EMLSAG00000005090, EMLSAG00000005090-687856 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000005090
Unique NameEMLSAG00000005090-687856
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
B F18 EcR female
  1. PreAdult2
No eggstrings
-Missing-
12.03.2012 - 10:23
18.04.2014 (All day)
Molecular characterisation of the salmon louse,... more
J F18 EcR female
  1. PreAdult
  2. Adult
-Missing-
-Missing-
27.02.2013 - 15:02
11.03.2013 (All day)
Molecular characterisation of the salmon louse,... more
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: female reproduction, no eggstrings
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
D F39 EcR female
  1. PreAdult2
No eggstring production
female reproduction, no eggstrings
24.08.2012 - 10:39
Molecular characterisation of the salmon louse,... more
Homology
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:nr1h3 "nuclear receptor subfamily 1, group H, member 3" species:7955 "Danio rerio" [GO:0043401 "steroid hormone mediated signaling pathway" evidence=IEA] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;IDA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0006355 "regulation of transcription, DNA-templated" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] [GO:0003677 "DNA binding" evidence=IEA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IDA] [GO:0006366 "transcription from RNA polymerase II promoter" evidence=IDA] [GO:0030522 "intracellular receptor signaling pathway" evidence=IDA] [GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=IDA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0006351 "transcription, DNA-templated" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 ZFIN:ZDB-GENE-050410-7 GO:GO:0005634 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GeneTree:ENSGT00720000108423 InterPro:IPR023257 PRINTS:PR02034 TreeFam:TF352167 OMA:CILREEA EMBL:CABZ01003670 EMBL:CABZ01003671 EMBL:CABZ01003672 EMBL:CABZ01009563 EMBL:CABZ01009564 EMBL:CABZ01009565 EMBL:CABZ01009566 EMBL:CABZ01009567 EMBL:CABZ01072909 ProteinModelPortal:F1QUF4 Ensembl:ENSDART00000123268 Bgee:F1QUF4 Uniprot:F1QUF4)

HSP 1 Score: 263.848 bits (673), Expect = 3.522e-80
Identity = 146/382 (38.22%), Postives = 215/382 (56.28%), Query Frame = 0
Query:  158 ERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            +RKK  +      E+C VCGD+ASG+HYN L+CEGCKGFFRRS+ K + Y+CK +G CE+DMYMRRKCQ CRL+KC   GM  +CV+ E   I+ ++ K      A   T   P         S + +M           PL PE++E+I +LV  Q++    S  D  +V   P      +     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + E+M+L  +RRY+   DSI +  ++ + KE++AKAGL  +    +F F + M+ +                       ++ + VE++Q+ YVDAL +Y+   R  N  + F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   79 KRKKGPAPKMLGNEVCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAQYSCKNSGRCEMDMYMRRKCQQCRLRKCREAGMLEQCVLSEEQ-IRLKKMKKQEEETARTSTVATP---------SPAPEMP----------PLAPEQQEMIEKLVAMQKQCNKRSFIDRPKVTPWPQSQDPQNREVRQQRFAHFTELAIMSVQEIVDFAKQLPGFLELTREDQIALLKTSTIEIMLLETSRRYNPAIDSITFLKDFTYNKEDFAKAGLQLEFINPIFEFSKGMNDLHLDEAEYALLIAINIFSADRPNVQDHELVERLQQPYVDALHSYIRIKR-PNDHLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 439          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:Nr1h2 "nuclear receptor subfamily 1, group H, member 2" species:10090 "Mus musculus" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IMP] [GO:0001133 "sequence-specific transcription regulatory region DNA binding RNA polymerase II transcription factor recruiting transcription factor activity" evidence=ISO] [GO:0003677 "DNA binding" evidence=IDA] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IGI;IDA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IDA] [GO:0005515 "protein binding" evidence=IPI] [GO:0005634 "nucleus" evidence=ISO;IDA] [GO:0005737 "cytoplasm" evidence=ISO] [GO:0006351 "transcription, DNA-templated" evidence=IEA] [GO:0006355 "regulation of transcription, DNA-templated" evidence=IDA] [GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=IGI] [GO:0006366 "transcription from RNA polymerase II promoter" evidence=IDA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0010628 "positive regulation of gene expression" evidence=ISO] [GO:0010629 "negative regulation of gene expression" evidence=ISO] [GO:0010867 "positive regulation of triglyceride biosynthetic process" evidence=ISO] [GO:0010875 "positive regulation of cholesterol efflux" evidence=IGI;ISO;IDA] [GO:0010884 "positive regulation of lipid storage" evidence=IMP] [GO:0010887 "negative regulation of cholesterol storage" evidence=ISO] [GO:0030522 "intracellular receptor signaling pathway" evidence=IDA] [GO:0032270 "positive regulation of cellular protein metabolic process" evidence=ISO] [GO:0032369 "negative regulation of lipid transport" evidence=ISO] [GO:0032376 "positive regulation of cholesterol transport" evidence=ISO] [GO:0042632 "cholesterol homeostasis" evidence=IDA] [GO:0043401 "steroid hormone mediated signaling pathway" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=ISO] [GO:0044255 "cellular lipid metabolic process" evidence=IDA] [GO:0045723 "positive regulation of fatty acid biosynthetic process" evidence=ISO] [GO:0045861 "negative regulation of proteolysis" evidence=IMP] [GO:0045892 "negative regulation of transcription, DNA-templated" evidence=ISO] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=ISO;IDA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0046965 "retinoid X receptor binding" evidence=ISO;IDA] [GO:0048384 "retinoic acid receptor signaling pathway" evidence=ISO] [GO:0048550 "negative regulation of pinocytosis" evidence=ISO] [GO:0051006 "positive regulation of lipoprotein lipase activity" evidence=ISO] [GO:0055088 "lipid homeostasis" evidence=IMP] [GO:0090108 "positive regulation of high-density lipoprotein particle assembly" evidence=IDA] [GO:0090187 "positive regulation of pancreatic juice secretion" evidence=IMP] [GO:0090340 "positive regulation of secretion of lysosomal enzymes" evidence=IMP] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 MGI:MGI:1352463 GO:GO:0005634 GO:GO:0005737 GO:GO:0003677 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 GO:GO:0045861 GO:GO:0044255 GO:GO:0042632 GO:GO:0010887 GO:GO:0010875 GO:GO:0000122 GO:GO:0051006 GO:GO:0010867 GO:GO:0032270 GO:GO:0048384 GO:GO:0045723 GO:GO:0046965 GO:GO:0048550 GO:GO:0010884 GO:GO:0001133 eggNOG:NOG285805 GeneTree:ENSGT00720000108423 OrthoDB:EOG7DC25S GO:GO:0032369 CTD:7376 HOVERGEN:HBG108655 KO:K08535 InterPro:IPR023257 PRINTS:PR02034 HOGENOM:HOG000220845 OMA:RRYACRG ChiTaRS:NR1H2 GO:GO:0090108 GO:GO:0090187 GO:GO:0090340 EMBL:U09419 EMBL:AJ132602 EMBL:BC066025 PIR:I49021 RefSeq:NP_001272446.1 RefSeq:NP_001272447.1 RefSeq:NP_001272448.1 RefSeq:NP_033499.1 RefSeq:XP_006540867.1 UniGene:Mm.968 ProteinModelPortal:Q60644 SMR:Q60644 BioGrid:204450 DIP:DIP-444N IntAct:Q60644 STRING:10090.ENSMUSP00000103545 PhosphoSite:Q60644 PRIDE:Q60644 Ensembl:ENSMUST00000073488 Ensembl:ENSMUST00000107912 Ensembl:ENSMUST00000167197 GeneID:22260 KEGG:mmu:22260 UCSC:uc009gpz.1 InParanoid:Q60644 NextBio:302353 PRO:PR:Q60644 ArrayExpress:Q60644 Bgee:Q60644 CleanEx:MM_NR1H2 Genevestigator:Q60644 Uniprot:Q60644)

HSP 1 Score: 258.07 bits (658), Expect = 6.670e-78
Identity = 144/400 (36.00%), Postives = 218/400 (54.50%), Query Frame = 0
Query:  156 ENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNS--NYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQ--------------AKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            E +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+       Y C+ +G C++D +MRRKCQ CRL+KC   GMR +CV+ E    +KR               A +++   A    T +  S  +G+   I +  A               +E +I +LV  Q +    S +D  +V   P+ +   S     + F H TE+ I++VQ IV+F+K +PGF  L R+DQI LLK  + E+M+L  ARRY+ E++ I +  ++ ++K+++ +AGL  +    +F F RAM R+                       +EP RVE +Q+ YV+AL +Y    R ++Q+  F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   61 ERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSGTCQMDAFMRRKCQLCRLRKCKEAGMREQCVLSEEQIRKKRIQKQQQQQPPPPSEPAASSSGRPAASPGTSEASSQGSGEGEGIQLTAA---------------QELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPSRVEALQQPYVEALLSYTRIKRPQDQL-RFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 444          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:Nr1h2 "Oxysterols receptor LXR-beta" species:10116 "Rattus norvegicus" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0010867 "positive regulation of triglyceride biosynthetic process" evidence=IEA] [GO:0010875 "positive regulation of cholesterol efflux" evidence=IEA] [GO:0010884 "positive regulation of lipid storage" evidence=IEA] [GO:0010887 "negative regulation of cholesterol storage" evidence=IEA] [GO:0032270 "positive regulation of cellular protein metabolic process" evidence=IEA] [GO:0032369 "negative regulation of lipid transport" evidence=IEA] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0044255 "cellular lipid metabolic process" evidence=IEA] [GO:0045723 "positive regulation of fatty acid biosynthetic process" evidence=IEA] [GO:0045861 "negative regulation of proteolysis" evidence=IEA] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0048550 "negative regulation of pinocytosis" evidence=IEA] [GO:0051006 "positive regulation of lipoprotein lipase activity" evidence=IEA] [GO:0090108 "positive regulation of high-density lipoprotein particle assembly" evidence=IEA] [GO:0090187 "positive regulation of pancreatic juice secretion" evidence=IEA] [GO:0090340 "positive regulation of secretion of lysosomal enzymes" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 RGD:61906 GO:GO:0005634 GO:GO:0005737 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 GO:GO:0045861 GO:GO:0010628 GO:GO:0044255 GO:GO:0042632 GO:GO:0010887 GO:GO:0010875 GO:GO:0000122 GO:GO:0051006 GO:GO:0006366 GO:GO:0010867 GO:GO:0010629 GO:GO:0032270 GO:GO:0048384 GO:GO:0045723 GO:GO:0046965 GO:GO:0048550 GO:GO:0010884 GO:GO:0001133 eggNOG:NOG285805 GeneTree:ENSGT00720000108423 OrthoDB:EOG7DC25S GO:GO:0032369 CTD:7376 HOVERGEN:HBG108655 KO:K08535 InterPro:IPR023257 PRINTS:PR02034 HOGENOM:HOG000220845 OMA:RRYACRG TreeFam:TF352167 GO:GO:0090108 GO:GO:0090187 GO:GO:0090340 EMBL:U20389 EMBL:U14533 PIR:I59354 RefSeq:NP_113814.1 UniGene:Rn.786 ProteinModelPortal:Q62755 SMR:Q62755 PhosphoSite:Q62755 PaxDb:Q62755 Ensembl:ENSRNOT00000026862 GeneID:58851 KEGG:rno:58851 UCSC:RGD:61906 InParanoid:Q62755 NextBio:611431 PRO:PR:Q62755 ArrayExpress:Q62755 Genevestigator:Q62755 Uniprot:Q62755)

HSP 1 Score: 257.684 bits (657), Expect = 8.323e-78
Identity = 144/400 (36.00%), Postives = 218/400 (54.50%), Query Frame = 0
Query:  156 ENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNS--NYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQ--------------AKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            E +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+       Y C+ +G C++D +MRRKCQ CRL+KC   GMR +CV+ E    +K+               A  ++A  A    T +  S  +G+   I +  A               +E +I +LV  Q +    S +D  +V   P+ +   S     + F H TE+ I++VQ IV+F+K +PGF  L R+DQI LLK  + E+M+L  ARRY+ E++ I +  ++ ++K+++ +AGL  +    +F F RAM R+                       +EP RVE +Q+ YV+AL +Y    R ++Q+  F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   61 ERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSGTCQMDAFMRRKCQLCRLRKCKEAGMREQCVLSEEQIRKKKIQKQQQQQPPPPTEPASGSSARPAASPGTSEASSQGSGEGEGIQLTAA---------------QELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPSRVEALQQPYVEALLSYTRIKRPQDQL-RFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 444          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:Nr1h2 "nuclear receptor subfamily 1, group H, member 2" species:10116 "Rattus norvegicus" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA;ISO] [GO:0001133 "sequence-specific transcription regulatory region DNA binding RNA polymerase II transcription factor recruiting transcription factor activity" evidence=IDA] [GO:0003677 "DNA binding" evidence=ISO] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISO] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IEA;ISO] [GO:0005515 "protein binding" evidence=IPI] [GO:0005634 "nucleus" evidence=IEA;ISO] [GO:0005737 "cytoplasm" evidence=IEA;ISO] [GO:0006355 "regulation of transcription, DNA-templated" evidence=ISO] [GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=ISO] [GO:0006366 "transcription from RNA polymerase II promoter" evidence=ISO] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0010628 "positive regulation of gene expression" evidence=IDA] [GO:0010629 "negative regulation of gene expression" evidence=IDA] [GO:0010867 "positive regulation of triglyceride biosynthetic process" evidence=IEA;ISO] [GO:0010875 "positive regulation of cholesterol efflux" evidence=IEA;ISO] [GO:0010884 "positive regulation of lipid storage" evidence=IEA;ISO] [GO:0010887 "negative regulation of cholesterol storage" evidence=IEA;ISO] [GO:0030522 "intracellular receptor signaling pathway" evidence=ISO] [GO:0032270 "positive regulation of cellular protein metabolic process" evidence=IEA;ISO] [GO:0032369 "negative regulation of lipid transport" evidence=IEA;ISO] [GO:0032376 "positive regulation of cholesterol transport" evidence=ISO] [GO:0042632 "cholesterol homeostasis" evidence=IEA;ISO] [GO:0044255 "cellular lipid metabolic process" evidence=IEA;ISO] [GO:0045723 "positive regulation of fatty acid biosynthetic process" evidence=IEA;ISO] [GO:0045861 "negative regulation of proteolysis" evidence=IEA;ISO] [GO:0045892 "negative regulation of transcription, DNA-templated" evidence=ISO] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA;ISO] [GO:0046965 "retinoid X receptor binding" evidence=ISO;IDA;IPI] [GO:0048384 "retinoic acid receptor signaling pathway" evidence=IDA] [GO:0048550 "negative regulation of pinocytosis" evidence=IEA;ISO] [GO:0051006 "positive regulation of lipoprotein lipase activity" evidence=IEA;ISO] [GO:0055088 "lipid homeostasis" evidence=ISO] [GO:0090108 "positive regulation of high-density lipoprotein particle assembly" evidence=IEA;ISO] [GO:0090187 "positive regulation of pancreatic juice secretion" evidence=IEA;ISO] [GO:0090340 "positive regulation of secretion of lysosomal enzymes" evidence=IEA;ISO] [GO:2000188 "regulation of cholesterol homeostasis" evidence=ISS] [GO:0043565 "sequence-specific DNA binding" evidence=IDA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 RGD:61906 GO:GO:0005634 GO:GO:0005737 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 GO:GO:0045861 GO:GO:0010628 GO:GO:0044255 GO:GO:0042632 GO:GO:0010887 GO:GO:0010875 GO:GO:0000122 GO:GO:0051006 GO:GO:0006366 GO:GO:0010867 GO:GO:0010629 GO:GO:0032270 GO:GO:0048384 GO:GO:0045723 GO:GO:0046965 GO:GO:0048550 GO:GO:0010884 GO:GO:0001133 eggNOG:NOG285805 GeneTree:ENSGT00720000108423 OrthoDB:EOG7DC25S GO:GO:0032369 CTD:7376 HOVERGEN:HBG108655 KO:K08535 InterPro:IPR023257 PRINTS:PR02034 HOGENOM:HOG000220845 OMA:RRYACRG TreeFam:TF352167 GO:GO:0090108 GO:GO:0090187 GO:GO:0090340 EMBL:U20389 EMBL:U14533 PIR:I59354 RefSeq:NP_113814.1 UniGene:Rn.786 ProteinModelPortal:Q62755 SMR:Q62755 PhosphoSite:Q62755 PaxDb:Q62755 Ensembl:ENSRNOT00000026862 GeneID:58851 KEGG:rno:58851 UCSC:RGD:61906 InParanoid:Q62755 NextBio:611431 PRO:PR:Q62755 ArrayExpress:Q62755 Genevestigator:Q62755 Uniprot:Q62755)

