +T++NY KAG+    ++L  FCR M  M                      ++P  VE+IQ  Y++ L+ Y++     +    V F ++L +LTE+R+LG+ NS +C SLKLKNRKLPPFL EIWD+
Sbjct:  132 LSPASSVNGCSTDGEARRQKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYICKFGHACEMDIYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRKEKKAQREKDKLPVSTTTVDDHMPPIMQCDPPPPEAARILE----CVQHEVVPRFLNEKLMEQNRLKNVPPLTANQKSLIARLVWYQEGYEQPSEEDLKRVTQSDEDDEDSDMP-----FRQITEMTILTVQLIVEFAKGLPGFAKISQSDQITLLKACSSEVMMLRVARRYDAATDSVLFANNQAYTRDNYRKAGMAYVIEDLLHFCRCMYSMMMDNVHYALLTAIVIFSDRPGLEQPLLVEEIQRYYLNTLRVYILNQNSASPRGAVIFGEILGILTEIRTLGMQNSNMCISLKLKNRKLPPFLEEIWDV 546          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|1706574|sp|P49881.1|ECR_BOMMO (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 355.525 bits (911), Expect = 4.790e-115
Identity = 194/420 (46.19%), Postives = 249/420 (59.29%), Query Frame = 0
Query:  142 LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVV--PERTCIQKRQAKAAAAAAAXXDTTV----------DPKSNNNGKNGSISIDMASFPKRLS----------STKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQ--MVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P  ++   S   +  R+KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECV+  P +   ++RQ K          TTV          DP      +   +       P+ LS          +  PL   ++ LI RLV++QE YE PS+ DL RV       ++  + ESD  FR +TEMTILTVQLIVEF+K LPGF  + + DQI LLK  SSEVMMLR ARRYDA SDS+++A N  +T++NY + G+    ++L  FCR M  M                      ++P  VE+IQ  Y++ L+ Y++     +    V + ++L VLTELR+LG  NS +C SLKLKNRKLPPFL EIWD+
Sbjct:  176 LSPASSINGCSADADARRQKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYICKFGHACEMDMYMRRKCQECRLKKCLAVGMRPECVIQEPSKNKDRQRQKKDKGILLPVSTTTVEDHMPPIMQCDPPPPEAARIHEV------VPRYLSEKLMEQNRQKNIPPLSANQKSLIARLVWYQEGYEQPSDEDLKRVTQT--WQSDEEDEESDLPFRQITEMTILTVQLIVEFAKGLPGFSKISQSDQITLLKASSSEVMMLRVARRYDAASDSVLFANNKAYTRDNYRQGGMAYVIEDLLHFCRCMFAMGMDNVHFALLTAIVIFSDRPGLEQPSLVEEIQRYYLNTLRIYIINQNSASSRCAVIYGRILSVLTELRTLGTQNSNMCISLKLKNRKLPPFLEEIWDV 587          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|1706575|sp|P49882.1|ECR_CHITE (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 330.872 bits (847), Expect = 1.936e-106
Identity = 187/414 (45.17%), Postives = 237/414 (57.25%), Query Frame = 0
Query:  161 KKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVD-----------PKSNNNGKNGSISI-----------------------DMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSR----------------------MKEPKRVEKIQEIYVDALQAYVMANRKKNQ---MVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            KKG   R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+  +CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K A          V              +N + KN  IS                        +      R   T  L   +  +I +L+++Q+ YE PSE DL R+        +     +   FR++TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD +SDSI++A N  +TK+ Y  AG+    D+L  FCR M                        +++ + V+ IQ  Y + L+ Y++ NR   +    V FAKLL +LTELR++G  NSE+CFSLKL+NRKLP FL E+WD+
Sbjct:  103 KKGPVPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYCCKFGHECEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAIKRKEKKAQKEKDKVPGIVGSNTSSSSLLNQSLNNGSLKNLEISYREELLEQLMKCDPPPHPMQQLLPEKLLMENRAKGTPQLTANQVAVIYKLIWYQDGYEQPSEEDLKRITTELEEEEDQEHEAN---FRYITEVTILTVQLIVEFAKGLPAFIKIPQEDQITLLKACSSEVMMLRMARRYDHDSDSILFANNTAYTKQTYQLAGMEETIDDLLHFCRQMYALSIDNVEYALLTAIVIFSDRPGLEKAEMVDIIQSYYTETLKVYIV-NRHGGESRCSVQFAKLLGILTELRTMGNKNSEMCFSLKLRNRKLPRFLEEVWDV 512          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|341942229|sp|Q9Z0Y9.3|NR1H3_MOUSE (RecName: Full=Oxysterols receptor LXR-alpha; AltName: Full=Liver X receptor alpha; AltName: Full=Nuclear receptor subfamily 1 group H member 3)

HSP 1 Score: 266.544 bits (680), Expect = 1.095e-82
Identity = 156/405 (38.52%), Postives = 226/405 (55.80%), Query Frame = 0
Query:  138 PNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P A L     + + +++   +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ K + Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T+V P+             ++S P+ L     L PE+  +I +LV  Q++    S +D  RV   P+     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F RAM+ +                       ++  +VE++Q  YV+AL AYV  N   + ++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   61 PTALLPRAETLPEPTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAQA-----TSVSPR-------------VSSPPQVLPQ---LSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPIAPDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSINHPHDPLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 443          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|23503089|sp|Q13133.2|NR1H3_HUMAN (RecName: Full=Oxysterols receptor LXR-alpha; AltName: Full=Liver X receptor alpha; AltName: Full=Nuclear receptor subfamily 1 group H member 3)

HSP 1 Score: 266.159 bits (679), Expect = 1.892e-82
Identity = 156/405 (38.52%), Postives = 228/405 (56.30%), Query Frame = 0
Query:  138 PNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P A LT      + +++   +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ K ++Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T++ P+++             S P+ L     L PE+  +I +LV  Q++    S +D  RV   PM     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F RAM+ +                       ++  +VE++Q  YV+AL AYV  +   ++++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   63 PTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAHA-----TSLPPRAS-------------SPPQILPQ---LSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 445          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|75060925|sp|Q5E9B6.1|NR1H3_BOVIN (RecName: Full=Oxysterols receptor LXR-alpha; AltName: Full=Liver X receptor alpha; AltName: Full=Nuclear receptor subfamily 1 group H member 3)

HSP 1 Score: 265.774 bits (678), Expect = 2.197e-82
Identity = 156/405 (38.52%), Postives = 225/405 (55.56%), Query Frame = 0
Query:  138 PNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P A L    A  + +++   +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ K + Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T+  P+++             S P+ L     L PE+  +I +LV  Q+     S +D  RV   PM     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F RAM+ +                       ++  +VE++Q  YV+AL AYV  +   ++++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   63 PTALLPGVEAPPESTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKMKRQEEEQAQA-----TSAPPRAS-------------SPPQVLPQ---LSPEQLGMIEKLVAAQQLCNRRSFSDQLRVTPWPMAPDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 445          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: EEB17490.1 (Ecdysone receptor, putative [Pediculus humanus corporis])

HSP 1 Score: 434.106 bits (1115), Expect = 4.222e-147
Identity = 238/466 (51.07%), Postives = 286/466 (61.37%), Query Frame = 0
Query:   95 PXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAP--------LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFP---------------KRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P  P P P     H Q++  +  Y         SSP+ +G   P +P        L+P G++  YS    + +KKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+   CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A        +T          NGS  + MA  P                  +  KP+ PE+EELI+RLVYFQ EYE PS+ DL R+ + P    +  E +SD  FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMMLR ARRYD  SDSI++A N P+T+++Y+ AG+G   D+L RFCR M  MK                      E  +VEKIQEIY++AL+ YV   RK      FAKLL VLTELR+LG  NSE+CFSLKLKN+KLPPFL EIWD+
Sbjct:   80 PLTPSPGP-----HNQYTVISNGY---------SSPMSSGSYDPYSPNGKLGREDLSPPGSLNGYSVDSSDSKKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGDSCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEIQCEVKRREKKAQREKGKPSSTT---------NGSPELIMADTPAIKTEPNTTQSHNEKSSANGVKPISPEQEELIHRLVYFQNEYEQPSDEDLKRISNAP----SEGEDQSDLNFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMLRMARRYDVGSDSILFANNQPYTRDSYSLAGMGETVDDLLRFCRQMYGMKVDNAEYALLTAIVIFSERPSLIEGWKVEKIQEIYLEALKVYVDNRRKPRSGTIFAKLLSVLTELRTLGNLNSEMCFSLKLKNKKLPPFLAEIWDV 518          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: gb|KYB25531.1| (Ecdysone receptor-like Protein [Tribolium castaneum])

HSP 1 Score: 425.246 bits (1092), Expect = 2.163e-143
Identity = 225/422 (53.32%), Postives = 278/422 (65.88%), Query Frame = 0
Query:  128 SSPLENGLRHPNAP--------LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISI--DMASFPKRL-SSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            SSP+ +G   P +P        L+P+ ++  YS    + +KKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A            P S  NG    I +  +++   K L + +K + PE+EELI+RLVYFQ EYEHPSE D+ R+ + PM      E + D  FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMM R ARRYD ++DSI++  N P+++++Y  AG+G   ++L  FCR M  MK                      E  +VEKIQEIY++AL+AYV   RK      FAKLL VLTELR+LG  NSE+CFSLKLKN+KLPPFL EIWD++
Sbjct:  125 SSPMSSGSYDPYSPNGKIGREDLSPS-SLNGYSADSCDSKKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEVQCAVKRKEKKAQKEKDK------PNSTTNGSPDVIKVEPELSDSEKTLCNGSKGISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPM----DGEDQCDVRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQTDSILFVNNQPYSRDSYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYLEALRAYVDNRRKPKPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFLAEIWDVD 535          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: gb|KYB25532.1| (Ecdysone receptor-like Protein [Tribolium castaneum])

HSP 1 Score: 421.394 bits (1082), Expect = 1.151e-142
Identity = 225/431 (52.20%), Postives = 282/431 (65.43%), Query Frame = 0
Query:  111 HSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISI--DMASFPKRL-SSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            H+   ++++L  S  S +S  E+        L+P+ ++  YS    + +KKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A            P S  NG    I +  +++   K L + +K + PE+EELI+RLVYFQ EYEHPSE D+ R+ + PM      E + D  FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMM R ARRYD ++DSI++  N P+++++Y  AG+G   ++L  FCR M  MK                      E  +VEKIQEIY++AL+AYV   RK      FAKLL VLTELR+LG  NSE+CFSLKLKN+KLPPFL EIWD++
Sbjct:   70 HTIIASNHHLAKSDTSSASGRED--------LSPS-SLNGYSADSCDSKKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEVQCAVKRKEKKAQKEKDK------PNSTTNGSPDVIKVEPELSDSEKTLCNGSKGISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPM----DGEDQCDVRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQTDSILFVNNQPYSRDSYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYLEALRAYVDNRRKPKPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFLAEIWDVD 481          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: NP_001152827.1 (ecdysone receptor isoform B1 [Apis mellifera])

HSP 1 Score: 414.846 bits (1065), Expect = 4.206e-139
Identity = 217/399 (54.39%), Postives = 258/399 (64.66%), Query Frame = 0
Query:  157 NERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSS------------------TKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            + RKKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC   GMR ECVVPE  C  KR+ K A       ++T    S  +G   S  + +   P    S                   KP+ PE+EELI+RLVYFQ EYE PSE DL R+ + P    +  E  SD  FRH+TE+TILTVQLIVEFSK LPGF  L R+DQI LLK CSSEVMMLR AR+YD ++DSI++A N P+TK++Y  AG+G   ++L  FCR M  MK                      E  +VEKIQEIY++AL+AYV   R+ N    FA+LL VLTELR+LG  NSE+CFSLK KN+KLP FL EIWD+
Sbjct:  161 DARKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLTVGMRPECVVPEYQCAVKRKEKKAQKEKDKPNSTTMNGSPGSGGIRSDQMGVKIEPAEAESLSTSGSSGILTPVSPYGYVKPISPEQEELIHRLVYFQNEYEQPSEEDLKRITNQP----SEGEDISDYKFRHITEITILTVQLIVEFSKRLPGFDELMREDQIALLKACSSEVMMLRMARKYDVQTDSIIFANNQPYTKDSYTVAGMGETIEDLLHFCRQMYAMKVNNAEYALLTAIVIFSERPNLLEGWKVEKIQEIYLEALRAYVDNRRRPNPGTVFARLLSVLTELRTLGNQNSEMCFSLKFKNKKLPVFLAEIWDV 555          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: NP_001091685.2 (ecdysone receptor isoform A [Apis mellifera])

HSP 1 Score: 417.157 bits (1071), Expect = 4.987e-139
Identity = 217/399 (54.39%), Postives = 258/399 (64.66%), Query Frame = 0
Query:  157 NERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSS------------------TKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            + RKKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC   GMR ECVVPE  C  KR+ K A       ++T    S  +G   S  + +   P    S                   KP+ PE+EELI+RLVYFQ EYE PSE DL R+ + P    +  E  SD  FRH+TE+TILTVQLIVEFSK LPGF  L R+DQI LLK CSSEVMMLR AR+YD ++DSI++A N P+TK++Y  AG+G   ++L  FCR M  MK                      E  +VEKIQEIY++AL+AYV   R+ N    FA+LL VLTELR+LG  NSE+CFSLK KN+KLP FL EIWD+
Sbjct:  233 DARKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLTVGMRPECVVPEYQCAVKRKEKKAQKEKDKPNSTTMNGSPGSGGIRSDQMGVKIEPAEAESLSTSGSSGILTPVSPYGYVKPISPEQEELIHRLVYFQNEYEQPSEEDLKRITNQP----SEGEDISDYKFRHITEITILTVQLIVEFSKRLPGFDELMREDQIALLKACSSEVMMLRMARKYDVQTDSIIFANNQPYTKDSYTVAGMGETIEDLLHFCRQMYAMKVNNAEYALLTAIVIFSERPNLLEGWKVEKIQEIYLEALRAYVDNRRRPNPGTVFARLLSVLTELRTLGNQNSEMCFSLKFKNKKLPVFLAEIWDV 627          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: XP_016768787.1 (PREDICTED: ecdysone receptor isoform X1 [Apis mellifera])

HSP 1 Score: 417.157 bits (1071), Expect = 5.139e-139
Identity = 217/399 (54.39%), Postives = 258/399 (64.66%), Query Frame = 0
Query:  157 NERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSS------------------TKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            + RKKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC   GMR ECVVPE  C  KR+ K A       ++T    S  +G   S  + +   P    S                   KP+ PE+EELI+RLVYFQ EYE PSE DL R+ + P    +  E  SD  FRH+TE+TILTVQLIVEFSK LPGF  L R+DQI LLK CSSEVMMLR AR+YD ++DSI++A N P+TK++Y  AG+G   ++L  FCR M  MK                      E  +VEKIQEIY++AL+AYV   R+ N    FA+LL VLTELR+LG  NSE+CFSLK KN+KLP FL EIWD+
Sbjct:  234 DARKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLTVGMRPECVVPEYQCAVKRKEKKAQKEKDKPNSTTMNGSPGSGGIRSDQMGVKIEPAEAESLSTSGSSGILTPVSPYGYVKPISPEQEELIHRLVYFQNEYEQPSEEDLKRITNQP----SEGEDISDYKFRHITEITILTVQLIVEFSKRLPGFDELMREDQIALLKACSSEVMMLRMARKYDVQTDSIIFANNQPYTKDSYTVAGMGETIEDLLHFCRQMYAMKVNNAEYALLTAIVIFSERPNLLEGWKVEKIQEIYLEALRAYVDNRRRPNPGTVFARLLSVLTELRTLGNQNSEMCFSLKFKNKKLPVFLAEIWDV 628          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: XP_006568116.1 (PREDICTED: ecdysone receptor isoform X1 [Apis mellifera])