HSP 1 Score: 257.684 bits (657), Expect = 8.323e-78
Identity = 144/400 (36.00%), Postives = 218/400 (54.50%), Query Frame = 0
Query:  156 ENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNS--NYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQ--------------AKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            E +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+       Y C+ +G C++D +MRRKCQ CRL+KC   GMR +CV+ E    +K+               A  ++A  A    T +  S  +G+   I +  A               +E +I +LV  Q +    S +D  +V   P+ +   S     + F H TE+ I++VQ IV+F+K +PGF  L R+DQI LLK  + E+M+L  ARRY+ E++ I +  ++ ++K+++ +AGL  +    +F F RAM R+                       +EP RVE +Q+ YV+AL +Y    R ++Q+  F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   61 ERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSGTCQMDAFMRRKCQLCRLRKCKEAGMREQCVLSEEQIRKKKIQKQQQQQPPPPTEPASGSSARPAASPGTSEASSQGSGEGEGIQLTAA---------------QELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPSRVEALQQPYVEALLSYTRIKRPQDQL-RFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 444          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:NR1H2 "Oxysterols receptor LXR-beta" species:9606 "Homo sapiens" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0001133 "sequence-specific transcription regulatory region DNA binding RNA polymerase II transcription factor recruiting transcription factor activity" evidence=IEA] [GO:0003677 "DNA binding" evidence=TAS] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IEA] [GO:0005515 "protein binding" evidence=IPI] [GO:0005634 "nucleus" evidence=IDA] [GO:0005654 "nucleoplasm" evidence=TAS] [GO:0005737 "cytoplasm" evidence=IDA] [GO:0006367 "transcription initiation from RNA polymerase II promoter" evidence=TAS] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0010467 "gene expression" evidence=TAS] [GO:0010745 "negative regulation of macrophage derived foam cell differentiation" evidence=IC] [GO:0010867 "positive regulation of triglyceride biosynthetic process" evidence=IMP] [GO:0010875 "positive regulation of cholesterol efflux" evidence=IMP] [GO:0010884 "positive regulation of lipid storage" evidence=IEA] [GO:0010887 "negative regulation of cholesterol storage" evidence=IMP] [GO:0032270 "positive regulation of cellular protein metabolic process" evidence=IMP] [GO:0032369 "negative regulation of lipid transport" evidence=IMP] [GO:0032376 "positive regulation of cholesterol transport" evidence=IDA] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] [GO:0044255 "cellular lipid metabolic process" evidence=IEA] [GO:0045723 "positive regulation of fatty acid biosynthetic process" evidence=IMP] [GO:0045861 "negative regulation of proteolysis" evidence=IEA] [GO:0045892 "negative regulation of transcription, DNA-templated" evidence=IDA] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP;IDA] [GO:0046965 "retinoid X receptor binding" evidence=IEA] [GO:0048384 "retinoic acid receptor signaling pathway" evidence=IEA] [GO:0048550 "negative regulation of pinocytosis" evidence=IMP] [GO:0051006 "positive regulation of lipoprotein lipase activity" evidence=IMP] [GO:0060336 "negative regulation of interferon-gamma-mediated signaling pathway" evidence=NAS] [GO:0090108 "positive regulation of high-density lipoprotein particle assembly" evidence=IEA] [GO:0090187 "positive regulation of pancreatic juice secretion" evidence=IEA] [GO:0090340 "positive regulation of secretion of lysosomal enzymes" evidence=IEA] [GO:2000188 "regulation of cholesterol homeostasis" evidence=ISS] Reactome:REACT_71 InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0005737 GO:GO:0045892 GO:GO:0005654 GO:GO:0003677 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 GO:GO:0045861 GO:GO:0044255 GO:GO:0042632 GO:GO:0010887 GO:GO:0010745 GO:GO:0010875 GO:GO:0000122 GO:GO:0051006 GO:GO:0010867 GO:GO:0032270 GO:GO:0048384 GO:GO:0006367 GO:GO:0045723 GO:GO:0048550 GO:GO:0010884 GO:GO:0001133 GO:GO:0060336 eggNOG:NOG285805 GO:GO:0032369 EMBL:AC008655 PDB:1P8D PDB:4DK7 PDB:4DK8 PDBsum:1P8D PDBsum:4DK7 PDBsum:4DK8 PDB:3L0E PDBsum:3L0E CTD:7376 HOVERGEN:HBG108655 KO:K08535 InterPro:IPR023257 PRINTS:PR02034 EMBL:U07132 EMBL:AK290855 EMBL:AK297978 EMBL:BC007790 EMBL:BC033500 EMBL:BC047750 EMBL:BC074500 EMBL:U14534 PIR:JC4014 RefSeq:NP_001243576.1 RefSeq:NP_009052.3 RefSeq:XP_005259252.1 UniGene:Hs.432976 PDB:1PQ6 PDB:1PQ9 PDB:1PQC PDB:1UPV PDB:1UPW PDB:3KFC PDBsum:1PQ6 PDBsum:1PQ9 PDBsum:1PQC PDBsum:1UPV PDBsum:1UPW PDBsum:3KFC ProteinModelPortal:P55055 SMR:P55055 BioGrid:113222 DIP:DIP-53004N IntAct:P55055 MINT:MINT-1444220 STRING:9606.ENSP00000253727 BindingDB:P55055 ChEMBL:CHEMBL4093 GuidetoPHARMACOLOGY:601 PhosphoSite:P55055 DMDM:296439251 PaxDb:P55055 PRIDE:P55055 DNASU:7376 Ensembl:ENST00000253727 Ensembl:ENST00000411902 Ensembl:ENST00000593926 GeneID:7376 KEGG:hsa:7376 GeneCards:GC19P050879 HGNC:HGNC:7965 HPA:HPA056838 MIM:600380 neXtProt:NX_P55055 PharmGKB:PA31750 HOGENOM:HOG000220845 InParanoid:P55055 OMA:RRYACRG PhylomeDB:P55055 TreeFam:TF352167 SignaLink:P55055 ChiTaRS:NR1H2 EvolutionaryTrace:P55055 GeneWiki:Liver_X_receptor_beta GenomeRNAi:7376 NextBio:28886 PRO:PR:P55055 ArrayExpress:P55055 Bgee:P55055 CleanEx:HS_NR1H2 Genevestigator:P55055 GO:GO:0090108 GO:GO:0090187 GO:GO:0090340 Uniprot:P55055)

HSP 1 Score: 257.684 bits (657), Expect = 1.348e-77
Identity = 142/390 (36.41%), Postives = 220/390 (56.41%), Query Frame = 0
Query:  156 ENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNS--NYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISI----DMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            E +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ +     Y C+  G C++D +MRRKCQ CRL+KC   GMR +CV+ E    +K+  K    + +   + V P+ +++  +G  +     +  S          L   +E +I +LV  Q +    S +D  +V   P+ +   S     + F H TE+ I++VQ IV+F+K +PGF  L R+DQI LLK  + E+M+L  ARRY+ E++ I +  ++ ++K+++ +AGL  +    +F F RAM R+                       +EP RVE +Q+ YV+AL +Y    R ++Q+  F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   70 ERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQSQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQL-RFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 458          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:NR1H2 "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0010867 "positive regulation of triglyceride biosynthetic process" evidence=IEA] [GO:0010875 "positive regulation of cholesterol efflux" evidence=IEA] [GO:0010884 "positive regulation of lipid storage" evidence=IEA] [GO:0010887 "negative regulation of cholesterol storage" evidence=IEA] [GO:0032270 "positive regulation of cellular protein metabolic process" evidence=IEA] [GO:0032369 "negative regulation of lipid transport" evidence=IEA] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] [GO:0044255 "cellular lipid metabolic process" evidence=IEA] [GO:0045723 "positive regulation of fatty acid biosynthetic process" evidence=IEA] [GO:0045861 "negative regulation of proteolysis" evidence=IEA] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0046965 "retinoid X receptor binding" evidence=IEA] [GO:0048550 "negative regulation of pinocytosis" evidence=IEA] [GO:0051006 "positive regulation of lipoprotein lipase activity" evidence=IEA] [GO:0090108 "positive regulation of high-density lipoprotein particle assembly" evidence=IEA] [GO:0090187 "positive regulation of pancreatic juice secretion" evidence=IEA] [GO:0090340 "positive regulation of secretion of lysosomal enzymes" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0005634 GO:GO:0005737 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 GO:GO:0045861 GO:GO:0044255 GO:GO:0042632 GO:GO:0010887 GO:GO:0010875 GO:GO:0000122 GO:GO:0051006 GO:GO:0006366 GO:GO:0010867 GO:GO:0032270 GO:GO:0030522 GO:GO:0045723 GO:GO:0048550 GO:GO:0010884 GeneTree:ENSGT00720000108423 OrthoDB:EOG7DC25S GO:GO:0032369 KO:K08535 InterPro:IPR023257 PRINTS:PR02034 OMA:RRYACRG TreeFam:TF352167 GO:GO:0090108 GO:GO:0090187 GO:GO:0090340 EMBL:FP102476 RefSeq:XP_005664839.1 Ensembl:ENSSSCT00000003566 GeneID:100525290 Uniprot:F1RH38)

HSP 1 Score: 254.218 bits (648), Expect = 2.063e-76
Identity = 143/390 (36.67%), Postives = 216/390 (55.38%), Query Frame = 0
Query:  156 ENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNS--NYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKP----LKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            E +RKK  +     +ELC VCGD ASG+HYN L+CEGCKGFFRRS+ +     Y C+  G C++D +MRRKCQ CRL+KC   GMR +CV+ +    +K+  K           T  P  ++   +G  +    S      S +     L   +E +I +LV  Q +    S +D  +V   P+ +   S     + F H TE+ I++VQ IV+F+K +PGF  L R+DQI LLK  + E+M+L  ARRY+ E++ I +  ++ ++K+++ +AGL  +    +F F RAM R+                       +EP RVE +Q+ YVDAL +Y    R ++Q+  F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   69 ERKRKKGPAPKMLGDELCQVCGDTASGFHYNVLSCEGCKGFFRRSVIRGGAGRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSKEQIRKKKIRKQQQQQQQQSSPTA-PGVSSGSASGPGASPGGSDGGGQGSGEGEGIQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPSRVEALQQPYVDALLSYTRIKRPQDQL-RFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 456          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:NR1H2 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0010867 "positive regulation of triglyceride biosynthetic process" evidence=IEA] [GO:0010875 "positive regulation of cholesterol efflux" evidence=IEA] [GO:0010884 "positive regulation of lipid storage" evidence=IEA] [GO:0010887 "negative regulation of cholesterol storage" evidence=IEA] [GO:0032270 "positive regulation of cellular protein metabolic process" evidence=IEA] [GO:0032369 "negative regulation of lipid transport" evidence=IEA] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] [GO:0044255 "cellular lipid metabolic process" evidence=IEA] [GO:0045723 "positive regulation of fatty acid biosynthetic process" evidence=IEA] [GO:0045861 "negative regulation of proteolysis" evidence=IEA] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0046965 "retinoid X receptor binding" evidence=IEA] [GO:0048550 "negative regulation of pinocytosis" evidence=IEA] [GO:0051006 "positive regulation of lipoprotein lipase activity" evidence=IEA] [GO:0090108 "positive regulation of high-density lipoprotein particle assembly" evidence=IEA] [GO:0090187 "positive regulation of pancreatic juice secretion" evidence=IEA] [GO:0090340 "positive regulation of secretion of lysosomal enzymes" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0005634 GO:GO:0005737 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 GO:GO:0045861 GO:GO:0044255 GO:GO:0042632 GO:GO:0010887 GO:GO:0010875 GO:GO:0000122 GO:GO:0051006 GO:GO:0006366 GO:GO:0010867 GO:GO:0032270 GO:GO:0030522 GO:GO:0045723 GO:GO:0048550 GO:GO:0010884 GeneTree:ENSGT00720000108423 GO:GO:0032369 InterPro:IPR023257 PRINTS:PR02034 OMA:RRYACRG TreeFam:TF352167 GO:GO:0090108 GO:GO:0090187 GO:GO:0090340 EMBL:AAEX03000791 Ensembl:ENSCAFT00000005346 Uniprot:F6XDJ5)

HSP 1 Score: 253.832 bits (647), Expect = 2.999e-76
Identity = 149/427 (34.89%), Postives = 224/427 (52.46%), Query Frame = 0
Query:  120 LNNSGESPSSPLENGLRHP--NAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNS--NYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNG---KNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L  SG  P  P  +  R     AP+ P  A +      E +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ +     Y C+  G C++D +MRRKCQ CRL+KC   GMR +CV+ E     +++            + V P  ++            D             L   +E +I +LV  Q +    S +D  +V   P+ +   S     + F H TE+ I++VQ IV+F+K +PGF  L R+DQI LLK  + E+M+L  ARRY+ E++ I +  ++ ++K+++ +AGL  +    +F F RAM R+                       +EP RVE +Q+ YV+AL +Y    R ++Q+  F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   37 LWPSGPDPDVPGSDWARSACSGAPVVPDPAEEP-----ERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQ--IRKKKIRKQQQQQQQQSPVGPMGSSTACGPGASPGGSDGGGQGSGEGEGIQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPSRVEALQQPYVEALLSYTRIKRPQDQL-RFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 455          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:LXR "Liver X receptor" species:9031 "Gallus gallus" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0000790 "nuclear chromatin" evidence=IEA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0010867 "positive regulation of triglyceride biosynthetic process" evidence=IEA] [GO:0010870 "positive regulation of receptor biosynthetic process" evidence=IEA] [GO:0010875 "positive regulation of cholesterol efflux" evidence=IEA] [GO:0010887 "negative regulation of cholesterol storage" evidence=IEA] [GO:0032270 "positive regulation of cellular protein metabolic process" evidence=IEA] [GO:0032369 "negative regulation of lipid transport" evidence=IEA] [GO:0032570 "response to progesterone" evidence=IEA] [GO:0032810 "sterol response element binding" evidence=IEA] [GO:0034145 "positive regulation of toll-like receptor 4 signaling pathway" evidence=IEA] [GO:0035326 "enhancer binding" evidence=IDA] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0043031 "negative regulation of macrophage activation" evidence=IEA] [GO:0043277 "apoptotic cell clearance" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IDA] [GO:0044255 "cellular lipid metabolic process" evidence=IEA] [GO:0045723 "positive regulation of fatty acid biosynthetic process" evidence=IEA] [GO:0045861 "negative regulation of proteolysis" evidence=IEA] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA] [GO:0048550 "negative regulation of pinocytosis" evidence=IEA] [GO:0050728 "negative regulation of inflammatory response" evidence=IEA] [GO:0051006 "positive regulation of lipoprotein lipase activity" evidence=IEA] [GO:0070328 "triglyceride homeostasis" evidence=IEA] [GO:0071222 "cellular response to lipopolysaccharide" evidence=IEA] [GO:0090188 "negative regulation of pancreatic juice secretion" evidence=IEA] [GO:0090341 "negative regulation of secretion of lysosomal enzymes" evidence=IEA] [GO:2000189 "positive regulation of cholesterol homeostasis" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0050728 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 GO:GO:0045861 GO:GO:0044255 GO:GO:0071222 GO:GO:0042632 GO:GO:0010887 GO:GO:0010875 GO:GO:0000122 GO:GO:0051006 GO:GO:0000790 GO:GO:0006366 GO:GO:2000189 GO:GO:0070328 GO:GO:0010867 GO:GO:0032570 GO:GO:0032270 GO:GO:0045723 GO:GO:0043031 GO:GO:0043277 GO:GO:0048550 GeneTree:ENSGT00720000108423 OrthoDB:EOG7DC25S GO:GO:0010870 GO:GO:0035326 GO:GO:0032369 GO:GO:0034145 HOVERGEN:HBG108655 InterPro:IPR023257 PRINTS:PR02034 TreeFam:TF352167 CTD:10062 KO:K08536 OMA:CILREEA GO:GO:0032810 GO:GO:0090188 GO:GO:0090341 EMBL:AADN03004615 EMBL:AF492498 EMBL:AJ851708 RefSeq:NP_989873.1 UniGene:Gga.4130 ProteinModelPortal:Q8JHU1 SMR:Q8JHU1 Ensembl:ENSGALT00000013356 GeneID:395221 KEGG:gga:395221 InParanoid:Q8JHU1 NextBio:20815310 PRO:PR:Q8JHU1 ArrayExpress:Q8JHU1 Uniprot:Q8JHU1)