HSP 1 Score: 417.157 bits (1071), Expect = 5.139e-139
Identity = 217/399 (54.39%), Postives = 258/399 (64.66%), Query Frame = 0
Query:  157 NERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSS------------------TKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            + RKKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC   GMR ECVVPE  C  KR+ K A       ++T    S  +G   S  + +   P    S                   KP+ PE+EELI+RLVYFQ EYE PSE DL R+ + P    +  E  SD  FRH+TE+TILTVQLIVEFSK LPGF  L R+DQI LLK CSSEVMMLR AR+YD ++DSI++A N P+TK++Y  AG+G   ++L  FCR M  MK                      E  +VEKIQEIY++AL+AYV   R+ N    FA+LL VLTELR+LG  NSE+CFSLK KN+KLP FL EIWD+
Sbjct:  234 DARKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLTVGMRPECVVPEYQCAVKRKEKKAQKEKDKPNSTTMNGSPGSGGIRSDQMGVKIEPAEAESLSTSGSSGILTPVSPYGYVKPISPEQEELIHRLVYFQNEYEQPSEEDLKRITNQP----SEGEDISDYKFRHITEITILTVQLIVEFSKRLPGFDELMREDQIALLKACSSEVMMLRMARKYDVQTDSIIFANNQPYTKDSYTVAGMGETIEDLLHFCRQMYAMKVNNAEYALLTAIVIFSERPNLLEGWKVEKIQEIYLEALRAYVDNRRRPNPGTVFARLLSVLTELRTLGNQNSEMCFSLKFKNKKLPVFLAEIWDV 628          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: gb|KFM66857.1| (Ecdysone receptor, partial [Stegodyphus mimosarum])

HSP 1 Score: 401.749 bits (1031), Expect = 1.493e-136
Identity = 212/384 (55.21%), Postives = 256/384 (66.67%), Query Frame = 0
Query:  158 ERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXD-TTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANR--KKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            ++KKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A       + TT D  S+   K GS        P      K +   +EELI+RLV FQEEYE PSE D  ++   P+     SE +S + F+H+TE+TILTVQLIVEFSK +PGF  L R+DQI LLK CSSEVMMLR AR+YD ++DSIV+A N P+T+ENY  A +G+  D +F FCR M  +K                      EPK+VEKIQE Y++ L+AY+  NR   KN    FA+LL  L ELR+LG  NSELCFSLK++N+KLP FL EIWDI+
Sbjct:    8 DKKKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEYQCAIKRETKKAQKDKDKPNSTTRDSGSDKEEKPGS--------PPNGGQPKAISKAQEELISRLVVFQEEYESPSEEDFKKITAFPL---GDSEEDSMKRFQHITEITILTVQLIVEFSKRVPGFDTLSREDQITLLKACSSEVMMLRTARKYDIKTDSIVFANNQPYTRENYRSACMGDSADSIFHFCRNMCVLKVDNAEYALLTAIVIFSERPSLLEPKKVEKIQEFYIETLRAYISTNRPPGKN---YFARLLSTLVELRTLGNMNSELCFSLKVQNKKLPAFLEEIWDIQ 377          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: gb|EEC03371.1| (AamEcRA1, putative [Ixodes scapularis])

HSP 1 Score: 396.741 bits (1018), Expect = 8.064e-134
Identity = 204/396 (51.52%), Postives = 265/396 (66.92%), Query Frame = 0
Query:  151 YSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTV--DPKSNNNGKNGSISIDMASFPKR-----LS-STKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            Y+    + +KKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +C+IDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR++K         ++T    P ++     G  S+     P+      LS   KPL   +E+LIN+LVY+Q+E+E PSE D+ +    P+     SE ++ R F+H+TE+TILTVQLIVEFSK +PGF  L R+DQI LLK CSSEVMMLRGAR+YD ++DSIV+A N P+T++NY  A +G+  D LFRFCR M +++                      +P +VE+IQE Y+D L+ Y   +R   +   FA+LL +LTELR+LG  N+E+CFSLK++N+KLPPFL EIWDI+
Sbjct:   41 YADSFGDPKKKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCDIDMYMRRKCQECRLKKCLSVGMRPECVVPEYQCAIKRESKKHQKDKDRPNSTTRESPATSMGPSPGGSSVVQLMEPEDKKPLVLSPGVKPLSSSQEDLINKLVYYQQEFESPSEEDMKKTTPFPL---GDSEEDNQRRFQHITEITILTVQLIVEFSKRVPGFDTLAREDQITLLKACSSEVMMLRGARKYDVKTDSIVFANNQPYTRDNYRSASVGDSADALFRFCRKMCQLRVDNAEYALLTAIVIFSERPCLVDPHKVERIQEYYIDTLRMYSENHRPPGKNY-FARLLSILTELRTLGNMNAEMCFSLKVQNKKLPPFLAEIWDIQ 432          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: AAM68346.1 (ecdysone receptor, isoform E [Drosophila melanogaster])

HSP 1 Score: 379.793 bits (974), Expect = 5.116e-122
Identity = 209/465 (44.95%), Postives = 277/465 (59.57%), Query Frame = 0
Query:  114 QNTHYYLNNSGESPSSPLENGLRHPNAP--------LTPTGAVQQYS--QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSIS------------IDMASFPKRLSSTKPLKPEE-----------------EELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQM--VTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            QN  Y ++N     +SP+  G   P +P        L+P+ ++  YS  +  + ++ KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TK++ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K    A    D      S+ +G NGS++            +D+ +      +T PL P+E                   +I +L+++Q+ YE PSE DL R+   P    + +ES++D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD  SDSI +A N  +T+++Y  AG+ +  ++L  FCR M  MK                      + + VE IQ  Y+D L+ Y++     + M  V +AKLL +LTELR+LG  N+E+CFSLKLKNRKLP FL EIWD+
Sbjct:  169 QNHSYNMSNG---YASPMSAGSYDPYSPTGKTGRDDLSPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREK---KAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILAKCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQP----DENESQTDVSFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYTRDSYKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQSYYIDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDV 623          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|729058610|gb|AIZ04022.1| (ecdysone receptor, partial [Lepeophtheirus salmonis salmonis])

HSP 1 Score: 1050.81 bits (2716), Expect = 0.000e+0
Identity = 507/536 (94.59%), Postives = 507/536 (94.59%), Query Frame = 0
Query:    1 MSTTQYTAIIQPRPXHDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            MSTTQYTAIIQPRP HDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIK  PHP  PPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAA  DTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM                      KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE
Sbjct:    1 MSTTQYTAIIQPRPTHDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKTEPHPYSPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAAADTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKVDNAEYALITAIVIFSDRNSLKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 536          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|291190960|gb|ADD82902.1| (ecdysone receptor [Tigriopus japonicus])