HSP 1 Score: 249.595 bits (636), Expect = 3.298e-75
Identity = 146/383 (38.12%), Postives = 214/383 (55.87%), Query Frame = 0
Query:  158 ERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVP-MHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            +RKK  +      E+C VCGD+ASG+HYN L+CEGCKGFFRRS+ K + Y CK  G CE+DMYMRRKCQ CRL+KC   GMR + V+ E     K+  K     A     TV              +   + P+  S +  L PE+  +I +LV  Q++    S  D  +V   P +   N+ E+   R F H TE+ I++VQ IV+F+K LPGF+ L R+DQI LLK  + EVM+L  +RRY+ E +SI +  +  + ++++AKAGL  +    +F F + M+ +                       ++   VE++Q  YV+AL +Y+  NR  N  + F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   45 KRKKGPAPKMLGNEVCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAQYVCKNGGKCEMDMYMRRKCQECRLRKCQEAGMREQYVLSEEQIRLKKLKKQEDDQA----RTV--------------VVRPNPPQPPSPSHQLTPEQLNMIEKLVAAQQQCNQRSFTDRLKVTPWPQVPDPNNREARQQR-FAHFTELAIISVQEIVDFAKQLPGFRELTREDQIALLKTSTIEVMLLETSRRYNPEIESITFLKDLSYNRDDFAKAGLQFEFINPIFEFSKGMNELQLNDAEYALLIAINIFSADRPNVQDQSLVERLQHTYVEALHSYICINR-PNDHLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 407          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:NR1H2 "Oxysterols receptor LXR-beta" species:9913 "Bos taurus" [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0006351 "transcription, DNA-templated" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] [GO:2000188 "regulation of cholesterol homeostasis" evidence=ISS] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0005634 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0003700 GO:GO:0006351 eggNOG:NOG285805 EMBL:BT021148 EMBL:BC109925 RefSeq:XP_005219286.1 UniGene:Bt.44371 ProteinModelPortal:Q5BIS6 SMR:Q5BIS6 STRING:9913.ENSBTAP00000004229 PRIDE:Q5BIS6 GeneID:509622 KEGG:bta:509622 CTD:7376 HOVERGEN:HBG108655 InParanoid:Q5BIS6 KO:K08535 InterPro:IPR023257 PRINTS:PR02034 Uniprot:Q5BIS6)

HSP 1 Score: 248.44 bits (633), Expect = 3.301e-74
Identity = 143/390 (36.67%), Postives = 217/390 (55.64%), Query Frame = 0
Query:  156 ENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNS--NYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKP----LKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            E +RKK  +     +ELC VCGD ASG+HYN L+CEGCKGFFRRS+ +     Y C+  G C++D +MRRKCQ CRL+KC   GMR +CV+ +    +K+  K           T    S+++  +G  +    S      S +     L   +E +I +LV  Q +    S +D  +V   P+ +   S     + F H TE+ I++VQ IV+F+K +PGF  L R+DQI LLK  + E+M+L  ARRY+ E++ I +  ++ ++K+++ +AGL  +    +F F RAM R+                       +EP RVE +Q+ YVDAL +Y    R ++Q+  F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   65 ERKRKKGPAPKMLGDELCQVCGDTASGFHYNVLSCEGCKGFFRRSVIRGGAGRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSKEQIRKKKIRKQQQQQQQQSSPTGPGVSSSSPASGPGASPGGSDGGGQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPSRVEALQQPYVDALLSYTRIKRPQDQL-RFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 453          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:NR1H2 "Oxysterols receptor LXR-beta" species:9606 "Homo sapiens" [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0006351 "transcription, DNA-templated" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0005634 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0003700 GO:GO:0006351 EMBL:AC008655 InterPro:IPR023257 PRINTS:PR02034 HGNC:HGNC:7965 ProteinModelPortal:M0R0K3 SMR:M0R0K3 Ensembl:ENST00000598168 ArrayExpress:M0R0K3 Uniprot:M0R0K3)

HSP 1 Score: 225.328 bits (573), Expect = 1.046e-65
Identity = 133/390 (34.10%), Postives = 201/390 (51.54%), Query Frame = 0
Query:  156 ENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNS--NYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPK----SNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            E +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ +     Y C+  G C++D +MRRKCQ CRL+KC   GMR +CV+ E    +K+  K    + +   + V P+    S +         +  S          L   +E +I +LV  Q +    S +D  +V                                IV+F+K +PGF  L R+DQI LLK  + E+M+L  ARRY+ E++ I +  ++ ++K+++ +AGL  +    +F F RAM R+                       +EP RVE +Q+ YV+AL +Y    R ++Q+  F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   70 ERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQSQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTE------------------------------IVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQL-RFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 428          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592844279|gb|GAXK01113265.1| (TSA: Calanus finmarchicus comp95139_c2_seq2 transcribed RNA sequence)

HSP 1 Score: 112.464 bits (280), Expect = 3.810e-25
Identity = 96/363 (26.45%), Postives = 158/363 (43.53%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQXXXXXXXXXXXDTTVDPXXXXXXXXXXXXXDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMV-TFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLME 509
            LC VCGD A+  HY    CEGCKGFF+R++ KN+ Y C  + +C +D   R +CQ CR +KC   GM  E V      ++ R+ +  +   +  +T   P  +         +D          T P      +L N L Y Q  Y   SE DL          +   E+E+ ++ +    +T  ++ +I  F + +PG   L   D+  L +    E+  LR A R   ES    + +     + N A++  G+  + +    R++  M+                      EPK VE +Q   +++L+ +V  N    +    F+++L  L +LRSL +   +  F LKL++    P L+E
Sbjct: 1832 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLTVGMVKEVV--RTDSLKGRRGRLPSKPKSPQETPPSPPVSLITALVRAHVD----------TNP------DLSN-LDYSQ--YVEISEEDLET-------KSGLMENEAAKITQFYNLLTT-SIDVIRNFCERIPGISELSNKDRELLFQSACLELFTLRLAYRTQPESLKFTFCSGLVLHR-NQARSTFGDWLNGIIELSRSLHSMELDVSAFSCLAALTLVNERHGLSEPKIVENLQNKIINSLRDHVTYNSDAQRKPHYFSRILDKLPQLRSLSVQGLQRIFYLKLEDLVQAPPLIE 2830          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592844280|gb|GAXK01113264.1| (TSA: Calanus finmarchicus comp95139_c2_seq1 transcribed RNA sequence)

HSP 1 Score: 112.464 bits (280), Expect = 3.840e-25
Identity = 96/363 (26.45%), Postives = 158/363 (43.53%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQXXXXXXXXXXXDTTVDPXXXXXXXXXXXXXDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMV-TFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLME 509
            LC VCGD A+  HY    CEGCKGFF+R++ KN+ Y C  + +C +D   R +CQ CR +KC   GM  E V      ++ R+ +  +   +  +T   P  +         +D          T P      +L N L Y Q  Y   SE DL          +   E+E+ ++ +    +T  ++ +I  F + +PG   L   D+  L +    E+  LR A R   ES    + +     + N A++  G+  + +    R++  M+                      EPK VE +Q   +++L+ +V  N    +    F+++L  L +LRSL +   +  F LKL++    P L+E
Sbjct: 1832 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLTVGMVKEVV--RTDSLKGRRGRLPSKPKSPQETPPSPPVSLITALVRAHVD----------TNP------DLSN-LDYSQ--YVEISEEDLET-------KSGLMENEAAKITQFYNLLTT-SIDVIRNFCERIPGISELSNKDRELLFQSACLELFTLRLAYRTQPESLKFTFCSGLVLHR-NQARSTFGDWLNGIIELSRSLHSMELDVSAFSCLAALTLVNERHGLSEPKIVENLQNKIINSLRDHVTYNSDAQRKPHYFSRILDKLPQLRSLSVQGLQRIFYLKLEDLVQAPPLIE 2830          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592853768|gb|GAXK01103776.1| (TSA: Calanus finmarchicus comp167181_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 108.997 bits (271), Expect = 4.169e-24
Identity = 43/71 (60.56%), Postives = 55/71 (77.46%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAE 241
            ELC+VCGDRASG HY A++CEGCKGFF+RSI K   Y C+ N +CE+  + R +CQ CRL+KC A GMR++
Sbjct: 2397 ELCVVCGDRASGRHYGAISCEGCKGFFKRSIRKQLGYQCRGNKECEVTKHARNRCQYCRLQKCLAMGMRSD 2609          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592874334|gb|GAXK01083228.1| (TSA: Calanus finmarchicus comp389578_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 104.375 bits (259), Expect = 9.736e-23
Identity = 50/127 (39.37%), Postives = 73/127 (57.48%), Query Frame = 0
Query:  135 LRHPNAPLTPTGAV--------QQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKR 253
            L HP AP +P  +V         +       + +  GS S    + C +CGDRA+G HY A +C+GCKGFFRRS+ K   Y+C+++ +C +D   R +C+ CRL+KC+  GM+ + V  ER  I KR
Sbjct:  515 LLHPPAPPSPINSVPSLVNDDIAELDHSHSPDLQCNGSQSGVIPQNCAICGDRATGKHYGAASCDGCKGFFRRSVRKKHAYSCRFSRNCTVDKDKRNQCRYCRLRKCFKAGMKKDAVQNERDRISKR 895          

HSP 2 Score: 41.2022 bits (95), Expect = 8.057e-3
Identity = 27/107 (25.23%), Postives = 53/107 (49.53%), Query Frame = 0
Query:  360 LIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATN--YPFTKENYAKAGLG--NDELFR--FCRAMSRMKEPKRVEKIQEIYVDALQAYV 460
            ++VE++KH+P F  L  DDQ+ LL+  + E ++L  ARR     + ++   +   P    ++  A +    D + R    R M+ + +P +  ++ +     L+A V
Sbjct: 1088 ILVEWAKHIPAFSELVLDDQVALLRAHAGEHLLLGLARRSMNLQNILLLGNDMIIPRDIRDWGTAWITEPQDTVVRDIGIRVMNELVQPFKAIQMDDTEFACLKAIV 1408          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592874006|gb|GAXK01083556.1| (TSA: Calanus finmarchicus comp176094_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 104.375 bits (259), Expect = 1.268e-22
Identity = 50/116 (43.10%), Postives = 68/116 (58.62%), Query Frame = 0
Query:  133 NGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEEL-CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPER 247
            +GL  P     P+  + Q S   + +          A++L C+VCGD++SG HY  + CEGCK FF+RS+ +N  Y C+ N +C ID + R +CQ CRLKKCY  GMR E V P R
Sbjct:  700 SGLISPTTTCIPSSNMSQSS---DGDSTNLKDGDLGADDLQCVVCGDKSSGKHYGQVTCEGCKSFFKRSVRRNLTYQCRGNKNCPIDQHHRNQCQHCRLKKCYKMGMRKEAVQPGR 1038          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592848671|gb|GAXK01108873.1| (TSA: Calanus finmarchicus comp297344_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 102.834 bits (255), Expect = 1.669e-22
Identity = 40/71 (56.34%), Postives = 54/71 (76.06%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAE 241
            E C+VCGDRASG HY  ++CEGCKGFF+RS+ K+  Y C+ N DC+++   R +CQ CRL+KC A GMR++
Sbjct: 1186 EFCVVCGDRASGRHYGVVSCEGCKGFFKRSMRKDQGYRCRLNKDCDVNKNYRNRCQYCRLQKCLAMGMRSD 1398          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592848672|gb|GAXK01108872.1| (TSA: Calanus finmarchicus comp297344_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 102.834 bits (255), Expect = 2.270e-22
Identity = 40/71 (56.34%), Postives = 54/71 (76.06%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAE 241
            E C+VCGDRASG HY  ++CEGCKGFF+RS+ K+  Y C+ N DC+++   R +CQ CRL+KC A GMR++
Sbjct: 1344 EFCVVCGDRASGRHYGVVSCEGCKGFFKRSMRKDQGYRCRLNKDCDVNKNYRNRCQYCRLQKCLAMGMRSD 1556          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592848673|gb|GAXK01108871.1| (TSA: Calanus finmarchicus comp297344_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 102.834 bits (255), Expect = 2.450e-22
Identity = 40/71 (56.34%), Postives = 54/71 (76.06%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAE 241
            E C+VCGDRASG HY  ++CEGCKGFF+RS+ K+  Y C+ N DC+++   R +CQ CRL+KC A GMR++
Sbjct: 1407 EFCVVCGDRASGRHYGVVSCEGCKGFFKRSMRKDQGYRCRLNKDCDVNKNYRNRCQYCRLQKCLAMGMRSD 1619          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592878692|gb|GAXK01079209.1| (TSA: Calanus finmarchicus comp267685_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 103.219 bits (256), Expect = 3.160e-22
Identity = 90/365 (24.66%), Postives = 156/365 (42.74%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQXXXXXXXXXXXDTTVDPXXXXXXXXXXXXXDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN-----DELFRFCRAMS-------------------RMKEPKRVEKIQEIYVDALQAYVMAN---RKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLME 509
            LC VCGD A+  HY    CEGCKGFF+R++ KN+ Y C  + +C +D   R +CQ CR +KC A GM  E V  +   ++ R+ +      +  D    P            ++     + L  ++ ++  +EE+ ++      E      A +++ Y +   S        D +F+               F   +PGF +LC+ D+  L +    E+  LR + R    S  + +  N      N  ++  G+      EL +  +A+                     + EPK+VE +Q   +++L+ +V  N   ++K Q   F+++L  L  LRSL     +  F L+L+     P ++E
Sbjct: 1161 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDG--LKGRRGRLPTKPRSNQDPPPSPPVAMITSLVRAHVESTPKLESLDYSQYVEMNDEEMDSKAGLIALE-----AARISQFYSLLTSSI-------DVIFK---------------FCDKIPGFNDLCKQDRELLFRSACLELFTLRLSHRTLPNSMKLTFC-NGTVLHRNQVRSTFGDWLNGITELSKSLQAIDIDASAYACLSALTLVNERHGLLEPKKVENLQTKIINSLRDHVTYNPDAQRKPQY--FSRILDKLQVLRSLSQQALQRIFYLRLEGLVPEPPIIE 2159          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592814756|gb|GAXK01139812.1| (TSA: Calanus finmarchicus comp832560_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 99.7525 bits (247), Expect = 8.878e-22
Identity = 48/102 (47.06%), Postives = 63/102 (61.76%), Query Frame = 0
Query:  150 QYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITK----NSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPER 247
            QY +M+  ERK         + LC VCGD+ASG HY   +C+GC+GFF+RSI +    N +Y CK NG C +D+  R +CQ+CR KKC A  M+ E V  ER
Sbjct:  730 QYIKMLSLERK--------GDILCQVCGDKASGKHYGVPSCDGCRGFFKRSIRRLAAGNLDYMCKENGRCIVDVTRRNQCQSCRFKKCLAVNMKKEAVQHER 1011          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000005090 (pep:novel supercontig:LSalAtl2s:LSalAtl2s269:306853:308464:-1 gene:EMLSAG00000005090 transcript:EMLSAT00000005090 description:"augustus_masked-LSalAtl2s269-processed-gene-3.0")

HSP 1 Score: 1059.28 bits (2738), Expect = 0.000e+0
Identity = 514/514 (100.00%), Postives = 514/514 (100.00%), Query Frame = 0
Query:    1 MSTTQYTAIIQPRPXHDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            MSTTQYTAIIQPRPXHDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE
Sbjct:    1 MSTTQYTAIIQPRPXHDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000001919 (pep:novel supercontig:LSalAtl2s:LSalAtl2s132:616435:622808:1 gene:EMLSAG00000001919 transcript:EMLSAT00000001919 description:"augustus_masked-LSalAtl2s132-processed-gene-6.5")

HSP 1 Score: 110.153 bits (274), Expect = 2.612e-26
Identity = 91/358 (25.42%), Postives = 148/358 (41.34%), Query Frame = 0
Query:  169 AEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE--RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPK--------------------------RVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKL 498
            ++  C +CGDRASG HY   +CEGCKGFF+R++ K   Y C+ N DC ID   R +CQ CR  KC  TGM+ E V  E  R                    + + +S+ +G  G + I+      R+   + +   +++    L+            D N          +          + +    I   +L+  FS+       L  +DQ+ L++G  +E+++   A      +D I+       T+EN  +AG+G+         +++MKE +                          +VE ++E     L+ Y  +   +N+   FAKLL  L  LRS+G+   E  F  KL
Sbjct:   87 SKHFCSICGDRASGKHYGVYSCEGCKGFFKRTVRKELTYACRENRDCVIDKRQRNRCQYCRYMKCLDTGMKREAVQEERHRGSNGPNHNNNNNNNNNNSRNSEEVESSTSGGGGDMPIE------RIIEAEDVGEMKQDTSEFLLL-----------DNNSSMSGGGSIGDMEIQRFGLAKKRIIHQLIEWAKLVPHFSE-------LKVEDQVTLIRGGWNELLVAGLAFXSIKLNDGILLGNGTIVTRENAHEAGVGHIFDRVLVELIAKMKEMQMDKAELGCLRAIILFNPDAKGLSDVTKVENLREKVYATLEEYTRSVH-ENEPSRFAKLLLRLPALRSIGLKCLEHLFFYKL 419          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000007361 (pep:novel supercontig:LSalAtl2s:LSalAtl2s418:374353:376789:1 gene:EMLSAG00000007361 transcript:EMLSAT00000007361 description:"maker-LSalAtl2s418-augustus-gene-3.13")