HSP 1 Score: 531.561 bits (1368), Expect = 0.000e+0
Identity = 280/490 (57.14%), Postives = 333/490 (67.96%), Query Frame = 0
Query:   66 QSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXD---TTVDPKSNNNGKNGSISIDMASFP-------------KRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSS---ESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            Q ++++T S +  +   SP+ +EIK  P         +  +     +Q N    L++ G SPSS   + L    +P     + Q Y +M ENERKKKG   RP EE C VCGDRASGYHYNALACEGCKGFFRRSITKNS Y+CK+   CEIDMYMRRKCQACR KKCY  GMRAECVVPE  C +KR  K A  AA   D   TT    +N  G    +S++ +  P             +   S + LKPEEEELINR+VY+Q+EYE+PSE DLNRVYHVP+   N S   ESESDRLF+H+TEMTILTVQLIVEFSKHLPGFQ LCR+DQ+NLLKGCSSEVMMLRGARRYD + DSI+YA NYPF+K+NY KAGL ND LFRFCR+M +M                      KEP RVEKIQEIYV+ALQ+YVMA +KK  MVTFAKLL VLTELRSLG +N++ CF+L++ NR+LP FL EIWDI+
Sbjct:   72 QPIYVDTSSPSSQFQASSPLTTEIKSEPPSSY-----SPPSNSLGFTQGN----LSSVG-SPSSQQSSFLVKSESP-----SSQDYPRMQENERKKKGQVPRPQEEFCTVCGDRASGYHYNALACEGCKGFFRRSITKNSTYSCKYGDGCEIDMYMRRKCQACRFKKCYTVGMRAECVVPESQCQKKRAIKRAQKAAQKGDASSTTAITNANGVGGVSGVSLNGSHTPNFAGLGLGLTLGARSTLSQRHLKPEEEELINRIVYYQDEYENPSEDDLNRVYHVPLQYANDSNGIESESDRLFQHITEMTILTVQLIVEFSKHLPGFQTLCREDQVNLLKGCSSEVMMLRGARRYDPQRDSIIYANNYPFSKDNYVKAGLSNDSLFRFCRSMCKMKVDNAEYALITAIVIFSERHNVKEPNRVEKIQEIYVEALQSYVMAKQKKEPMVTFAKLLSVLTELRSLGNSNAKTCFNLRMINRQLPAFLAEIWDIK 546          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|335355357|gb|AEH43772.1| (ecdysone receptor isoform 2 [Amphiascus tenuiremis])

HSP 1 Score: 473.011 bits (1216), Expect = 1.325e-160
Identity = 256/457 (56.02%), Postives = 303/457 (66.30%), Query Frame = 0
Query:  123 SGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKG----------SSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKA------AAAAAAXXDTTVDPKSNNNGKNGSISIDMAS---FPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVP------------------------MHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            S  SP+    +      +PLTPTGAV QY+QM E ERKKK              +P EELCLVCGDRASGYHYNALACEGCKGFFR SITK+S Y CK+   CEIDMYMRRKCQACRLKKCY  GMRAECVVPE  C +KRQAK                T    ++NNN   GS++  +AS      RL+    LKPE+E LINR+V++Q+E+E P++ DL+RVYHVP                          S    ++ESD+ FRHMTEMT+LTVQLIVEFSKHLPGFQ LCRDDQ++LLK CSSEV+M+RGARRYD + + I+YATNYPF++ENY  AGLGN+ LFRFC+ M  MK                      EPKRVEKIQEIYV+ALQ+YVMA RK+  MV FAKLL VLT LRSLG NN++ CF++K+ NRKLP FL EIWDI+
Sbjct:    3 SAGSPAGSANSFFPPGGSPLTPTGAVHQYAQMQEAERKKKSHHNSGGNSSNGGGKPQEELCLVCGDRASGYHYNALACEGCKGFFR-SITKSSKYACKYGDGCEIDMYMRRKCQACRLKKCYLVGMRAECVVPESQCQKKRQAKQAQKAQQGGEGGDITTTNNSVQNNNNNLLGSLAASVASTSALKNRLTPPWTLKPEQEGLINRIVFYQDEFEKPTDEDLSRVYHVPPLQPGHLDPGSGGGPGTNSLTANGSGSNGELDNESDKYFRHMTEMTVLTVQLIVEFSKHLPGFQTLCRDDQVSLLKACSSEVIMIRGARRYDPQRECIIYATNYPFSQENYDMAGLGNEALFRFCKLMCSMKVDNAEYALLTAIVIFSDRENVREPKRVEKIQEIYVEALQSYVMARRKEEHMVAFAKLLSVLTTLRSLGNNNAKTCFNMKMVNRKLPAFLAEIWDIK 458          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|1111332457|gb|APH81342.1| (ecdysone receptor [Paracyclopina nana])

HSP 1 Score: 464.537 bits (1194), Expect = 6.560e-157
Identity = 232/393 (59.03%), Postives = 276/393 (70.23%), Query Frame = 0
Query:  164 SSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSS--------------------TKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            S+SRP E+LCLVCGDRASGYHYNALACEGCKGFFRRSITKN +Y CK+  +CEIDMYMRRKCQACRLKKCYA GMRA+CVVPE  C++KR AK+                NNNG+   + I      + LS                      +PLKPEEEELINRLVYFQ ++E+P+E DL +VYHVP+HS   +E+E D LFRH+TEMTILTV LIV+F KHLPGF +L +DDQ+ +LKGCSSEVMMLR ARRYD +++SI++A N+PFTKENY +AGL  + LFRFCR M +M                      K+ KRVEKIQEIYVDAL++YVM++RKK+  V FAKLL  L ELRSLG  NS  CF LKL NR+LP FL EIWDI+
Sbjct:  113 SNSRPQEDLCLVCGDRASGYHYNALACEGCKGFFRRSITKNQSYKCKYGDNCEIDMYMRRKCQACRLKKCYAVGMRADCVVPEEQCVKKRMAKS---------------KNNNGETSPLMITNGGHMRHLSGGSDTNGATLVLKRPAPLVHVVRPLKPEEEELINRLVYFQLQFEYPNEEDLKKVYHVPLHS-QGAENEGDCLFRHITEMTILTVNLIVDFCKHLPGFASLEKDDQVVILKGCSSEVMMLRAARRYDPQTESIIFANNHPFTKENYKQAGLRFEALFRFCRRMIKMKVDNAEFGLLTAITIFSERKNLKQRKRVEKIQEIYVDALRSYVMSHRKKDPTVAFAKLLGALVELRSLGNLNSRTCFDLKLVNRRLPDFLAEIWDIK 489          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|1110961968|gb|APG80611.1| (ecdysone receptor [Paracyclopina nana])

HSP 1 Score: 464.537 bits (1194), Expect = 6.778e-157
Identity = 232/393 (59.03%), Postives = 276/393 (70.23%), Query Frame = 0
Query:  164 SSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSS--------------------TKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            S+SRP E+LCLVCGDRASGYHYNALACEGCKGFFRRSITKN +Y CK+  +CEIDMYMRRKCQACRLKKCYA GMRA+CVVPE  C++KR AK+                NNNG+   + I      + LS                      +PLKPEEEELINRLVYFQ ++E+P+E DL +VYHVP+HS   +E+E D LFRH+TEMTILTV LIV+F KHLPGF +L +DDQ+ +LKGCSSEVMMLR ARRYD +++SI++A N+PFTKENY +AGL  + LFRFCR M +M                      K+ KRVEKIQEIYVDAL++YVM++RKK+  V FAKLL  L ELRSLG  NS  CF LKL NR+LP FL EIWDI+
Sbjct:  113 SNSRPQEDLCLVCGDRASGYHYNALACEGCKGFFRRSITKNQSYKCKYGDNCEIDMYMRRKCQACRLKKCYAVGMRADCVVPEEQCVKKRMAKS---------------KNNNGETSPLMITNGGHMRHLSGGSDTNGATLVLKRPAPLVHVVRPLKPEEEELINRLVYFQLQFEYPNEEDLKKVYHVPLHS-QGAENEGDCLFRHITEMTILTVNLIVDFCKHLPGFASLEKDDQVVILKGCSSEVMMLRAARRYDPQTESIIFANNHPFTKENYKQAGLRFEALFRFCRRMIKMKVDNAEFGLLTAITIFSERKNLKQRKRVEKIQEIYVDALRSYVMSHRKKDPTVAFAKLLGALVELRSLGNLNSRTCFDLKLVNRRLPDFLAEIWDIK 489          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|242019559|ref|XP_002430228.1| (Ecdysone receptor, putative [Pediculus humanus corporis] >gi|212515324|gb|EEB17490.1| Ecdysone receptor, putative [Pediculus humanus corporis])