HSP 1 Score: 110.153 bits (274), Expect = 6.362e-26
Identity = 82/291 (28.18%), Postives = 125/291 (42.96%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFR--FCRAMSRMKEPKRVEKIQEIYVDALQAYVM 461
            C VCGDRA+G HY A +C+GCKGFFRRS+ K   Y C+ N  C ++   R  C+ CRLK C   GM+   V  ER  I  R+  +A    +  + TV    N + K G  S+ + S      +T     EE  L N+ +   E+  H                              M E  I    ++VE++KH+  F  L  DDQ+ LL+  S E +++  A+R    +  ++   +    K+         D   R    R M+ + +  +   I +  +  L+A V 
Sbjct:  151 CAVCGDRATGKHYGAASCDGCKGFFRRSVRKERVYGCRQNRACIVNKDKRNNCRYCRLKMCIKAGMKKSAVQNERDRISCRKKTSAKDMNSANELTVTALLNAD-KVGQKSL-LNSIVGGNINTNNFITEENVLANKQLASIEDIGHS-----------------------------MKEQLI----VLVEWAKHIKAFCELSVDDQVRLLRAHSGEHLLMGVAKRSMNLNGILLLGNDMIIVKDERKWNSESQDAAVRSIGVRVMNELVDTFKRINIDDAELACLKAIVF 406          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000012486 (pep:novel supercontig:LSalAtl2s:LSalAtl2s91:348479:353390:-1 gene:EMLSAG00000012486 transcript:EMLSAT00000012486 description:"maker-LSalAtl2s91-snap-gene-4.8")

HSP 1 Score: 107.842 bits (268), Expect = 5.626e-25
Identity = 58/146 (39.73%), Postives = 79/146 (54.11%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRA------ECVVPERTCIQ--KRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELIN 308
            E C+VCGDRASG HY A++CEGCKGFF+RSI K   Y C+ N DCE+  + R +CQ CRL+KC A GMR         + P  + +Q  +R    A  + A      +  S +N KN S    +   P  LS    L P  + +++
Sbjct:  218 EACVVCGDRASGRHYGAISCEGCKGFFKRSIRKQLGYQCRGNKDCEVTKHHRNRCQYCRLQKCLAMGMRIMKQIYESYLAPRVSAVQSERRPIVPANVSNAVTAALAENISISNAKNSSPVYHIYDSPTLLSRNS-LGPSSDSILS 362          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000009941 (pep:novel supercontig:LSalAtl2s:LSalAtl2s649:484085:485655:-1 gene:EMLSAG00000009941 transcript:EMLSAT00000009941 description:"maker-LSalAtl2s649-snap-gene-4.11")

HSP 1 Score: 103.99 bits (258), Expect = 1.734e-24
Identity = 92/352 (26.14%), Postives = 147/352 (41.76%), Query Frame = 0
Query:  158 ERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSE----VMMLRGARRYDAE----SDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNR 501
            E  K    S  ++  C+VCGD++SG HY    CEGCK FF+RS+ +N  Y C+ + +C +D + R +CQ CRLKKC+  GMR E V       Q+ +             + DP S     +  IS+ + + P                            +P+    +R   +PM +      E      ++ E     +   VE+++ +PGF  L   DQ+ LL+   SE    V  L+G     AE       +++ T+ P         GL + ++               +E++QE    AL+ Y   ++  NQ   F KLL  L  LR++     E  F ++L  +
Sbjct:   68 EHAKPSELSESSDINCVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYQCRGSKNCPVDQHHRNQCQHCRLKKCFKMGMRREAV-------QRGRVPPTPQGVFGLGFSSDPLSGTTYLSSYISMLLRAEP----------------------------YPT----SRYGQMPMPTNGMIGIE------NICEFAARLLFSAVEWTRSIPGFPELQVTDQVALLRLVWSELFEQVEKLKGLHVDSAEYVCMKAIVLFTTDAP---------GLCDMQV---------------IEQLQEKSQCALEEYC-RSQYPNQPTRFGKLLLRLPSLRTVSSTVIEQLFFVRLVGK 349          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000013004 (pep:novel supercontig:LSalAtl2s:LSalAtl2s98:942409:953748:1 gene:EMLSAG00000013004 transcript:EMLSAT00000013004 description:"augustus_masked-LSalAtl2s98-processed-gene-9.1")

HSP 1 Score: 103.99 bits (258), Expect = 1.292e-23
Identity = 96/389 (24.68%), Postives = 155/389 (39.85%), Query Frame = 0
Query:  169 AEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAK-------------------AAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPF----TKENYAKAGLGNDELFRFCRAMS----------------------RMKEPKRVEKIQEIYVDALQAYVMAN---RKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLME 509
            A  LC VCGD A+  HY    CEGCKGFF+R++ KN+ Y C  + +C +D   R +CQ CR +KC A GM  E V  +   ++ R+ +                     A   A  DT+  P  NN        +D + F +  S       +E  L N  +             + + YHV   S                      +++I  F + +PG   L  +D+  L +    E+ +LR A R + +SD   +           ++ +     G +E  R   +M                        + +PK+VE I+   +++L+ +V  N   +KK   +T  ++L  L  LRSL +   +  F LK ++    P L+E
Sbjct:  405 ASLLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDS--LKGRRGRLPSKPKSPTESPPSPPVSLITALVRAHIDTS--PDMNN--------LDYSQFVET-SIEDERDSKENMLANEAI------------KIGQFYHVLTSS----------------------IEVIRNFCERIPGISELSLNDRDLLFQTSCLELFVLRLAYRSNPDSDRYTFCNGVVLHVSQCEQTFGDWLNGINEFARGLHSMELDISAFSCLCGLILVNGKDERHGLSDPKKVESIENKIINSLKDHVTYNPEAQKKEHYMT--RILDRLPALRSLSMQGLQRIFFLKWEDLVPAPPLIE 744          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000008071 (pep:novel supercontig:LSalAtl2s:LSalAtl2s47:304551:317770:1 gene:EMLSAG00000008071 transcript:EMLSAT00000008071 description:"snap_masked-LSalAtl2s47-processed-gene-3.10")

HSP 1 Score: 98.2117 bits (243), Expect = 5.852e-22
Identity = 70/252 (27.78%), Postives = 107/252 (42.46%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGL 424
            CLVCGD ASG+HY   +CE CK FF+R+I  N  YT   + +CEI+   R+ CQACR +KC   GM  E V  +R     R  +            + P                  PK+         E+ +L+  L + +     P    +N    +P +   +  + SD   R +           +E++K +PGF NL  +DQ+ LL+   SE+++L    R    +  I    N+   +      GL
Sbjct:  271 CLVCGDIASGFHYGVSSCEACKAFFKRTIQGNIEYTXPASNECEINKRRRKACQACRFQKCLRMGMLKEGVRLDRV----RGGRQKYRRMIESSPYIQPP-----------------PKK-------TLEDNKLLQVLRHCE-----PEAFLVNMDMTLPNYKIRTISTLSDFYNRELIGT--------IEWAKQIPGFSNLTINDQMKLLQSSWSEILVLSLVYRSLPYNGKISLTNNFSLDESQARLCGL 481          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000009969 (pep:novel supercontig:LSalAtl2s:LSalAtl2s651:302705:304416:-1 gene:EMLSAG00000009969 transcript:EMLSAT00000009969 description:"maker-LSalAtl2s651-augustus-gene-2.5")

HSP 1 Score: 97.0561 bits (240), Expect = 1.198e-21
Identity = 64/228 (28.07%), Postives = 101/228 (44.30%), Query Frame = 0
Query:  170 EELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGAR 397
            E LC+VCGD++SG HY    CEGCK FF+R + ++  + C+    C +D + R +CQ CR KKC   GM+ E V   RT            +A   + + D  S N G     S  ++++   L   +P             Y   +Y     A  N +  +     N  E  +  LF              +E+++++PGF  L   DQ+ LL+   SE+ +L  ++
Sbjct:   72 EILCVVCGDKSSGKHYGQFTCEGCKSFFKRCVRRSLTFQCRSKKSCPVDQHHRNQCQHCRFKKCLNMGMKKEAVQKGRT---------TTTSAPIFNYSNDLFSPNTG-----SSYLSTYISLLLRAEP-------------YTTSQYGQLQMAASNNIIGI----DNICEFAARLLFS------------AIEWARNIPGFPELQITDQVGLLRMVWSELFVLNASQ 256          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000008902 (pep:novel supercontig:LSalAtl2s:LSalAtl2s554:572309:581835:1 gene:EMLSAG00000008902 transcript:EMLSAT00000008902 description:"maker-LSalAtl2s554-snap-gene-5.6")

HSP 1 Score: 94.7449 bits (234), Expect = 7.072e-21
Identity = 39/78 (50.00%), Postives = 49/78 (62.82%), Query Frame = 0
Query:  170 EELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPER 247
            EELC VCGD+ SGYHY  L CE CKGFF+R++     YTC  +  C ID   R++C  CR +KC   GM+ E V  +R
Sbjct:  183 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDR 260          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000004451 (pep:novel supercontig:LSalAtl2s:LSalAtl2s231:945915:949068:1 gene:EMLSAG00000004451 transcript:EMLSAT00000004451 description:"snap_masked-LSalAtl2s231-processed-gene-9.18")

HSP 1 Score: 94.7449 bits (234), Expect = 8.139e-21
Identity = 60/229 (26.20%), Postives = 101/229 (44.10%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERT--------CIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMML 393
            C VCGD+ SG+HY   +CE CKGFF+R++    NY C     C + +  R+KC ACR  KC   GM+ E +  +RT        C          +  +    T+  +S  +  N    ++        SS  P+   E   +  L ++       S +  +   +    +T++S+       + +T +    +  +V + K LP F+N+  DDQI LL     E+++ 
Sbjct:  155 CPVCGDKISGFHYGIFSCESCKGFFKRTVQNKKNYVCLRGSQCPVTISTRKKCPACRFDKCLNIGMKLEAIREDRTRGGRSTYQCSYNLPTTGVCSTNSTTIPTIKRESRGDDHNTETKVNQ-------SSGIPVLLHEIMSVEHLWFW-------STSMPSLSLNNSSSNTDTSQESPSNPVQTLTLLADKRLYKLVRWCKSLPLFKNILVDDQITLLINAWCELLVF 369          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|205371750|sp|P49880.2|ECR_AEDAE (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; Short=AaEcR; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 380.178 bits (975), Expect = 1.228e-122
Identity = 221/525 (42.10%), Postives = 292/525 (55.62%), Query Frame = 0
Query:   42 PPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAP--------LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSI-SIDMASFP----------------KRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSR----------------------MKEPKRVEKIQEIYVDALQAYVMANRKKNQ---MVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            P PP ++    S++ S  ++   ++ L     SN    S+PSP    +     P  P P   +TT            Y        SSP+  G   P +P        L+P+ ++  Y+   + +++KKG + R  EELCLVCGDR SGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K A        T     + N+     I  I M   P                 RL +   L   +  +I +L+++Q+ YE PSE DL R+    + S N  E + D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYDA +DSI++A N  +T+++Y  AG+ +  ++L  FCR M                        +++ + VE IQ  Y+D L+ Y++ NR        V FAKLL +LTELR+LG  NSE+CFSLKLKNRKLP FL EIWD++
Sbjct:  170 PMPPVAAGTNVSSNGSVTVYASGKRRL----ESNEEWISSPSP--GSVPGSAPPLSPSPGSQSTT------------YTTTMSNGYSSPMSTGSYDPYSPNGKMGREDLSPSSSLNGYTDGSDAKKQKKGPTPRQQEELCLVCGDRESGYHYNALTCEGCKGFFRRSVTKNAVYCCKFGHACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAIKRKEKKAQKEKDKVQTNATVSTTNSTYRSEILPILMKCDPPPHQAIPLLPEKLLQENRLRNIPLLTANQMAVIYKLIWYQDGYEQPSEEDLKRIM---IGSPNEEEDQHDVHFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDAATDSILFANNRSYTRDSYRMAGMADTIEDLLHFCRQMFSLTVDNVEYALLTAIVIFSDRPGLEQAELVEHIQSYYIDTLRIYIL-NRHAGDPKCSVIFAKLLSILTELRTLGNQNSEMCFSLKLKNRKLPRFLEEIWDVQ 672          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|1706576|sp|P49883.1|ECR_MANSE (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 365.925 bits (938), Expect = 8.847e-120
Identity = 203/415 (48.92%), Postives = 248/415 (59.76%), Query Frame = 0
Query:  142 LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAA---AAAAAXXDTTVD----------PKSNNNGKNGSIS----IDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQ--MVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P  ++   S   E  R+KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE TC  KR+ K A           TTVD          P      +   +      +      RL +  PL   ++ LI RLV++QE YE PSE DL RV           E E+D  FR +TEMTILTVQLIVEF+K LPGF  + + DQI LLK  SSEVMMLR ARRYDA +DS+++A N  +T++NY KAG+    ++L  FCR M  M                      ++P  VE+IQ  Y+  L+ Y++     +    V F K+L VLTELR+LG  NS +C SLKLKNRKLPPFL EIWD+
Sbjct:  116 LSPASSINGCSTDGEPRRQKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYICKFGHACEMDMYMRRKCQECRLKKCLAVGMRPECVVPESTCKNKRREKEAQREKDKLPVSTTTVDDHMPAIMQCDPPPPEAARIHEVVPRFLTEKLMEQNRLKNVTPLSANQKSLIARLVWYQEGYEQPSEEDLKRVTQT-WQLEEEEEEETDMPFRQITEMTILTVQLIVEFAKGLPGFSKISQSDQITLLKASSSEVMMLRVARRYDAATDSVLFANNQAYTRDNYRKAGMSYVIEDLLHFCRCMYSMSMDNVHYALLTAIVIFSDRPGLEQPLLVEEIQRYYLKTLRVYILNQHSASPRCAVLFGKILGVLTELRTLGTQNSNMCISLKLKNRKLPPFLEEIWDV 529          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|461984|sp|P34021.1|ECR_DROME (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 374.785 bits (961), Expect = 1.542e-119
Identity = 203/445 (45.62%), Postives = 268/445 (60.22%), Query Frame = 0
Query:  126 SPSSPLENGLRHPNAPLTPTGAVQQYS--QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSIS------------IDMASFPKRLSSTKPLKPEE-----------------EELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQM--VTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            +P S   N +      L+P+ ++  YS  +  + ++ KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TK++ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K    A    D      S+ +G NGS++            +D+ +      +T PL P+E                   +I +L+++Q+ YE PSE DL R+   P    + +ES++D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD  SDSI +A N  +T+++Y  AG+ +  ++L  FCR M  MK                      + + VE IQ  Y+D L+ Y++     + M  V +AKLL +LTELR+LG  N+E+CFSLKLKNRKLP FL EIWD+
Sbjct:  215 TPRSDSVNSISSGRDDLSPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREK---KAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILAKCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQP----DENESQTDVSFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYTRDSYKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQSYYIDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDV 652          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|146328613|sp|O18531.2|ECR_LUCCU (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 369.007 bits (946), Expect = 1.693e-118
Identity = 204/433 (47.11%), Postives = 260/433 (60.05%), Query Frame = 0
Query:  126 SPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKK--KGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEE-----------------EELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQM--VTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            +P S   N +      L+P+ ++  +S    ++ KK  KG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K A        T+V            ++ +  S P     T PL PE+                   +I +L+++Q+ YE PSE DL R+    M S + +ES+ D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD  SDSI +A N  +T+++Y  AG+ +  ++L  FCR M  MK                      E + VE IQ  Y+D L+ Y++     + M  V FAKLL +LTELR+LG  N+E+CFSLKLKNRKLP FL EIWD+
Sbjct:  252 TPRSESANSISSGRDDLSPSSSLNGFSTSDASDVKKIKKGPAPRLQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYCCKFGHACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREKKAQKEKDKIQTSVCATEIKKEILDLMTCEPPSHP-----TCPLLPEDILAKCQARNIPPLSYNQLAVIYKLIWYQDGYEQPSEEDLKRI----MSSPDENESQHDASFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHNSDSIFFANNRSYTRDSYKMAGMADNIEDLLHFCRQMYSMKVDNVEYALLTAIVIFSDRPGLEEAELVEAIQSYYIDTLRIYILNRHCGDPMSLVFFAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDV 675          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|6015050|sp|O18473.1|ECR_HELVI (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=HvEcR; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 358.992 bits (920), Expect = 8.147e-117
Identity = 199/424 (46.93%), Postives = 251/424 (59.20%), Query Frame = 0
Query:  142 LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAA---XXDTTVD-------------PKSNNNGKNGSISIDMASFPK----------RLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKN--QMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P  +V   S   E  R+KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+D+YMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K A           TTVD             P++    +     +     P+          RL +  PL   ++ LI RLV++QE YE PSE DL RV        +S        FR +TEMTILTVQLIVEF+K LPGF  + + DQI LLK CSSEVMMLR ARRYDA +DS+++A N  +T++NY KAG+    ++L  FCR M  M                      ++P  VE+IQ  Y++ L+ Y++     +    V F ++L +LTE+R+LG+ NS +C SLKLKNRKLPPFL EIWD+
Sbjct:  132 LSPASSVNGCSTDGEARRQKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYICKFGHACEMDIYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRKEKKAQREKDKLPVSTTTVDDHMPPIMQCDPPPPEAARILE----CVQHEVVPRFLNEKLMEQNRLKNVPPLTANQKSLIARLVWYQEGYEQPSEEDLKRVTQSDEDDEDSDMP-----FRQITEMTILTVQLIVEFAKGLPGFAKISQSDQITLLKACSSEVMMLRVARRYDAATDSVLFANNQAYTRDNYRKAGMAYVIEDLLHFCRCMYSMMMDNVHYALLTAIVIFSDRPGLEQPLLVEEIQRYYLNTLRVYILNQNSASPRGAVIFGEILGILTEIRTLGMQNSNMCISLKLKNRKLPPFLEEIWDV 546          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|1706574|sp|P49881.1|ECR_BOMMO (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 355.525 bits (911), Expect = 4.790e-115
Identity = 194/420 (46.19%), Postives = 249/420 (59.29%), Query Frame = 0
Query:  142 LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVV--PERTCIQKRQAKAAAAAAAXXDTTV----------DPKSNNNGKNGSISIDMASFPKRLS----------STKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQ--MVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P  ++   S   +  R+KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECV+  P +   ++RQ K          TTV          DP      +   +       P+ LS          +  PL   ++ LI RLV++QE YE PS+ DL RV       ++  + ESD  FR +TEMTILTVQLIVEF+K LPGF  + + DQI LLK  SSEVMMLR ARRYDA SDS+++A N  +T++NY + G+    ++L  FCR M  M                      ++P  VE+IQ  Y++ L+ Y++     +    V + ++L VLTELR+LG  NS +C SLKLKNRKLPPFL EIWD+
Sbjct:  176 LSPASSINGCSADADARRQKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYICKFGHACEMDMYMRRKCQECRLKKCLAVGMRPECVIQEPSKNKDRQRQKKDKGILLPVSTTTVEDHMPPIMQCDPPPPEAARIHEV------VPRYLSEKLMEQNRQKNIPPLSANQKSLIARLVWYQEGYEQPSDEDLKRVTQT--WQSDEEDEESDLPFRQITEMTILTVQLIVEFAKGLPGFSKISQSDQITLLKASSSEVMMLRVARRYDAASDSVLFANNKAYTRDNYRQGGMAYVIEDLLHFCRCMFAMGMDNVHFALLTAIVIFSDRPGLEQPSLVEEIQRYYLNTLRIYIINQNSASSRCAVIYGRILSVLTELRTLGTQNSNMCISLKLKNRKLPPFLEEIWDV 587          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|1706575|sp|P49882.1|ECR_CHITE (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 330.872 bits (847), Expect = 1.936e-106
Identity = 187/414 (45.17%), Postives = 237/414 (57.25%), Query Frame = 0
Query:  161 KKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVD-----------PKSNNNGKNGSISI-----------------------DMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSR----------------------MKEPKRVEKIQEIYVDALQAYVMANRKKNQ---MVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            KKG   R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+  +CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K A          V              +N + KN  IS                        +      R   T  L   +  +I +L+++Q+ YE PSE DL R+        +     +   FR++TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD +SDSI++A N  +TK+ Y  AG+    D+L  FCR M                        +++ + V+ IQ  Y + L+ Y++ NR   +    V FAKLL +LTELR++G  NSE+CFSLKL+NRKLP FL E+WD+
Sbjct:  103 KKGPVPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYCCKFGHECEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAIKRKEKKAQKEKDKVPGIVGSNTSSSSLLNQSLNNGSLKNLEISYREELLEQLMKCDPPPHPMQQLLPEKLLMENRAKGTPQLTANQVAVIYKLIWYQDGYEQPSEEDLKRITTELEEEEDQEHEAN---FRYITEVTILTVQLIVEFAKGLPAFIKIPQEDQITLLKACSSEVMMLRMARRYDHDSDSILFANNTAYTKQTYQLAGMEETIDDLLHFCRQMYALSIDNVEYALLTAIVIFSDRPGLEKAEMVDIIQSYYTETLKVYIV-NRHGGESRCSVQFAKLLGILTELRTMGNKNSEMCFSLKLRNRKLPRFLEEVWDV 512          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|341942229|sp|Q9Z0Y9.3|NR1H3_MOUSE (RecName: Full=Oxysterols receptor LXR-alpha; AltName: Full=Liver X receptor alpha; AltName: Full=Nuclear receptor subfamily 1 group H member 3)

HSP 1 Score: 266.544 bits (680), Expect = 1.095e-82
Identity = 156/405 (38.52%), Postives = 226/405 (55.80%), Query Frame = 0
Query:  138 PNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P A L     + + +++   +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ K + Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T+V P+             ++S P+ L     L PE+  +I +LV  Q++    S +D  RV   P+     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F RAM+ +                       ++  +VE++Q  YV+AL AYV  N   + ++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   61 PTALLPRAETLPEPTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAQA-----TSVSPR-------------VSSPPQVLPQ---LSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPIAPDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSINHPHDPLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 443          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|23503089|sp|Q13133.2|NR1H3_HUMAN (RecName: Full=Oxysterols receptor LXR-alpha; AltName: Full=Liver X receptor alpha; AltName: Full=Nuclear receptor subfamily 1 group H member 3)

HSP 1 Score: 266.159 bits (679), Expect = 1.892e-82
Identity = 156/405 (38.52%), Postives = 228/405 (56.30%), Query Frame = 0
Query:  138 PNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P A LT      + +++   +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ K ++Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T++ P+++             S P+ L     L PE+  +I +LV  Q++    S +D  RV   PM     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F RAM+ +                       ++  +VE++Q  YV+AL AYV  +   ++++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   63 PTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAHA-----TSLPPRAS-------------SPPQILPQ---LSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 445          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|75060925|sp|Q5E9B6.1|NR1H3_BOVIN (RecName: Full=Oxysterols receptor LXR-alpha; AltName: Full=Liver X receptor alpha; AltName: Full=Nuclear receptor subfamily 1 group H member 3)

HSP 1 Score: 265.774 bits (678), Expect = 2.197e-82
Identity = 156/405 (38.52%), Postives = 225/405 (55.56%), Query Frame = 0
Query:  138 PNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P A L    A  + +++   +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ K + Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T+  P+++             S P+ L     L PE+  +I +LV  Q+     S +D  RV   PM     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F RAM+ +                       ++  +VE++Q  YV+AL AYV  +   ++++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   63 PTALLPGVEAPPESTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKMKRQEEEQAQA-----TSAPPRAS-------------SPPQVLPQ---LSPEQLGMIEKLVAAQQLCNRRSFSDQLRVTPWPMAPDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 445          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: EEB17490.1 (Ecdysone receptor, putative [Pediculus humanus corporis])

HSP 1 Score: 434.106 bits (1115), Expect = 4.222e-147
Identity = 238/466 (51.07%), Postives = 286/466 (61.37%), Query Frame = 0
Query:   95 PXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAP--------LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFP---------------KRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P  P P P     H Q++  +  Y         SSP+ +G   P +P        L+P G++  YS    + +KKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+   CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A        +T          NGS  + MA  P                  +  KP+ PE+EELI+RLVYFQ EYE PS+ DL R+ + P    +  E +SD  FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMMLR ARRYD  SDSI++A N P+T+++Y+ AG+G   D+L RFCR M  MK                      E  +VEKIQEIY++AL+ YV   RK      FAKLL VLTELR+LG  NSE+CFSLKLKN+KLPPFL EIWD+
Sbjct:   80 PLTPSPGP-----HNQYTVISNGY---------SSPMSSGSYDPYSPNGKLGREDLSPPGSLNGYSVDSSDSKKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGDSCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEIQCEVKRREKKAQREKGKPSSTT---------NGSPELIMADTPAIKTEPNTTQSHNEKSSANGVKPISPEQEELIHRLVYFQNEYEQPSDEDLKRISNAP----SEGEDQSDLNFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMLRMARRYDVGSDSILFANNQPYTRDSYSLAGMGETVDDLLRFCRQMYGMKVDNAEYALLTAIVIFSERPSLIEGWKVEKIQEIYLEALKVYVDNRRKPRSGTIFAKLLSVLTELRTLGNLNSEMCFSLKLKNKKLPPFLAEIWDV 518          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: gb|KYB25531.1| (Ecdysone receptor-like Protein [Tribolium castaneum])

HSP 1 Score: 425.246 bits (1092), Expect = 2.163e-143
Identity = 225/422 (53.32%), Postives = 278/422 (65.88%), Query Frame = 0
Query:  128 SSPLENGLRHPNAP--------LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISI--DMASFPKRL-SSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            SSP+ +G   P +P        L+P+ ++  YS    + +KKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A            P S  NG    I +  +++   K L + +K + PE+EELI+RLVYFQ EYEHPSE D+ R+ + PM      E + D  FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMM R ARRYD ++DSI++  N P+++++Y  AG+G   ++L  FCR M  MK                      E  +VEKIQEIY++AL+AYV   RK      FAKLL VLTELR+LG  NSE+CFSLKLKN+KLPPFL EIWD++
Sbjct:  125 SSPMSSGSYDPYSPNGKIGREDLSPS-SLNGYSADSCDSKKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEVQCAVKRKEKKAQKEKDK------PNSTTNGSPDVIKVEPELSDSEKTLCNGSKGISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPM----DGEDQCDVRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQTDSILFVNNQPYSRDSYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYLEALRAYVDNRRKPKPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFLAEIWDVD 535          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: gb|KYB25532.1| (Ecdysone receptor-like Protein [Tribolium castaneum])

HSP 1 Score: 421.394 bits (1082), Expect = 1.151e-142
Identity = 225/431 (52.20%), Postives = 282/431 (65.43%), Query Frame = 0
Query:  111 HSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISI--DMASFPKRL-SSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            H+   ++++L  S  S +S  E+        L+P+ ++  YS    + +KKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A            P S  NG    I +  +++   K L + +K + PE+EELI+RLVYFQ EYEHPSE D+ R+ + PM      E + D  FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMM R ARRYD ++DSI++  N P+++++Y  AG+G   ++L  FCR M  MK                      E  +VEKIQEIY++AL+AYV   RK      FAKLL VLTELR+LG  NSE+CFSLKLKN+KLPPFL EIWD++
Sbjct:   70 HTIIASNHHLAKSDTSSASGRED--------LSPS-SLNGYSADSCDSKKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEVQCAVKRKEKKAQKEKDK------PNSTTNGSPDVIKVEPELSDSEKTLCNGSKGISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPM----DGEDQCDVRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQTDSILFVNNQPYSRDSYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYLEALRAYVDNRRKPKPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFLAEIWDVD 481          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: NP_001152827.1 (ecdysone receptor isoform B1 [Apis mellifera])

HSP 1 Score: 414.846 bits (1065), Expect = 4.206e-139
Identity = 217/399 (54.39%), Postives = 258/399 (64.66%), Query Frame = 0
Query:  157 NERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSS------------------TKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            + RKKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC   GMR ECVVPE  C  KR+ K A       ++T    S  +G   S  + +   P    S                   KP+ PE+EELI+RLVYFQ EYE PSE DL R+ + P    +  E  SD  FRH+TE+TILTVQLIVEFSK LPGF  L R+DQI LLK CSSEVMMLR AR+YD ++DSI++A N P+TK++Y  AG+G   ++L  FCR M  MK                      E  +VEKIQEIY++AL+AYV   R+ N    FA+LL VLTELR+LG  NSE+CFSLK KN+KLP FL EIWD+
Sbjct:  161 DARKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLTVGMRPECVVPEYQCAVKRKEKKAQKEKDKPNSTTMNGSPGSGGIRSDQMGVKIEPAEAESLSTSGSSGILTPVSPYGYVKPISPEQEELIHRLVYFQNEYEQPSEEDLKRITNQP----SEGEDISDYKFRHITEITILTVQLIVEFSKRLPGFDELMREDQIALLKACSSEVMMLRMARKYDVQTDSIIFANNQPYTKDSYTVAGMGETIEDLLHFCRQMYAMKVNNAEYALLTAIVIFSERPNLLEGWKVEKIQEIYLEALRAYVDNRRRPNPGTVFARLLSVLTELRTLGNQNSEMCFSLKFKNKKLPVFLAEIWDV 555          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: NP_001091685.2 (ecdysone receptor isoform A [Apis mellifera])

HSP 1 Score: 417.157 bits (1071), Expect = 4.987e-139
Identity = 217/399 (54.39%), Postives = 258/399 (64.66%), Query Frame = 0
Query:  157 NERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSS------------------TKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            + RKKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC   GMR ECVVPE  C  KR+ K A       ++T    S  +G   S  + +   P    S                   KP+ PE+EELI+RLVYFQ EYE PSE DL R+ + P    +  E  SD  FRH+TE+TILTVQLIVEFSK LPGF  L R+DQI LLK CSSEVMMLR AR+YD ++DSI++A N P+TK++Y  AG+G   ++L  FCR M  MK                      E  +VEKIQEIY++AL+AYV   R+ N    FA+LL VLTELR+LG  NSE+CFSLK KN+KLP FL EIWD+
Sbjct:  233 DARKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLTVGMRPECVVPEYQCAVKRKEKKAQKEKDKPNSTTMNGSPGSGGIRSDQMGVKIEPAEAESLSTSGSSGILTPVSPYGYVKPISPEQEELIHRLVYFQNEYEQPSEEDLKRITNQP----SEGEDISDYKFRHITEITILTVQLIVEFSKRLPGFDELMREDQIALLKACSSEVMMLRMARKYDVQTDSIIFANNQPYTKDSYTVAGMGETIEDLLHFCRQMYAMKVNNAEYALLTAIVIFSERPNLLEGWKVEKIQEIYLEALRAYVDNRRRPNPGTVFARLLSVLTELRTLGNQNSEMCFSLKFKNKKLPVFLAEIWDV 627          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: XP_016768787.1 (PREDICTED: ecdysone receptor isoform X1 [Apis mellifera])

HSP 1 Score: 417.157 bits (1071), Expect = 5.139e-139
Identity = 217/399 (54.39%), Postives = 258/399 (64.66%), Query Frame = 0
Query:  157 NERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSS------------------TKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            + RKKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC   GMR ECVVPE  C  KR+ K A       ++T    S  +G   S  + +   P    S                   KP+ PE+EELI+RLVYFQ EYE PSE DL R+ + P    +  E  SD  FRH+TE+TILTVQLIVEFSK LPGF  L R+DQI LLK CSSEVMMLR AR+YD ++DSI++A N P+TK++Y  AG+G   ++L  FCR M  MK                      E  +VEKIQEIY++AL+AYV   R+ N    FA+LL VLTELR+LG  NSE+CFSLK KN+KLP FL EIWD+
Sbjct:  234 DARKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLTVGMRPECVVPEYQCAVKRKEKKAQKEKDKPNSTTMNGSPGSGGIRSDQMGVKIEPAEAESLSTSGSSGILTPVSPYGYVKPISPEQEELIHRLVYFQNEYEQPSEEDLKRITNQP----SEGEDISDYKFRHITEITILTVQLIVEFSKRLPGFDELMREDQIALLKACSSEVMMLRMARKYDVQTDSIIFANNQPYTKDSYTVAGMGETIEDLLHFCRQMYAMKVNNAEYALLTAIVIFSERPNLLEGWKVEKIQEIYLEALRAYVDNRRRPNPGTVFARLLSVLTELRTLGNQNSEMCFSLKFKNKKLPVFLAEIWDV 628          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: XP_006568116.1 (PREDICTED: ecdysone receptor isoform X1 [Apis mellifera])

HSP 1 Score: 417.157 bits (1071), Expect = 5.139e-139
Identity = 217/399 (54.39%), Postives = 258/399 (64.66%), Query Frame = 0
Query:  157 NERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSS------------------TKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            + RKKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC   GMR ECVVPE  C  KR+ K A       ++T    S  +G   S  + +   P    S                   KP+ PE+EELI+RLVYFQ EYE PSE DL R+ + P    +  E  SD  FRH+TE+TILTVQLIVEFSK LPGF  L R+DQI LLK CSSEVMMLR AR+YD ++DSI++A N P+TK++Y  AG+G   ++L  FCR M  MK                      E  +VEKIQEIY++AL+AYV   R+ N    FA+LL VLTELR+LG  NSE+CFSLK KN+KLP FL EIWD+
Sbjct:  234 DARKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLTVGMRPECVVPEYQCAVKRKEKKAQKEKDKPNSTTMNGSPGSGGIRSDQMGVKIEPAEAESLSTSGSSGILTPVSPYGYVKPISPEQEELIHRLVYFQNEYEQPSEEDLKRITNQP----SEGEDISDYKFRHITEITILTVQLIVEFSKRLPGFDELMREDQIALLKACSSEVMMLRMARKYDVQTDSIIFANNQPYTKDSYTVAGMGETIEDLLHFCRQMYAMKVNNAEYALLTAIVIFSERPNLLEGWKVEKIQEIYLEALRAYVDNRRRPNPGTVFARLLSVLTELRTLGNQNSEMCFSLKFKNKKLPVFLAEIWDV 628          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: gb|KFM66857.1| (Ecdysone receptor, partial [Stegodyphus mimosarum])