HSP 1 Score: 434.106 bits (1115), Expect = 2.066e-144
Identity = 238/466 (51.07%), Postives = 286/466 (61.37%), Query Frame = 0
Query:   95 PXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAP--------LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFP---------------KRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P  P P P     H Q++  +  Y         SSP+ +G   P +P        L+P G++  YS    + +KKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+   CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A        +T          NGS  + MA  P                  +  KP+ PE+EELI+RLVYFQ EYE PS+ DL R+ + P    +  E +SD  FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMMLR ARRYD  SDSI++A N P+T+++Y+ AG+G   D+L RFCR M  MK                      E  +VEKIQEIY++AL+ YV   RK      FAKLL VLTELR+LG  NSE+CFSLKLKN+KLPPFL EIWD+
Sbjct:   80 PLTPSPGP-----HNQYTVISNGY---------SSPMSSGSYDPYSPNGKLGREDLSPPGSLNGYSVDSSDSKKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGDSCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEIQCEVKRREKKAQREKGKPSSTT---------NGSPELIMADTPAIKTEPNTTQSHNEKSSANGVKPISPEQEELIHRLVYFQNEYEQPSDEDLKRISNAP----SEGEDQSDLNFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMLRMARRYDVGSDSILFANNQPYTRDSYSLAGMGETVDDLLRFCRQMYGMKVDNAEYALLTAIVIFSERPSLIEGWKVEKIQEIYLEALKVYVDNRRKPRSGTIFAKLLSVLTELRTLGNLNSEMCFSLKLKNKKLPPFLAEIWDV 518          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|939669806|ref|XP_014281743.1| (PREDICTED: ecdysone receptor isoform X1 [Halyomorpha halys])

HSP 1 Score: 429.483 bits (1103), Expect = 1.410e-143
Identity = 222/409 (54.28%), Postives = 273/409 (66.75%), Query Frame = 0
Query:  142 LTPTGAVQQYS-QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISI------------DMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P  ++  +S    +  +KKKGS++R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A            P S  NG   SI +            D    P  ++  KP+ PE+EELI+RLVYFQ EYEHPSE DL R+     ++ N  E +SD+ FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMMLR AR+YDA +DSI++A N P+ +E+Y+ AG+G+  ++L RFCR M  MK                      E  +VEKIQEIY++AL++YV    +      FAKLL VLTELR+LG  NSE+CFSLKL+N+KLPPFL EIWD+
Sbjct:   53 LSPANSLNGFSADSCDGSKKKKGSAARQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEYQCAVKRKEKKAQKDKDK------PVSTTNGSPESIKVEEPHRVVYKTESDTLGRPVPMNGIKPVSPEQEELIHRLVYFQNEYEHPSEEDLRRIVS---NTPNEDEEQSDQRFRHLTEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMLRMARKYDANTDSILFANNQPYNRESYSLAGMGDVIEDLLRFCRHMYNMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYLEALKSYVDNRSRPRSPAIFAKLLSVLTELRTLGNQNSEMCFSLKLQNKKLPPFLAEIWDV 452          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|939669809|ref|XP_014281744.1| (PREDICTED: ecdysone receptor isoform X2 [Halyomorpha halys])

HSP 1 Score: 429.098 bits (1102), Expect = 1.730e-143
Identity = 222/409 (54.28%), Postives = 273/409 (66.75%), Query Frame = 0
Query:  142 LTPTGAVQQYS-QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISI------------DMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P  ++  +S    +  +KKKGS++R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A            P S  NG   SI +            D    P  ++  KP+ PE+EELI+RLVYFQ EYEHPSE DL R+     ++ N  E +SD+ FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMMLR AR+YDA +DSI++A N P+ +E+Y+ AG+G+  ++L RFCR M  MK                      E  +VEKIQEIY++AL++YV    +      FAKLL VLTELR+LG  NSE+CFSLKL+N+KLPPFL EIWD+
Sbjct:   53 LSPANSLNGFSADSCDGSKKKKGSAARQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEYQCAVKRKEKKAQKDKDK------PVSTTNGSPESIKVEEPHRVVYKTESDTLGRPVPMNGIKPVSPEQEELIHRLVYFQNEYEHPSEEDLRRI-----NTPNEDEEQSDQRFRHLTEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMLRMARKYDANTDSILFANNQPYNRESYSLAGMGDVIEDLLRFCRHMYNMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYLEALKSYVDNRSRPRSPAIFAKLLSVLTELRTLGNQNSEMCFSLKLQNKKLPPFLAEIWDV 450          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|952543055|gb|ALO17612.1| (ecysone receptor isoform A [Schistocerca gregaria])

HSP 1 Score: 431.409 bits (1108), Expect = 3.460e-143
Identity = 253/521 (48.56%), Postives = 305/521 (58.54%), Query Frame = 0
Query:   31 PDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSS------PLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGS------ISIDMASFPKR--LSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P + S  ++    P  +  +FA A SSP      +  L  + +S+ GS + PSP        PHP           L    +       L N   SP S      P   G +     L+P  ++  YS    + +KKKG++ R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC   GMR ECVVPE  C  KR+ K A           D    N+  NGS        ID    P+R   +  KP+ PE+EELI+RLVYFQ EYE PSE DL RV   P       E +SD  FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMM R ARRYD  SDSI++A N P+TK++Y  AG+G   +++ RFCR M  MK                      E  +VEKIQEIY++AL+AYV   R+      FAKLL VLTELR+LG  NSE+CFSLKLKN+KLPPFL EIWD+
Sbjct:   42 PASVSDALVVKTEPREAGSLFA-AISSPGPGPAKRARLDSDWLSSPGSNAAPSP-------PPHP-----------LFGGAASAGAPAALPNGYASPLSSGGSYDPYSPGGKIGREDLSPLSSLNGYSADSCDAKKKKGAAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLTVGMRPECVVPEYQCAVKRKEKKAQK---------DKDKPNSTTNGSPEVMMLKDIDAKVEPERPLSNGIKPVSPEQEELIHRLVYFQNEYESPSEEDLRRVTSQPTE----GEDQSDVRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVNSDSILFANNQPYTKDSYNLAGMGETIEDMLRFCRQMYAMKVDNAEYALLTAIVIFSERPSLVEGWKVEKIQEIYLEALKAYVDNRRRPKSGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFLAEIWDV 530          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|1080033213|ref|XP_018560850.1| (PREDICTED: ecdysone receptor isoform X1 [Anoplophora glabripennis])