HSP 1 Score: 401.749 bits (1031), Expect = 1.493e-136
Identity = 212/384 (55.21%), Postives = 256/384 (66.67%), Query Frame = 0
Query:  158 ERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXD-TTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANR--KKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            ++KKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A       + TT D  S+   K GS        P      K +   +EELI+RLV FQEEYE PSE D  ++   P+     SE +S + F+H+TE+TILTVQLIVEFSK +PGF  L R+DQI LLK CSSEVMMLR AR+YD ++DSIV+A N P+T+ENY  A +G+  D +F FCR M  +K                      EPK+VEKIQE Y++ L+AY+  NR   KN    FA+LL  L ELR+LG  NSELCFSLK++N+KLP FL EIWDI+
Sbjct:    8 DKKKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEYQCAIKRETKKAQKDKDKPNSTTRDSGSDKEEKPGS--------PPNGGQPKAISKAQEELISRLVVFQEEYESPSEEDFKKITAFPL---GDSEEDSMKRFQHITEITILTVQLIVEFSKRVPGFDTLSREDQITLLKACSSEVMMLRTARKYDIKTDSIVFANNQPYTRENYRSACMGDSADSIFHFCRNMCVLKVDNAEYALLTAIVIFSERPSLLEPKKVEKIQEFYIETLRAYISTNRPPGKN---YFARLLSTLVELRTLGNMNSELCFSLKVQNKKLPAFLEEIWDIQ 377          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: gb|EEC03371.1| (AamEcRA1, putative [Ixodes scapularis])

HSP 1 Score: 396.741 bits (1018), Expect = 8.064e-134
Identity = 204/396 (51.52%), Postives = 265/396 (66.92%), Query Frame = 0
Query:  151 YSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTV--DPKSNNNGKNGSISIDMASFPKR-----LS-STKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            Y+    + +KKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +C+IDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR++K         ++T    P ++     G  S+     P+      LS   KPL   +E+LIN+LVY+Q+E+E PSE D+ +    P+     SE ++ R F+H+TE+TILTVQLIVEFSK +PGF  L R+DQI LLK CSSEVMMLRGAR+YD ++DSIV+A N P+T++NY  A +G+  D LFRFCR M +++                      +P +VE+IQE Y+D L+ Y   +R   +   FA+LL +LTELR+LG  N+E+CFSLK++N+KLPPFL EIWDI+
Sbjct:   41 YADSFGDPKKKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCDIDMYMRRKCQECRLKKCLSVGMRPECVVPEYQCAIKRESKKHQKDKDRPNSTTRESPATSMGPSPGGSSVVQLMEPEDKKPLVLSPGVKPLSSSQEDLINKLVYYQQEFESPSEEDMKKTTPFPL---GDSEEDNQRRFQHITEITILTVQLIVEFSKRVPGFDTLAREDQITLLKACSSEVMMLRGARKYDVKTDSIVFANNQPYTRDNYRSASVGDSADALFRFCRKMCQLRVDNAEYALLTAIVIFSERPCLVDPHKVERIQEYYIDTLRMYSENHRPPGKNY-FARLLSILTELRTLGNMNAEMCFSLKVQNKKLPPFLAEIWDIQ 432          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: AAM68346.1 (ecdysone receptor, isoform E [Drosophila melanogaster])

HSP 1 Score: 379.793 bits (974), Expect = 5.116e-122
Identity = 209/465 (44.95%), Postives = 277/465 (59.57%), Query Frame = 0
Query:  114 QNTHYYLNNSGESPSSPLENGLRHPNAP--------LTPTGAVQQYS--QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSIS------------IDMASFPKRLSSTKPLKPEE-----------------EELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQM--VTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            QN  Y ++N     +SP+  G   P +P        L+P+ ++  YS  +  + ++ KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TK++ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K    A    D      S+ +G NGS++            +D+ +      +T PL P+E                   +I +L+++Q+ YE PSE DL R+   P    + +ES++D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD  SDSI +A N  +T+++Y  AG+ +  ++L  FCR M  MK                      + + VE IQ  Y+D L+ Y++     + M  V +AKLL +LTELR+LG  N+E+CFSLKLKNRKLP FL EIWD+
Sbjct:  169 QNHSYNMSNG---YASPMSAGSYDPYSPTGKTGRDDLSPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREK---KAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILAKCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQP----DENESQTDVSFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYTRDSYKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQSYYIDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDV 623          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|729058610|gb|AIZ04022.1| (ecdysone receptor, partial [Lepeophtheirus salmonis salmonis])

HSP 1 Score: 1050.81 bits (2716), Expect = 0.000e+0
Identity = 507/536 (94.59%), Postives = 507/536 (94.59%), Query Frame = 0
Query:    1 MSTTQYTAIIQPRPXHDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            MSTTQYTAIIQPRP HDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIK  PHP  PPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAA  DTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM                      KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE
Sbjct:    1 MSTTQYTAIIQPRPTHDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKTEPHPYSPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAAADTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKVDNAEYALITAIVIFSDRNSLKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 536          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|291190960|gb|ADD82902.1| (ecdysone receptor [Tigriopus japonicus])

HSP 1 Score: 531.561 bits (1368), Expect = 0.000e+0
Identity = 280/490 (57.14%), Postives = 333/490 (67.96%), Query Frame = 0
Query:   66 QSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXD---TTVDPKSNNNGKNGSISIDMASFP-------------KRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSS---ESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            Q ++++T S +  +   SP+ +EIK  P         +  +     +Q N    L++ G SPSS   + L    +P     + Q Y +M ENERKKKG   RP EE C VCGDRASGYHYNALACEGCKGFFRRSITKNS Y+CK+   CEIDMYMRRKCQACR KKCY  GMRAECVVPE  C +KR  K A  AA   D   TT    +N  G    +S++ +  P             +   S + LKPEEEELINR+VY+Q+EYE+PSE DLNRVYHVP+   N S   ESESDRLF+H+TEMTILTVQLIVEFSKHLPGFQ LCR+DQ+NLLKGCSSEVMMLRGARRYD + DSI+YA NYPF+K+NY KAGL ND LFRFCR+M +M                      KEP RVEKIQEIYV+ALQ+YVMA +KK  MVTFAKLL VLTELRSLG +N++ CF+L++ NR+LP FL EIWDI+
Sbjct:   72 QPIYVDTSSPSSQFQASSPLTTEIKSEPPSSY-----SPPSNSLGFTQGN----LSSVG-SPSSQQSSFLVKSESP-----SSQDYPRMQENERKKKGQVPRPQEEFCTVCGDRASGYHYNALACEGCKGFFRRSITKNSTYSCKYGDGCEIDMYMRRKCQACRFKKCYTVGMRAECVVPESQCQKKRAIKRAQKAAQKGDASSTTAITNANGVGGVSGVSLNGSHTPNFAGLGLGLTLGARSTLSQRHLKPEEEELINRIVYYQDEYENPSEDDLNRVYHVPLQYANDSNGIESESDRLFQHITEMTILTVQLIVEFSKHLPGFQTLCREDQVNLLKGCSSEVMMLRGARRYDPQRDSIIYANNYPFSKDNYVKAGLSNDSLFRFCRSMCKMKVDNAEYALITAIVIFSERHNVKEPNRVEKIQEIYVEALQSYVMAKQKKEPMVTFAKLLSVLTELRSLGNSNAKTCFNLRMINRQLPAFLAEIWDIK 546          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|335355357|gb|AEH43772.1| (ecdysone receptor isoform 2 [Amphiascus tenuiremis])

HSP 1 Score: 473.011 bits (1216), Expect = 1.325e-160
Identity = 256/457 (56.02%), Postives = 303/457 (66.30%), Query Frame = 0
Query:  123 SGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKG----------SSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKA------AAAAAAXXDTTVDPKSNNNGKNGSISIDMAS---FPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVP------------------------MHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            S  SP+    +      +PLTPTGAV QY+QM E ERKKK              +P EELCLVCGDRASGYHYNALACEGCKGFFR SITK+S Y CK+   CEIDMYMRRKCQACRLKKCY  GMRAECVVPE  C +KRQAK                T    ++NNN   GS++  +AS      RL+    LKPE+E LINR+V++Q+E+E P++ DL+RVYHVP                          S    ++ESD+ FRHMTEMT+LTVQLIVEFSKHLPGFQ LCRDDQ++LLK CSSEV+M+RGARRYD + + I+YATNYPF++ENY  AGLGN+ LFRFC+ M  MK                      EPKRVEKIQEIYV+ALQ+YVMA RK+  MV FAKLL VLT LRSLG NN++ CF++K+ NRKLP FL EIWDI+
Sbjct:    3 SAGSPAGSANSFFPPGGSPLTPTGAVHQYAQMQEAERKKKSHHNSGGNSSNGGGKPQEELCLVCGDRASGYHYNALACEGCKGFFR-SITKSSKYACKYGDGCEIDMYMRRKCQACRLKKCYLVGMRAECVVPESQCQKKRQAKQAQKAQQGGEGGDITTTNNSVQNNNNNLLGSLAASVASTSALKNRLTPPWTLKPEQEGLINRIVFYQDEFEKPTDEDLSRVYHVPPLQPGHLDPGSGGGPGTNSLTANGSGSNGELDNESDKYFRHMTEMTVLTVQLIVEFSKHLPGFQTLCRDDQVSLLKACSSEVIMIRGARRYDPQRECIIYATNYPFSQENYDMAGLGNEALFRFCKLMCSMKVDNAEYALLTAIVIFSDRENVREPKRVEKIQEIYVEALQSYVMARRKEEHMVAFAKLLSVLTTLRSLGNNNAKTCFNMKMVNRKLPAFLAEIWDIK 458          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|1111332457|gb|APH81342.1| (ecdysone receptor [Paracyclopina nana])

HSP 1 Score: 464.537 bits (1194), Expect = 6.560e-157
Identity = 232/393 (59.03%), Postives = 276/393 (70.23%), Query Frame = 0
Query:  164 SSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSS--------------------TKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            S+SRP E+LCLVCGDRASGYHYNALACEGCKGFFRRSITKN +Y CK+  +CEIDMYMRRKCQACRLKKCYA GMRA+CVVPE  C++KR AK+                NNNG+   + I      + LS                      +PLKPEEEELINRLVYFQ ++E+P+E DL +VYHVP+HS   +E+E D LFRH+TEMTILTV LIV+F KHLPGF +L +DDQ+ +LKGCSSEVMMLR ARRYD +++SI++A N+PFTKENY +AGL  + LFRFCR M +M                      K+ KRVEKIQEIYVDAL++YVM++RKK+  V FAKLL  L ELRSLG  NS  CF LKL NR+LP FL EIWDI+
Sbjct:  113 SNSRPQEDLCLVCGDRASGYHYNALACEGCKGFFRRSITKNQSYKCKYGDNCEIDMYMRRKCQACRLKKCYAVGMRADCVVPEEQCVKKRMAKS---------------KNNNGETSPLMITNGGHMRHLSGGSDTNGATLVLKRPAPLVHVVRPLKPEEEELINRLVYFQLQFEYPNEEDLKKVYHVPLHS-QGAENEGDCLFRHITEMTILTVNLIVDFCKHLPGFASLEKDDQVVILKGCSSEVMMLRAARRYDPQTESIIFANNHPFTKENYKQAGLRFEALFRFCRRMIKMKVDNAEFGLLTAITIFSERKNLKQRKRVEKIQEIYVDALRSYVMSHRKKDPTVAFAKLLGALVELRSLGNLNSRTCFDLKLVNRRLPDFLAEIWDIK 489          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|1110961968|gb|APG80611.1| (ecdysone receptor [Paracyclopina nana])

HSP 1 Score: 464.537 bits (1194), Expect = 6.778e-157
Identity = 232/393 (59.03%), Postives = 276/393 (70.23%), Query Frame = 0
Query:  164 SSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSS--------------------TKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            S+SRP E+LCLVCGDRASGYHYNALACEGCKGFFRRSITKN +Y CK+  +CEIDMYMRRKCQACRLKKCYA GMRA+CVVPE  C++KR AK+                NNNG+   + I      + LS                      +PLKPEEEELINRLVYFQ ++E+P+E DL +VYHVP+HS   +E+E D LFRH+TEMTILTV LIV+F KHLPGF +L +DDQ+ +LKGCSSEVMMLR ARRYD +++SI++A N+PFTKENY +AGL  + LFRFCR M +M                      K+ KRVEKIQEIYVDAL++YVM++RKK+  V FAKLL  L ELRSLG  NS  CF LKL NR+LP FL EIWDI+
Sbjct:  113 SNSRPQEDLCLVCGDRASGYHYNALACEGCKGFFRRSITKNQSYKCKYGDNCEIDMYMRRKCQACRLKKCYAVGMRADCVVPEEQCVKKRMAKS---------------KNNNGETSPLMITNGGHMRHLSGGSDTNGATLVLKRPAPLVHVVRPLKPEEEELINRLVYFQLQFEYPNEEDLKKVYHVPLHS-QGAENEGDCLFRHITEMTILTVNLIVDFCKHLPGFASLEKDDQVVILKGCSSEVMMLRAARRYDPQTESIIFANNHPFTKENYKQAGLRFEALFRFCRRMIKMKVDNAEFGLLTAITIFSERKNLKQRKRVEKIQEIYVDALRSYVMSHRKKDPTVAFAKLLGALVELRSLGNLNSRTCFDLKLVNRRLPDFLAEIWDIK 489          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|242019559|ref|XP_002430228.1| (Ecdysone receptor, putative [Pediculus humanus corporis] >gi|212515324|gb|EEB17490.1| Ecdysone receptor, putative [Pediculus humanus corporis])

HSP 1 Score: 434.106 bits (1115), Expect = 2.066e-144
Identity = 238/466 (51.07%), Postives = 286/466 (61.37%), Query Frame = 0
Query:   95 PXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAP--------LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFP---------------KRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P  P P P     H Q++  +  Y         SSP+ +G   P +P        L+P G++  YS    + +KKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+   CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A        +T          NGS  + MA  P                  +  KP+ PE+EELI+RLVYFQ EYE PS+ DL R+ + P    +  E +SD  FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMMLR ARRYD  SDSI++A N P+T+++Y+ AG+G   D+L RFCR M  MK                      E  +VEKIQEIY++AL+ YV   RK      FAKLL VLTELR+LG  NSE+CFSLKLKN+KLPPFL EIWD+
Sbjct:   80 PLTPSPGP-----HNQYTVISNGY---------SSPMSSGSYDPYSPNGKLGREDLSPPGSLNGYSVDSSDSKKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGDSCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEIQCEVKRREKKAQREKGKPSSTT---------NGSPELIMADTPAIKTEPNTTQSHNEKSSANGVKPISPEQEELIHRLVYFQNEYEQPSDEDLKRISNAP----SEGEDQSDLNFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMLRMARRYDVGSDSILFANNQPYTRDSYSLAGMGETVDDLLRFCRQMYGMKVDNAEYALLTAIVIFSERPSLIEGWKVEKIQEIYLEALKVYVDNRRKPRSGTIFAKLLSVLTELRTLGNLNSEMCFSLKLKNKKLPPFLAEIWDV 518          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|939669806|ref|XP_014281743.1| (PREDICTED: ecdysone receptor isoform X1 [Halyomorpha halys])

HSP 1 Score: 429.483 bits (1103), Expect = 1.410e-143
Identity = 222/409 (54.28%), Postives = 273/409 (66.75%), Query Frame = 0
Query:  142 LTPTGAVQQYS-QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISI------------DMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P  ++  +S    +  +KKKGS++R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A            P S  NG   SI +            D    P  ++  KP+ PE+EELI+RLVYFQ EYEHPSE DL R+     ++ N  E +SD+ FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMMLR AR+YDA +DSI++A N P+ +E+Y+ AG+G+  ++L RFCR M  MK                      E  +VEKIQEIY++AL++YV    +      FAKLL VLTELR+LG  NSE+CFSLKL+N+KLPPFL EIWD+
Sbjct:   53 LSPANSLNGFSADSCDGSKKKKGSAARQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEYQCAVKRKEKKAQKDKDK------PVSTTNGSPESIKVEEPHRVVYKTESDTLGRPVPMNGIKPVSPEQEELIHRLVYFQNEYEHPSEEDLRRIVS---NTPNEDEEQSDQRFRHLTEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMLRMARKYDANTDSILFANNQPYNRESYSLAGMGDVIEDLLRFCRHMYNMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYLEALKSYVDNRSRPRSPAIFAKLLSVLTELRTLGNQNSEMCFSLKLQNKKLPPFLAEIWDV 452          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|939669809|ref|XP_014281744.1| (PREDICTED: ecdysone receptor isoform X2 [Halyomorpha halys])

HSP 1 Score: 429.098 bits (1102), Expect = 1.730e-143
Identity = 222/409 (54.28%), Postives = 273/409 (66.75%), Query Frame = 0
Query:  142 LTPTGAVQQYS-QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISI------------DMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P  ++  +S    +  +KKKGS++R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A            P S  NG   SI +            D    P  ++  KP+ PE+EELI+RLVYFQ EYEHPSE DL R+     ++ N  E +SD+ FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMMLR AR+YDA +DSI++A N P+ +E+Y+ AG+G+  ++L RFCR M  MK                      E  +VEKIQEIY++AL++YV    +      FAKLL VLTELR+LG  NSE+CFSLKL+N+KLPPFL EIWD+
Sbjct:   53 LSPANSLNGFSADSCDGSKKKKGSAARQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEYQCAVKRKEKKAQKDKDK------PVSTTNGSPESIKVEEPHRVVYKTESDTLGRPVPMNGIKPVSPEQEELIHRLVYFQNEYEHPSEEDLRRI-----NTPNEDEEQSDQRFRHLTEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMLRMARKYDANTDSILFANNQPYNRESYSLAGMGDVIEDLLRFCRHMYNMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYLEALKSYVDNRSRPRSPAIFAKLLSVLTELRTLGNQNSEMCFSLKLQNKKLPPFLAEIWDV 450          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|952543055|gb|ALO17612.1| (ecysone receptor isoform A [Schistocerca gregaria])

HSP 1 Score: 431.409 bits (1108), Expect = 3.460e-143
Identity = 253/521 (48.56%), Postives = 305/521 (58.54%), Query Frame = 0
Query:   31 PDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSS------PLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGS------ISIDMASFPKR--LSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P + S  ++    P  +  +FA A SSP      +  L  + +S+ GS + PSP        PHP           L    +       L N   SP S      P   G +     L+P  ++  YS    + +KKKG++ R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC   GMR ECVVPE  C  KR+ K A           D    N+  NGS        ID    P+R   +  KP+ PE+EELI+RLVYFQ EYE PSE DL RV   P       E +SD  FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMM R ARRYD  SDSI++A N P+TK++Y  AG+G   +++ RFCR M  MK                      E  +VEKIQEIY++AL+AYV   R+      FAKLL VLTELR+LG  NSE+CFSLKLKN+KLPPFL EIWD+
Sbjct:   42 PASVSDALVVKTEPREAGSLFA-AISSPGPGPAKRARLDSDWLSSPGSNAAPSP-------PPHP-----------LFGGAASAGAPAALPNGYASPLSSGGSYDPYSPGGKIGREDLSPLSSLNGYSADSCDAKKKKGAAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLTVGMRPECVVPEYQCAVKRKEKKAQK---------DKDKPNSTTNGSPEVMMLKDIDAKVEPERPLSNGIKPVSPEQEELIHRLVYFQNEYESPSEEDLRRVTSQPTE----GEDQSDVRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVNSDSILFANNQPYTKDSYNLAGMGETIEDMLRFCRQMYAMKVDNAEYALLTAIVIFSERPSLVEGWKVEKIQEIYLEALKAYVDNRRRPKSGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFLAEIWDV 530          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|1080033213|ref|XP_018560850.1| (PREDICTED: ecdysone receptor isoform X1 [Anoplophora glabripennis])

HSP 1 Score: 432.565 bits (1111), Expect = 4.007e-143
Identity = 228/427 (53.40%), Postives = 277/427 (64.87%), Query Frame = 0
Query:  128 SSPLENGLRHPNAP--------LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSST--------KPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            SSP+ +G   P +P        L+P  ++  YS    + +KKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A            P S  NG    I ++   F  +LS +        KP+ PE+EELI+RLVYFQ EYEHPSE D+ R+ + PM      E + D  FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMM R ARRYD +SDSI++  N P+++++Y  AG+G   ++L  FCR M  MK                      E  +VEKIQEIY++AL+AYV   RK      FAKLL VLTELR+LG  NSE+CFSLKLKN+KLPPFL EIWD++
Sbjct:  151 SSPMSSGSYDPYSPNGKIGREDLSPPSSLNGYSADSCDAKKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEVQCAVKRKEKKAQKEKDK------PNSTTNGSPEMIKLEPEMFFLQLSDSEKTLTNGVKPISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPME----GEDQCDIRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSILFVNNQPYSRDSYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYLEALRAYVDNRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFLAEIWDVD 567          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold106_size358372-processed-gene-0.6 (protein:Tk03534 transcript:snap_masked-scaffold106_size358372-processed-gene-0.6-mRNA-1 annotation:"ecdysone receptor")

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 284/490 (57.96%), Postives = 340/490 (69.39%), Query Frame = 0
Query:   66 QSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNN-------GKNGS--------ISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTN----SSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            Q ++++T S +  +   SP ++EIK  P     PP        Q+H+  N+   +++    P         +P  PLTP  AVQ+Y+++ ENERKKKG   RP EELC VCGDRASGYHYNALACEGCKGFFRRSITKNS+Y+CK+   CEIDMYMRRKCQACRLKKCY  GMRAECVVPE  C +KR  K A  AA   D +      NN       G  G+        +S +  S P  L+  + LKPEEEELINR+VY+Q+E+E+P+  DLNRVYHVP+H  N     +ESESDRLF+HMTEMTILTVQLIVEF+KHLPGF  LCR+DQ++LLKGCSSEVMMLRGARRYD + DSI+YATNYPF+K+NY KAGLGND LFRFCR M +M                      KEPKRVEKIQEIYV+ALQ+YVMA +KK  MV FAKLL VLTELRSLG NN++ CF+L++ NRKLP FL EIWDI+
Sbjct:   73 QPIYVDTSSPSSHFQASSPQITEIKTEPPSSFSPPVNGYGHAPQRHNSSNSS--VSSPSSQPGGFFVKSESNP--PLTPNQAVQEYARLQENERKKKGPVPRPQEELCTVCGDRASGYHYNALACEGCKGFFRRSITKNSSYSCKYGDGCEIDMYMRRKCQACRLKKCYTVGMRAECVVPESQCQKKRAIKQAQKAAQNGDASSTTLMANNSSLSGGMGGRGTPLAIGGPGLSSNHNSIPSALAP-RHLKPEEEELINRIVYYQDEFENPTAEDLNRVYHVPLHPVNNDATGNESESDRLFQHMTEMTILTVQLIVEFTKHLPGFPTLCREDQVSLLKGCSSEVMMLRGARRYDPQRDSIIYATNYPFSKDNYVKAGLGNDALFRFCRNMCKMKVDNAEYALITAIVIFSERHNVKEPKRVEKIQEIYVEALQSYVMAKQKKEPMVAFAKLLSVLTELRSLGNNNAKTCFNLRMINRKLPAFLAEIWDIK 557          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold1253_size52701-processed-gene-0.0 (protein:Tk01373 transcript:snap_masked-scaffold1253_size52701-processed-gene-0.0-mRNA-1 annotation:"ecdysone receptor")

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 284/490 (57.96%), Postives = 340/490 (69.39%), Query Frame = 0
Query:   66 QSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNN-------GKNGS--------ISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTN----SSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            Q ++++T S +  +   SP ++EIK  P     PP        Q+H+  N+   +++    P         +P  PLTP  AVQ+Y+++ ENERKKKG   RP EELC VCGDRASGYHYNALACEGCKGFFRRSITKNS+Y+CK+   CEIDMYMRRKCQACRLKKCY  GMRAECVVPE  C +KR  K A  AA   D +      NN       G  G+        +S +  S P  L+  + LKPEEEELINR+VY+Q+E+E+P+  DLNRVYHVP+H  N     +ESESDRLF+HMTEMTILTVQLIVEF+KHLPGF  LCR+DQ++LLKGCSSEVMMLRGARRYD + DSI+YATNYPF+K+NY KAGLGND LFRFCR M +M                      KEPKRVEKIQEIYV+ALQ+YVMA +KK  MV FAKLL VLTELRSLG NN++ CF+L++ NRKLP FL EIWDI+
Sbjct:   73 QPIYVDTSSPSSHFQASSPQITEIKTEPPSSFSPPVNGYGHAPQRHNSSNSS--VSSPSSQPGGFFVKSESNP--PLTPNQAVQEYARLQENERKKKGPVPRPQEELCTVCGDRASGYHYNALACEGCKGFFRRSITKNSSYSCKYGDGCEIDMYMRRKCQACRLKKCYTVGMRAECVVPESQCQKKRAIKQAQKAAQNGDASSTTLMANNSSLSGGMGGRGTPLAIGGPGLSSNHNSIPSALAP-RHLKPEEEELINRIVYYQDEFENPTAEDLNRVYHVPLHPVNNDATGNESESDRLFQHMTEMTILTVQLIVEFTKHLPGFPTLCREDQVSLLKGCSSEVMMLRGARRYDPQRDSIIYATNYPFSKDNYVKAGLGNDALFRFCRNMCKMKVDNAEYALITAIVIFSERHNVKEPKRVEKIQEIYVEALQSYVMAKQKKEPMVAFAKLLSVLTELRSLGNNNAKTCFNLRMINRKLPAFLAEIWDIK 557          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold192_size271026-snap-gene-1.22 (protein:Tk07205 transcript:maker-scaffold192_size271026-snap-gene-1.22-mRNA-1 annotation:"retinoid x receptor")

HSP 1 Score: 138.658 bits (348), Expect = 1.962e-36
Identity = 107/365 (29.32%), Postives = 155/365 (42.47%), Query Frame = 0
Query:  169 AEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEM-------TILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPK----------------------------RVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKL 498
            ++  C +CGDRASG HY   +CEGCKGFF+R++ K   Y C+ N  C ID   R +CQ CR  KC ATGMR E V  ER     + A+AA          V+  +   G  G ++ID                       R+V  +               H+       S  ESD L  HM              +Q +VE++KH+P F +L  +D+I L++   +E+++   A R   + D I++A +    +EN   AG+G+         + +MKE K                            +VE  +E     L+ Y   N  +N+   FAKLL  L  LRS+G+   E  F  KL
Sbjct:   64 SKHFCSICGDRASGKHYGVYSCEGCKGFFKRTVRKELVYACRENKACIIDKRQRNRCQYCRYMKCLATGMRREAVQEERNRGGHKGAEAA--------EPVESSTGAGGLGGEMAID-----------------------RIVAAE---------------HISEQGGAFSRQESDDLQAHMPGGFDGDQPNKRKMLQQLVEWAKHIPHFTDLKIEDRIKLIRAGWNELLIAGCAFRSMNQEDGILWADSQFIKRENAHLAGVGDIFDRVLVELVGKMKEMKMDKAELGCLRAIILFNPDAKGLEQDPALQVESFREKVYATLEEYCRTNH-ENEPSRFAKLLLRLPALRSIGLKCVEHLFFYKL 381          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold106_size358372-snap-gene-1.13 (protein:Tk03536 transcript:maker-scaffold106_size358372-snap-gene-1.13-mRNA-1 annotation:"ecdysone-inducible protein e75 isoform x3")

HSP 1 Score: 118.627 bits (296), Expect = 2.195e-28
Identity = 100/357 (28.01%), Postives = 158/357 (44.26%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYT-CKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECV----VPERTCIQKRQAKAAAAAAAXXDTTVDPKS----NNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN-----DELFRFCRAMSR-----------------------MKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSE 491
            LC VCGD+ASG+HY   +CEGCKGFFRRSI +   Y  C  N  C I    R +CQ CRLKKC A GM  + V    VP+R      +AK  AA       T + K     N++GK    +I  A +     +   ++P          + Q+    PS A  + +   PM          D      +E  +  V+ +  F+K +PGF+ L  DDQ+ LLK C  EV+++R A  +  E+  ++        KE   +   GN     D +F   + +++                       ++ P+ V+K+Q      L   ++     +  + F +L+ ++ +LR+L   ++E
Sbjct:    1 LCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCNILRINRNRCQYCRLKKCIAAGMSRDAVRFGRVPKR-----EKAKILAAMQTSRMKTQESKVLGEMNDDGKIIE-TIVRAHYDTCDYTRNKMEP----------FIQKAKAQPSFAICSGMT-CPMKG-----RPEDSFLEQFSERFMEHVRQVCTFAKLIPGFKCLHHDDQVTLLKSCVFEVLLVRLAGLF--ENQGLICLNGDIIRKETINQMPPGNAKFLMDSVFDLAQRLNQFRLSDAEIGLFCSVVIITADRPGLRNPELVQKMQNKLKMVLNKILLPQHADHPAI-FTELMTMIHDLRTLNTLHTE 332          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold743_size103610-snap-gene-0.17 (protein:Tk01116 transcript:maker-scaffold743_size103610-snap-gene-0.17-mRNA-1 annotation:"probable nuclear hormone receptor hr38-like")

HSP 1 Score: 113.235 bits (282), Expect = 1.096e-27
Identity = 97/384 (25.26%), Postives = 159/384 (41.41%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAK-------------------AAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMAN---RKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLME 509
            LC VCGD A+  HY    CEGCKGFF+R++ KN+ Y C  + +C +D   R +CQ CR +KC A GM  E V  +   ++ R+ +                     A   A  DT+ D   N        S+D + + +  +S + L+ +E  ++N     Q+ Y                H   SS                  +++I +F   +PG  ++   D+  L +    E+  LR A R   +SD   +       + N  +   G+    +  F R +  M                       +PKRVE +Q   +++L+ +V  N   +KK Q   F+++L  LT LRSL +   +  F LK+++    P ++E
Sbjct:   30 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDS--LKGRRGRLPSKPRSPQEQPPSPPVSLITALVRAHIDTSPDSSPN--------SLDFSQYME--ASVEELETKEGLVVNEATKIQQFY----------------HLLTSS------------------IEVIRKFCDRIPGINDILASDRELLFQSACLELFALRLAYRIQPDSDQFTFCHGLVLHR-NQCQHSFGDWLGSIMEFSRTLHAMDLDIQAFACLCALTLVTDRHGLSDPKRVENLQSKVINSLKDHVTYNPDAQKKQQY--FSRILERLTPLRSLSVQGLQRIFYLKMEDTVPVPAVIE 364          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1408_size42850-snap-gene-0.13 (protein:Tk00739 transcript:maker-scaffold1408_size42850-snap-gene-0.13-mRNA-1 annotation:"probable nuclear hormone receptor hr38-like")

HSP 1 Score: 113.235 bits (282), Expect = 1.096e-27
Identity = 97/384 (25.26%), Postives = 159/384 (41.41%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAK-------------------AAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMAN---RKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLME 509
            LC VCGD A+  HY    CEGCKGFF+R++ KN+ Y C  + +C +D   R +CQ CR +KC A GM  E V  +   ++ R+ +                     A   A  DT+ D   N        S+D + + +  +S + L+ +E  ++N     Q+ Y                H   SS                  +++I +F   +PG  ++   D+  L +    E+  LR A R   +SD   +       + N  +   G+    +  F R +  M                       +PKRVE +Q   +++L+ +V  N   +KK Q   F+++L  LT LRSL +   +  F LK+++    P ++E
Sbjct:   30 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDS--LKGRRGRLPSKPRSPQEQPPSPPVSLITALVRAHIDTSPDSSPN--------SLDFSQYME--ASVEELETKEGLVVNEATKIQQFY----------------HLLTSS------------------IEVIRKFCDRIPGINDILASDRELLFQSACLELFALRLAYRIQPDSDQFTFCHGLVLHR-NQCQHSFGDWLGSIMEFSRTLHAMDLDIQAFACLCALTLVTDRHGLSDPKRVENLQSKVINSLKDHVTYNPDAQKKQQY--FSRILERLTPLRSLSVQGLQRIFYLKMEDTVPVPAVIE 364          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold524_size146631-snap-gene-0.27 (protein:Tk03332 transcript:maker-scaffold524_size146631-snap-gene-0.27-mRNA-1 annotation:"steroid receptor seven- isoforms b c-like")

HSP 1 Score: 112.849 bits (281), Expect = 2.002e-26
Identity = 98/360 (27.22%), Postives = 150/360 (41.67%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSI----SIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLR-----------------GARRYDAESDSIVYATNY--PFTKENYAKAGLGNDE--------LFRFCRAMSRMKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNR 501
            C+VCGD++SG HY    CEGCK FF+RS+ +N  Y C+ + +C ID + R +CQ CRLKKC+  GMR E V       Q+ +   +AA A              G NG +    +  ++S+   L   +P             Y    Y     A  N +  +     N  E  +  LF              VE+S+++PGF  L   DQ+ LL+   SE+ +L                  G       +D +V   ++   F ++     GL  D         +  F      + E + +E++QE    AL+ Y   N+  NQ   F KLL  L  LR++  +  E  F ++L  +
Sbjct:  470 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYQCRGSRNCPIDQHHRNQCQHCRLKKCFKMGMRKEAV-------QRGRVPPSAAQAMI----------GFGFNGEVTHPGTTYLSSYISMLLRAEP-------------YHTSRYGQMQMAAANNMVGI----DNICEFAARLLFS------------AVEWSRNIPGFPELQVTDQVALLRLVWSELFVLNASQCNMPLHVAPLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKLKGLHVDSAEYSCMKAIVLFTSDACGLSEVQTIEQLQEKSQCALEEYC-RNQYPNQPTRFGKLLLRLPSLRTVSPSVIEQLFFVRLVGK 782          