HSP 1 Score: 432.565 bits (1111), Expect = 4.007e-143
Identity = 228/427 (53.40%), Postives = 277/427 (64.87%), Query Frame = 0
Query:  128 SSPLENGLRHPNAP--------LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSST--------KPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            SSP+ +G   P +P        L+P  ++  YS    + +KKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A            P S  NG    I ++   F  +LS +        KP+ PE+EELI+RLVYFQ EYEHPSE D+ R+ + PM      E + D  FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMM R ARRYD +SDSI++  N P+++++Y  AG+G   ++L  FCR M  MK                      E  +VEKIQEIY++AL+AYV   RK      FAKLL VLTELR+LG  NSE+CFSLKLKN+KLPPFL EIWD++
Sbjct:  151 SSPMSSGSYDPYSPNGKIGREDLSPPSSLNGYSADSCDAKKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEVQCAVKRKEKKAQKEKDK------PNSTTNGSPEMIKLEPEMFFLQLSDSEKTLTNGVKPISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPME----GEDQCDIRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSILFVNNQPYSRDSYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYLEALRAYVDNRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFLAEIWDVD 567          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1296_size49803-snap-gene-0.14 (protein:Tk08819 transcript:maker-scaffold1296_size49803-snap-gene-0.14-mRNA-1 annotation:"nuclear hormone receptor ftz-f1 beta")

HSP 1 Score: 95.1301 bits (235), Expect = 9.169e-21
Identity = 36/76 (47.37%), Postives = 47/76 (61.84%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERT 248
            C VCGD+ SG+HY   +CE CKGFF+R++    NY C     C I +  R+KC ACR  KC  TGM+ E +  +RT
Sbjct:  633 CPVCGDKISGFHYGIFSCESCKGFFKRTVQNKKNYVCLRGAQCPITIATRKKCPACRFDKCLKTGMKLEAIREDRT 708          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold1034_size68570-processed-gene-0.12 (protein:Tk10487 transcript:snap_masked-scaffold1034_size68570-processed-gene-0.12-mRNA-1 annotation:"hypothetical protein YQE_06807 partial")

HSP 1 Score: 89.7373 bits (221), Expect = 1.110e-20
Identity = 38/76 (50.00%), Postives = 48/76 (63.16%), Query Frame = 0
Query:  170 EELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVP 245
            EELC VCGD+ SGYHY  L CE CKGFF+R++     YTC  +  C ID   R++C  CR +KC   GM+ E  +P
Sbjct:  139 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAPLP 214          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold926_size80606-snap-gene-0.9 (protein:Tk09468 transcript:maker-scaffold926_size80606-snap-gene-0.9-mRNA-1 annotation:"tailless-like protein")

HSP 1 Score: 92.8189 bits (229), Expect = 1.212e-20
Identity = 67/246 (27.24%), Postives = 114/246 (46.34%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTC--KWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPER-----------TCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMAS-FPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLN----RVYHVPMHSTNSSESESDR---LFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGAR 397
            C VC D +SG HY   AC+GC GFF+RSI +N  Y C  K  G+C +D   R +C++CRLK+C   GM  E V  ER           T   K + + + +       ++ P ++    + +   D+++ F   +         +E  I R ++   + + PS  ++      +  +P   + +   ES R        +E+    V + V ++KH+P F+ L   DQ+ LL+    E+ +L  A+
Sbjct:    8 CRVCTDHSSGKHYGIFACDGCAGFFKRSIRRNRQYVCKAKIEGNCVVDKTHRNQCRSCRLKRCIMVGMNREAVQHERGPRNSTLRRQMTIFFKEKYQESPSIEKSMQVSISPTTSVGPVSSAFKTDLSTHFHSNVQ-------HQETSIPRYIF---DSQVPSLTNVTNQGANLDCLPETQSVTQTLESMRDNPATWDASEIAARLVFMNVRWTKHVPAFRTLPERDQLTLLEESWRELFVLSAAQ 243          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1404_size42976-snap-gene-0.13 (protein:Tk06750 transcript:maker-scaffold1404_size42976-snap-gene-0.13-mRNA-1 annotation:"orphan nuclear receptor")

HSP 1 Score: 93.2041 bits (230), Expect = 2.218e-20
Identity = 50/121 (41.32%), Postives = 71/121 (58.68%), Query Frame = 0
Query:  163 GSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCK----WNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKN 279
            G+  R  +  C VCGDR+SG HY   +C+GC GFF+RSI ++  YTCK    + G C ID   R +C+ACRLKKC+ + M  + V  ER     R++K     AA   T+  P S+ +G++
Sbjct:    2 GTGDRLLDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRSRVYTCKAQGEFKGRCPIDKTHRNQCRACRLKKCFDSAMNKDAVQHERG---PRKSKLQKELAANGITS--PTSHLSGRS 117          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold421_size176100-snap-gene-0.27 (protein:Tk10558 transcript:maker-scaffold421_size176100-snap-gene-0.27-mRNA-1 annotation:"estrogen related nuclear partial")

HSP 1 Score: 84.7297 bits (208), Expect = 1.425e-19
Identity = 38/75 (50.67%), Postives = 48/75 (64.00%), Query Frame = 0
Query:  174 LVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERT 248
            LVCGD ASG+HY   +CE CK FF+R+I  N  YTC  + +CEI+   R+ CQACR +KC   GM  E V  +R 
Sbjct:    1 LVCGDVASGFHYGVSSCEACKAFFKRTIQGNIEYTCPASNECEINKRRRKACQACRFQKCLRMGMLKEGVRLDRV 75          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1331_size47282-snap-gene-0.8 (protein:Tk00449 transcript:maker-scaffold1331_size47282-snap-gene-0.8-mRNA-1 annotation:"hormone receptor")

HSP 1 Score: 90.8929 bits (224), Expect = 1.585e-19
Identity = 38/82 (46.34%), Postives = 50/82 (60.98%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQ 254
            C VCGD++SG HY  + CEGCKGFFRRS +   NY C    +C +D   R +CQ CRL+KC   GM  + V   R   ++R+
Sbjct:   74 CKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVINYQCPRQKNCTVDRVNRNRCQYCRLQKCLNLGMSRDAVKFGRMSKKQRE 155          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold329_size204955-snap-gene-0.15 (protein:Tk00268 transcript:maker-scaffold329_size204955-snap-gene-0.15-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_311954")

HSP 1 Score: 88.5817 bits (218), Expect = 3.209e-19
Identity = 38/82 (46.34%), Postives = 50/82 (60.98%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQ 254
            C VCGD++SG HY  + CEGCKGFFRRS +   NY C    +C +D   R +CQ CRL+KC   GM  + V   R   ++R+
Sbjct:   45 CKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVINYQCPRQKNCTVDRVNRNRCQYCRLQKCLNLGMSRDAVKFGRMSKKQRE 126          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold267_size230776-snap-gene-1.25 (protein:Tk02974 transcript:maker-scaffold267_size230776-snap-gene-1.25-mRNA-1 annotation:"vitamin d3 receptor b")

HSP 1 Score: 88.9669 bits (219), Expect = 5.359e-19
Identity = 51/163 (31.29%), Postives = 75/163 (46.01%), Query Frame = 0
Query:   99 PPPPTTTTLHQQHSQQNTHYYLNNSGE---SPSSPLENGLRHPNAPL-TPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGY-HYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAK 256
            PP        Q +  +     L+N G     P  P    +  P AP+ TP      Y+        KK   + P   +C VCGD+A  + HY  +AC  C+ FFRRS+ K+ +YTC  N  C +    R+ CQ CR  KC   GM+A  V+ +   +++ + K
Sbjct:   72 PPHELMAYFTQTYGVEGAIKLLHNLGHHYPGPPHPKMEPIYPPTAPVDTPRDLNADYALKERAGDCKKKRRASPKHLMCHVCGDKAPNHCHYGGIACFSCRAFFRRSVPKHRSYTCSSNNQCAVTPATRKNCQKCRFDKCLGAGMKASWVLSDEEKLERLEKK 234          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold491_size156641-snap-gene-0.24 (protein:Tk05482 transcript:maker-scaffold491_size156641-snap-gene-0.24-mRNA-1 annotation:"orphan nuclear receptor")

HSP 1 Score: 87.8113 bits (216), Expect = 1.524e-18
Identity = 33/76 (43.42%), Postives = 47/76 (61.84%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPER 247
            +C++C D+A+G HY  + CEGCKGFF+R++     Y C  +G CEI+   R +CQ CR +KC   GM    V  +R
Sbjct:  194 ICMICEDKATGLHYGIITCEGCKGFFKRTVQNKRIYNCVADGHCEINKAQRNRCQYCRFQKCLHKGMVLAAVREDR 269          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold33_size549341-snap-gene-0.17 (protein:Tk11517 transcript:maker-scaffold33_size549341-snap-gene-0.17-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_106791")

HSP 1 Score: 87.0409 bits (214), Expect = 1.703e-18
Identity = 41/77 (53.25%), Postives = 49/77 (63.64%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCK-WNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPER 247
            LC+VCGD +SG HY  LAC GC GFF+RS+ +   Y C+   G C ID   R +CQACRLKKC   GM  + V  ER
Sbjct:  162 LCIVCGDVSSGKHYGILACNGCSGFFKRSVRRRLIYRCQAGTGTCIIDKAHRNQCQACRLKKCLNMGMNKDAVQNER 238          

HSP 2 Score: 83.5741 bits (205), Expect = 1.986e-17
Identity = 38/68 (55.88%), Postives = 45/68 (66.18%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCK-WNGDCEIDMYMRRKCQACRLKKCYATGM 238
            LC+VCGD +SG HY  LAC GC GFF+RS+ +   Y C+   G C ID   R +CQACRLKKC   GM
Sbjct:   71 LCIVCGDVSSGKHYGILACNGCSGFFKRSVRRRLIYRCQAGTGTCIIDKAHRNQCQACRLKKCLNMGM 138          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000005090 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-5.894e-11845.62symbol:EcR "Ecdysone receptor" species:7227 "Droso... [more]
-3.768e-11546.93symbol:EcR "Ecdysone receptor" species:7102 "Helio... [more]
-2.732e-8137.86symbol:Nr1h3 "Oxysterols receptor LXR-alpha" speci... [more]
-2.934e-8139.38symbol:NR1H3 "Uncharacterized protein" species:961... [more]
-3.135e-8138.52symbol:Nr1h3 "nuclear receptor subfamily 1, group ... [more]
-4.945e-8139.64symbol:LXRA "Uncharacterized protein" species:9823... [more]
-5.381e-8138.52symbol:NR1H3 "Oxysterols receptor LXR-alpha" speci... [more]
-6.240e-8138.52symbol:NR1H3 "Oxysterols receptor LXR-alpha" speci... [more]
-3.175e-8037.62symbol:Nr1h3 "Oxysterols receptor LXR-alpha" speci... [more]
-3.175e-8037.62symbol:Nr1h3 "nuclear receptor subfamily 1, group ... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592844279|gb|GAXK01113265.1|3.810e-2526.45TSA: Calanus finmarchicus comp95139_c2_seq2 transc... [more]
gi|592844280|gb|GAXK01113264.1|3.840e-2526.45TSA: Calanus finmarchicus comp95139_c2_seq1 transc... [more]
gi|592853768|gb|GAXK01103776.1|4.169e-2460.56TSA: Calanus finmarchicus comp167181_c0_seq1 trans... [more]
gi|592874334|gb|GAXK01083228.1|9.736e-2339.37TSA: Calanus finmarchicus comp389578_c0_seq1 trans... [more]
gi|592874006|gb|GAXK01083556.1|1.268e-2243.10TSA: Calanus finmarchicus comp176094_c0_seq1 trans... [more]
gi|592848671|gb|GAXK01108873.1|1.669e-2256.34TSA: Calanus finmarchicus comp297344_c0_seq3 trans... [more]
gi|592848672|gb|GAXK01108872.1|2.270e-2256.34TSA: Calanus finmarchicus comp297344_c0_seq2 trans... [more]
gi|592848673|gb|GAXK01108871.1|2.450e-2256.34TSA: Calanus finmarchicus comp297344_c0_seq1 trans... [more]
gi|592878692|gb|GAXK01079209.1|3.160e-2224.66TSA: Calanus finmarchicus comp267685_c0_seq1 trans... [more]
gi|592814756|gb|GAXK01139812.1|8.878e-2247.06TSA: Calanus finmarchicus comp832560_c0_seq2 trans... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 25
Match NameE-valueIdentityDescription
EMLSAP000000050900.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s269:30685... [more]
EMLSAP000000019192.612e-2625.42pep:novel supercontig:LSalAtl2s:LSalAtl2s132:61643... [more]
EMLSAP000000073616.362e-2628.18pep:novel supercontig:LSalAtl2s:LSalAtl2s418:37435... [more]
EMLSAP000000124865.626e-2539.73pep:novel supercontig:LSalAtl2s:LSalAtl2s91:348479... [more]
EMLSAP000000099411.734e-2426.14pep:novel supercontig:LSalAtl2s:LSalAtl2s649:48408... [more]
EMLSAP000000130041.292e-2324.68pep:novel supercontig:LSalAtl2s:LSalAtl2s98:942409... [more]
EMLSAP000000080715.852e-2227.78pep:novel supercontig:LSalAtl2s:LSalAtl2s47:304551... [more]
EMLSAP000000099691.198e-2128.07pep:novel supercontig:LSalAtl2s:LSalAtl2s651:30270... [more]
EMLSAP000000089027.072e-2150.00pep:novel supercontig:LSalAtl2s:LSalAtl2s554:57230... [more]
EMLSAP000000044518.139e-2126.20pep:novel supercontig:LSalAtl2s:LSalAtl2s231:94591... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|205371750|sp|P49880.2|ECR_AEDAE1.228e-12242.10RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|1706576|sp|P49883.1|ECR_MANSE8.847e-12048.92RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|461984|sp|P34021.1|ECR_DROME1.542e-11945.62RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|146328613|sp|O18531.2|ECR_LUCCU1.693e-11847.11RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|6015050|sp|O18473.1|ECR_HELVI8.147e-11746.93RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|1706574|sp|P49881.1|ECR_BOMMO4.790e-11546.19RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|1706575|sp|P49882.1|ECR_CHITE1.936e-10645.17RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|341942229|sp|Q9Z0Y9.3|NR1H3_MOUSE1.095e-8238.52RecName: Full=Oxysterols receptor LXR-alpha; AltNa... [more]
gi|23503089|sp|Q13133.2|NR1H3_HUMAN1.892e-8238.52RecName: Full=Oxysterols receptor LXR-alpha; AltNa... [more]
gi|75060925|sp|Q5E9B6.1|NR1H3_BOVIN2.197e-8238.52RecName: Full=Oxysterols receptor LXR-alpha; AltNa... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EEB17490.14.222e-14751.07Ecdysone receptor, putative [Pediculus humanus cor... [more]