HSP 2 Score: 111.309 bits (277), Expect = 6.511e-26
Identity = 90/321 (28.04%), Postives = 134/321 (41.74%), Query Frame = 0
Query:  141 PLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPF-TKENYAKAGL-----GNDELFRFCRAMSRMKEPKRVEKIQEIYVDA 455
            PLTP        Q      ++ G +    + +C+VCGD++SG HY    CEGCK FF+RS+ +N  Y C+ N +C ID   R +CQ CRLKKC   GMR E V         ++ + A    A    T       NG   S +  ++S+   L   +P             Y    Y     A  N +  +     N  E  +  LF              VE+S+++PGF  L   DQ+ LL+   SE+ +L  ++             N P       A AGL       D +  F   +   +E  +VEK++ ++VD+
Sbjct:   62 PLTPMSTTVHPPQESSISSEESGKNDDCQDIICVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYQCRGNRNCPIDQNHRNQCQHCRLKKCLKMGMRREAV---------QRGRVATTPQAMFGITF------NGDPLSGTTYLSSYISMLLRAEP-------------YHTSRYGQMQMAAANNMVGI----DNICEFAARLLFS------------AVEWSRNIPGFPELQVTDQVALLRLVWSELFVLNASQ------------CNMPLHVAPLLAAAGLHASPMAADRVVAFMDHIRIFQE--QVEKLKALHVDS 324          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1013_size70870-snap-gene-0.16 (protein:Tk07036 transcript:maker-scaffold1013_size70870-snap-gene-0.16-mRNA-1 annotation:"transcription factor hnf-4 homolog")

HSP 1 Score: 107.457 bits (267), Expect = 7.289e-25
Identity = 73/245 (29.80%), Postives = 121/245 (49.39%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKE 417
            C +CGD+A+G HY A +C+GCKGFFRRS+ K   Y C++  +C +    R +C+ CRL+KC   GM+ + V   R  I  +++               P+S ++  N SIS         LS T     E+ EL++R  + Q  Y+   +   NR       ++ +   +S +      ++ IL     VE++KH+P F +L  DDQ+ LL+  + E ++L   RR    +D ++   +    K+
Sbjct:  200 CAICGDKATGKHYGAASCDGCKGFFRRSVRKKQAYICRFYRNCVVTKDKRNQCRFCRLRKCMKAGMKTDSVQHTRDRISSKRST--------------PESESS--NPSIS--------GLSVT---TLEKAELLSR--HGQHGYDIQKDQLTNREIETKQLASIADIGDSMK-----QQLLIL-----VEWAKHIPAFCDLSIDDQVALLRAHAGEHLLLGVTRRSLHLNDILLLGNDMIIPKD 405          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold120_size336265-snap-gene-1.12 (protein:Tk08787 transcript:maker-scaffold120_size336265-snap-gene-1.12-mRNA-1 annotation:"nuclear receptor nhr-48")

HSP 1 Score: 102.064 bits (253), Expect = 3.120e-23
Identity = 41/83 (49.40%), Postives = 57/83 (68.67%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKR 253
            +LC VCGD+A GY++NAL CE CK FFRR+  KN ++ C ++  CE+ +  RR CQ CRLKKC+  GM+ E ++ +    QKR
Sbjct:  283 KLCAVCGDKALGYNFNALTCESCKAFFRRNALKNKDFKCPFSNKCEVTVVTRRFCQKCRLKKCFDIGMKKEWILSDEEKQQKR 365          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold58_size443543-processed-gene-3.1 (protein:Tk00704 transcript:snap_masked-scaffold58_size443543-processed-gene-3.1-mRNA-1 annotation:"nuclear hormone receptor")

HSP 1 Score: 90.1225 bits (222), Expect = 2.170e-22
Identity = 39/71 (54.93%), Postives = 49/71 (69.01%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAEC 242
            L L  GDR    HY A++CEGCKGFF+RSI K   Y C+ N DCE+  + R +CQ CRL+KC A GMR++C
Sbjct:    9 LSLTRGDRR---HYGAISCEGCKGFFKRSIRKQLGYQCRGNKDCEVTKHHRNRCQYCRLQKCLAMGMRSDC 76          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000005090 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-3.522e-8038.22symbol:nr1h3 "nuclear receptor subfamily 1, group ... [more]
-6.670e-7836.00symbol:Nr1h2 "nuclear receptor subfamily 1, group ... [more]
-8.323e-7836.00symbol:Nr1h2 "Oxysterols receptor LXR-beta" specie... [more]
-8.323e-7836.00symbol:Nr1h2 "nuclear receptor subfamily 1, group ... [more]
-1.348e-7736.41symbol:NR1H2 "Oxysterols receptor LXR-beta" specie... [more]
-2.063e-7636.67symbol:NR1H2 "Uncharacterized protein" species:982... [more]
-2.999e-7634.89symbol:NR1H2 "Uncharacterized protein" species:961... [more]
-3.298e-7538.12symbol:LXR "Liver X receptor" species:9031 "Gallus... [more]
-3.301e-7436.67symbol:NR1H2 "Oxysterols receptor LXR-beta" specie... [more]
-1.046e-6534.10symbol:NR1H2 "Oxysterols receptor LXR-beta" specie... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592844279|gb|GAXK01113265.1|3.810e-2526.45TSA: Calanus finmarchicus comp95139_c2_seq2 transc... [more]
gi|592844280|gb|GAXK01113264.1|3.840e-2526.45TSA: Calanus finmarchicus comp95139_c2_seq1 transc... [more]
gi|592853768|gb|GAXK01103776.1|4.169e-2460.56TSA: Calanus finmarchicus comp167181_c0_seq1 trans... [more]
gi|592874334|gb|GAXK01083228.1|9.736e-2339.37TSA: Calanus finmarchicus comp389578_c0_seq1 trans... [more]
gi|592874006|gb|GAXK01083556.1|1.268e-2243.10TSA: Calanus finmarchicus comp176094_c0_seq1 trans... [more]
gi|592848671|gb|GAXK01108873.1|1.669e-2256.34TSA: Calanus finmarchicus comp297344_c0_seq3 trans... [more]
gi|592848672|gb|GAXK01108872.1|2.270e-2256.34TSA: Calanus finmarchicus comp297344_c0_seq2 trans... [more]
gi|592848673|gb|GAXK01108871.1|2.450e-2256.34TSA: Calanus finmarchicus comp297344_c0_seq1 trans... [more]
gi|592878692|gb|GAXK01079209.1|3.160e-2224.66TSA: Calanus finmarchicus comp267685_c0_seq1 trans... [more]
gi|592814756|gb|GAXK01139812.1|8.878e-2247.06TSA: Calanus finmarchicus comp832560_c0_seq2 trans... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 25
Match NameE-valueIdentityDescription
EMLSAP000000050900.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s269:30685... [more]
EMLSAP000000019192.612e-2625.42pep:novel supercontig:LSalAtl2s:LSalAtl2s132:61643... [more]
EMLSAP000000073616.362e-2628.18pep:novel supercontig:LSalAtl2s:LSalAtl2s418:37435... [more]
EMLSAP000000124865.626e-2539.73pep:novel supercontig:LSalAtl2s:LSalAtl2s91:348479... [more]
EMLSAP000000099411.734e-2426.14pep:novel supercontig:LSalAtl2s:LSalAtl2s649:48408... [more]
EMLSAP000000130041.292e-2324.68pep:novel supercontig:LSalAtl2s:LSalAtl2s98:942409... [more]
EMLSAP000000080715.852e-2227.78pep:novel supercontig:LSalAtl2s:LSalAtl2s47:304551... [more]
EMLSAP000000099691.198e-2128.07pep:novel supercontig:LSalAtl2s:LSalAtl2s651:30270... [more]
EMLSAP000000089027.072e-2150.00pep:novel supercontig:LSalAtl2s:LSalAtl2s554:57230... [more]
EMLSAP000000044518.139e-2126.20pep:novel supercontig:LSalAtl2s:LSalAtl2s231:94591... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|205371750|sp|P49880.2|ECR_AEDAE1.228e-12242.10RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|1706576|sp|P49883.1|ECR_MANSE8.847e-12048.92RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|461984|sp|P34021.1|ECR_DROME1.542e-11945.62RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|146328613|sp|O18531.2|ECR_LUCCU1.693e-11847.11RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|6015050|sp|O18473.1|ECR_HELVI8.147e-11746.93RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|1706574|sp|P49881.1|ECR_BOMMO4.790e-11546.19RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|1706575|sp|P49882.1|ECR_CHITE1.936e-10645.17RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|341942229|sp|Q9Z0Y9.3|NR1H3_MOUSE1.095e-8238.52RecName: Full=Oxysterols receptor LXR-alpha; AltNa... [more]
gi|23503089|sp|Q13133.2|NR1H3_HUMAN1.892e-8238.52RecName: Full=Oxysterols receptor LXR-alpha; AltNa... [more]
gi|75060925|sp|Q5E9B6.1|NR1H3_BOVIN2.197e-8238.52RecName: Full=Oxysterols receptor LXR-alpha; AltNa... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EEB17490.14.222e-14751.07Ecdysone receptor, putative [Pediculus humanus cor... [more]
gb|KYB25531.1|2.163e-14353.32Ecdysone receptor-like Protein [Tribolium castaneu... [more]
gb|KYB25532.1|1.151e-14252.20Ecdysone receptor-like Protein [Tribolium castaneu... [more]
NP_001152827.14.206e-13954.39ecdysone receptor isoform B1 [Apis mellifera][more]
NP_001091685.24.987e-13954.39ecdysone receptor isoform A [Apis mellifera][more]
XP_016768787.15.139e-13954.39PREDICTED: ecdysone receptor isoform X1 [Apis mell... [more]
XP_006568116.15.139e-13954.39PREDICTED: ecdysone receptor isoform X1 [Apis mell... [more]
gb|KFM66857.1|1.493e-13655.21Ecdysone receptor, partial [Stegodyphus mimosarum][more]
gb|EEC03371.1|8.064e-13451.52AamEcRA1, putative [Ixodes scapularis][more]
AAM68346.15.116e-12244.95ecdysone receptor, isoform E [Drosophila melanogas... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|729058610|gb|AIZ04022.1|0.000e+094.59ecdysone receptor, partial [Lepeophtheirus salmoni... [more]
gi|291190960|gb|ADD82902.1|0.000e+057.14ecdysone receptor [Tigriopus japonicus][more]
gi|335355357|gb|AEH43772.1|1.325e-16056.02ecdysone receptor isoform 2 [Amphiascus tenuiremis... [more]
gi|1111332457|gb|APH81342.1|6.560e-15759.03ecdysone receptor [Paracyclopina nana][more]
gi|1110961968|gb|APG80611.1|6.778e-15759.03ecdysone receptor [Paracyclopina nana][more]
gi|242019559|ref|XP_002430228.1|2.066e-14451.07Ecdysone receptor, putative [Pediculus humanus cor... [more]
gi|939669806|ref|XP_014281743.1|1.410e-14354.28PREDICTED: ecdysone receptor isoform X1 [Halyomorp... [more]
gi|939669809|ref|XP_014281744.1|1.730e-14354.28PREDICTED: ecdysone receptor isoform X2 [Halyomorp... [more]
gi|952543055|gb|ALO17612.1|3.460e-14348.56ecysone receptor isoform A [Schistocerca gregaria][more]
gi|1080033213|ref|XP_018560850.1|4.007e-14353.40PREDICTED: ecdysone receptor isoform X1 [Anoplopho... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 25
Match NameE-valueIdentityDescription
snap_masked-scaffold106_size358372-processed-gene-0.60.000e+057.96protein:Tk03534 transcript:snap_masked-scaffold106... [more]
snap_masked-scaffold1253_size52701-processed-gene-0.00.000e+057.96protein:Tk01373 transcript:snap_masked-scaffold125... [more]
maker-scaffold192_size271026-snap-gene-1.221.962e-3629.32protein:Tk07205 transcript:maker-scaffold192_size2... [more]
maker-scaffold106_size358372-snap-gene-1.132.195e-2828.01protein:Tk03536 transcript:maker-scaffold106_size3... [more]
maker-scaffold743_size103610-snap-gene-0.171.096e-2725.26protein:Tk01116 transcript:maker-scaffold743_size1... [more]
maker-scaffold1408_size42850-snap-gene-0.131.096e-2725.26protein:Tk00739 transcript:maker-scaffold1408_size... [more]
maker-scaffold524_size146631-snap-gene-0.272.002e-2627.22protein:Tk03332 transcript:maker-scaffold524_size1... [more]
maker-scaffold1013_size70870-snap-gene-0.167.289e-2529.80protein:Tk07036 transcript:maker-scaffold1013_size... [more]
maker-scaffold120_size336265-snap-gene-1.123.120e-2349.40protein:Tk08787 transcript:maker-scaffold120_size3... [more]
snap_masked-scaffold58_size443543-processed-gene-3.12.170e-2254.93protein:Tk00704 transcript:snap_masked-scaffold58_... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s269supercontigLSalAtl2s269:306853..308464 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Descriptionecdysone receptor
Logic nameensemblgenomes
Biotypeprotein_coding
EvidenceIEA
NoteEcdysone receptor
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000005090 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000005090EMLSAT00000005090-700937Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s269:306853..308464-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000005090-687856 ID=EMLSAG00000005090-687856|Name=EMLSAG00000005090|organism=Lepeophtheirus salmonis|type=gene|length=1612bp|location=Sequence derived from alignment at LSalAtl2s269:306853..308464- (Lepeophtheirus salmonis)
ATGTCAACAACTCAATATACGGCTATAATTCAGCCTCGCCCAMCTCACGA TTCRGTGGTYCCTGCCGTTAAACGATTTCGTCCTAATCCTCCAGATAATT CTTCGCCAACTGTTATTGGACTTCCTCCACCGCCTTCCAGTTCGCCAATA TTCGCTAGTGCCTCGTCTTCTCCTTTGATTCACCAACAGCACCAACAATC TCTTTTCATAGAAACTATGAGTAACAATGGGTCTTACTCGACCCCTTCTC CTATACTCTCCGAAATTAAGMCTGAMCCCCATCCTTMCYCCCCGCCMCCT CCGCCAACAACGACGACCCTCCACCAACAGCACTCCCAACAAAATACACA CTATTACCTGAATAACTCGGGAGAAAGTCCCTCTTCTCCATTGGAGAATG GACTGCGACATCCTAATGCTCCTTTAACACCTACTGGAGCTGTTCAGCAG TACTCTCAGATGGTGGAAAATGAGAGGAAAAAGAAAGGATCTTCCTCTCG CCCTGCCGAAGAGTTATGTCTTGTCTGTGGAGATCGAGCATCGGGTTATC ATTATAATGCATTGGCATGTGAGGGATGCAAAGGGTTCTTTCGACGTTCT ATTACCAAAAACTCTAACTATACTTGCAAATGGAATGGGGATTGTGAAAT TGATATGTATATGAGGCGAAAATGTCAGGCGTGTAGACTAAAAAAATGTT ATGCCACGGGTATGAGGGCAGAGTGTGTTGTGCCAGAAAGGACTTGCATT CAGAAAAGACAAGCTAAAGCTGCAGCCGCTGCCGCAGCTSCASCCGACAC AACTGTAGATCCTAAGTCCAATAACAACGGTAAAAATGGAAGCATATCCA TAGATATGGCTTCTTTTCCTAAAAGACTTTCATCCACCAAACCTTTAAAG CCAGAAGAAGAGGAGCTAATTAATCGTTTGGTATATTTTCAAGAAGAATA CGAGCATCCATCTGAAGCGGACCTTAACCGTGTTTACCATGTTCCTATGC ACAGTACTAATTCATCCGAATCCGAGTCTGACCGTTTATTCCGTCATATG ACAGAGATGACTATTCTTACAGTTCAATTAATAGTTGAGTTCTCCAAGCA CCTGCCGGGCTTCCAGAATCTTTGCAGAGACGATCAAATTAATTTACTTA AAGGCTGTTCCTCAGAAGTGATGATGCTGAGGGGAGCCCGTCGTTATGAT GCCGAGTCAGACTCTATTGTTTATGCAACGAACTATCCTTTTACGAAAGA AAATTACGCTAAGGCGGGGCTTGGCAATGACGAGCTCTTTCGTTTCTGCA GGGCCATGTCTCGAATGAAAGTACGATAACGCAGAATACGCTCTCATAAC AGCTATTGTCATTTTTAGTGATAGAAACTCCTTAAAGGAACCTAAAAGAG TTGAAAAGATTCAAGAGATTTATGTAGATGCTCTACAAGCCTACGTAATG GCAAATCGGAAAAAGAATCAAATGGTTACCTTTGCGAAGTTGTTATATGT CCTTACTGAGCTTCGATCCTTAGGGATCAACAACTCAGAACTTTGCTTCT CTCTTAAGCTTAAAAACCGAAAATTGCCCCCATTTCTCATGGAAATTTGG GACATCGAATGA
back to top
Add to Basket