gb|KYB25531.1|2.163e-14353.32Ecdysone receptor-like Protein [Tribolium castaneu... [more]
gb|KYB25532.1|1.151e-14252.20Ecdysone receptor-like Protein [Tribolium castaneu... [more]
NP_001152827.14.206e-13954.39ecdysone receptor isoform B1 [Apis mellifera][more]
NP_001091685.24.987e-13954.39ecdysone receptor isoform A [Apis mellifera][more]
XP_016768787.15.139e-13954.39PREDICTED: ecdysone receptor isoform X1 [Apis mell... [more]
XP_006568116.15.139e-13954.39PREDICTED: ecdysone receptor isoform X1 [Apis mell... [more]
gb|KFM66857.1|1.493e-13655.21Ecdysone receptor, partial [Stegodyphus mimosarum][more]
gb|EEC03371.1|8.064e-13451.52AamEcRA1, putative [Ixodes scapularis][more]
AAM68346.15.116e-12244.95ecdysone receptor, isoform E [Drosophila melanogas... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|729058610|gb|AIZ04022.1|0.000e+094.59ecdysone receptor, partial [Lepeophtheirus salmoni... [more]
gi|291190960|gb|ADD82902.1|0.000e+057.14ecdysone receptor [Tigriopus japonicus][more]
gi|335355357|gb|AEH43772.1|1.325e-16056.02ecdysone receptor isoform 2 [Amphiascus tenuiremis... [more]
gi|1111332457|gb|APH81342.1|6.560e-15759.03ecdysone receptor [Paracyclopina nana][more]
gi|1110961968|gb|APG80611.1|6.778e-15759.03ecdysone receptor [Paracyclopina nana][more]
gi|242019559|ref|XP_002430228.1|2.066e-14451.07Ecdysone receptor, putative [Pediculus humanus cor... [more]
gi|939669806|ref|XP_014281743.1|1.410e-14354.28PREDICTED: ecdysone receptor isoform X1 [Halyomorp... [more]
gi|939669809|ref|XP_014281744.1|1.730e-14354.28PREDICTED: ecdysone receptor isoform X2 [Halyomorp... [more]
gi|952543055|gb|ALO17612.1|3.460e-14348.56ecysone receptor isoform A [Schistocerca gregaria][more]
gi|1080033213|ref|XP_018560850.1|4.007e-14353.40PREDICTED: ecdysone receptor isoform X1 [Anoplopho... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 25
Match NameE-valueIdentityDescription
maker-scaffold1296_size49803-snap-gene-0.149.169e-2147.37protein:Tk08819 transcript:maker-scaffold1296_size... [more]
snap_masked-scaffold1034_size68570-processed-gene-0.121.110e-2050.00protein:Tk10487 transcript:snap_masked-scaffold103... [more]
maker-scaffold926_size80606-snap-gene-0.91.212e-2027.24protein:Tk09468 transcript:maker-scaffold926_size8... [more]
maker-scaffold1404_size42976-snap-gene-0.132.218e-2041.32protein:Tk06750 transcript:maker-scaffold1404_size... [more]
maker-scaffold421_size176100-snap-gene-0.271.425e-1950.67protein:Tk10558 transcript:maker-scaffold421_size1... [more]
maker-scaffold1331_size47282-snap-gene-0.81.585e-1946.34protein:Tk00449 transcript:maker-scaffold1331_size... [more]
maker-scaffold329_size204955-snap-gene-0.153.209e-1946.34protein:Tk00268 transcript:maker-scaffold329_size2... [more]
maker-scaffold267_size230776-snap-gene-1.255.359e-1931.29protein:Tk02974 transcript:maker-scaffold267_size2... [more]
maker-scaffold491_size156641-snap-gene-0.241.524e-1843.42protein:Tk05482 transcript:maker-scaffold491_size1... [more]
maker-scaffold33_size549341-snap-gene-0.171.703e-1853.25protein:Tk11517 transcript:maker-scaffold33_size54... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s269supercontigLSalAtl2s269:306853..308464 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Descriptionecdysone receptor
Logic nameensemblgenomes
Biotypeprotein_coding
EvidenceIEA
NoteEcdysone receptor
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000005090 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000005090EMLSAT00000005090-700937Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s269:306853..308464-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000005090-687856 ID=EMLSAG00000005090-687856|Name=EMLSAG00000005090|organism=Lepeophtheirus salmonis|type=gene|length=1612bp|location=Sequence derived from alignment at LSalAtl2s269:306853..308464- (Lepeophtheirus salmonis)
ATGTCAACAACTCAATATACGGCTATAATTCAGCCTCGCCCAMCTCACGA TTCRGTGGTYCCTGCCGTTAAACGATTTCGTCCTAATCCTCCAGATAATT CTTCGCCAACTGTTATTGGACTTCCTCCACCGCCTTCCAGTTCGCCAATA TTCGCTAGTGCCTCGTCTTCTCCTTTGATTCACCAACAGCACCAACAATC TCTTTTCATAGAAACTATGAGTAACAATGGGTCTTACTCGACCCCTTCTC CTATACTCTCCGAAATTAAGMCTGAMCCCCATCCTTMCYCCCCGCCMCCT CCGCCAACAACGACGACCCTCCACCAACAGCACTCCCAACAAAATACACA CTATTACCTGAATAACTCGGGAGAAAGTCCCTCTTCTCCATTGGAGAATG GACTGCGACATCCTAATGCTCCTTTAACACCTACTGGAGCTGTTCAGCAG TACTCTCAGATGGTGGAAAATGAGAGGAAAAAGAAAGGATCTTCCTCTCG CCCTGCCGAAGAGTTATGTCTTGTCTGTGGAGATCGAGCATCGGGTTATC ATTATAATGCATTGGCATGTGAGGGATGCAAAGGGTTCTTTCGACGTTCT ATTACCAAAAACTCTAACTATACTTGCAAATGGAATGGGGATTGTGAAAT TGATATGTATATGAGGCGAAAATGTCAGGCGTGTAGACTAAAAAAATGTT ATGCCACGGGTATGAGGGCAGAGTGTGTTGTGCCAGAAAGGACTTGCATT CAGAAAAGACAAGCTAAAGCTGCAGCCGCTGCCGCAGCTSCASCCGACAC AACTGTAGATCCTAAGTCCAATAACAACGGTAAAAATGGAAGCATATCCA TAGATATGGCTTCTTTTCCTAAAAGACTTTCATCCACCAAACCTTTAAAG CCAGAAGAAGAGGAGCTAATTAATCGTTTGGTATATTTTCAAGAAGAATA CGAGCATCCATCTGAAGCGGACCTTAACCGTGTTTACCATGTTCCTATGC ACAGTACTAATTCATCCGAATCCGAGTCTGACCGTTTATTCCGTCATATG ACAGAGATGACTATTCTTACAGTTCAATTAATAGTTGAGTTCTCCAAGCA CCTGCCGGGCTTCCAGAATCTTTGCAGAGACGATCAAATTAATTTACTTA AAGGCTGTTCCTCAGAAGTGATGATGCTGAGGGGAGCCCGTCGTTATGAT GCCGAGTCAGACTCTATTGTTTATGCAACGAACTATCCTTTTACGAAAGA AAATTACGCTAAGGCGGGGCTTGGCAATGACGAGCTCTTTCGTTTCTGCA GGGCCATGTCTCGAATGAAAGTACGATAACGCAGAATACGCTCTCATAAC AGCTATTGTCATTTTTAGTGATAGAAACTCCTTAAAGGAACCTAAAAGAG TTGAAAAGATTCAAGAGATTTATGTAGATGCTCTACAAGCCTACGTAATG GCAAATCGGAAAAAGAATCAAATGGTTACCTTTGCGAAGTTGTTATATGT CCTTACTGAGCTTCGATCCTTAGGGATCAACAACTCAGAACTTTGCTTCT CTCTTAAGCTTAAAAACCGAAAATTGCCCCCATTTCTCATGGAAATTTGG GACATCGAATGA
back to top
Add to Basket