EMLSAG00000005090, EMLSAG00000005090-687856 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000005090
Unique NameEMLSAG00000005090-687856
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
B F18 EcR female
  1. PreAdult2
No eggstrings
-Missing-
12.03.2012 - 10:23
18.04.2014 (All day)
Molecular characterisation of the salmon louse,... more
J F18 EcR female
  1. PreAdult
  2. Adult
-Missing-
-Missing-
27.02.2013 - 15:02
11.03.2013 (All day)
Molecular characterisation of the salmon louse,... more
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: female reproduction, no eggstrings
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
D F39 EcR female
  1. PreAdult2
No eggstring production
female reproduction, no eggstrings
24.08.2012 - 10:39
Molecular characterisation of the salmon louse,... more
Homology
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:NR1H4 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004887 "thyroid hormone receptor activity" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR001728 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PRINTS:PR00546 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0005634 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0006357 GO:GO:0006366 GO:GO:0030522 GO:GO:0004887 GeneTree:ENSGT00720000108423 OrthoDB:EOG7DC25S KO:K08537 EMBL:AAEX03009974 GeneID:612928 RefSeq:XP_005629332.1 Ensembl:ENSCAFT00000044453 Uniprot:J9P1S1)

HSP 1 Score: 223.016 bits (567), Expect = 1.816e-64
Identity = 153/429 (35.66%), Postives = 218/429 (50.82%), Query Frame = 0
Query:  119 YLNNSGESPSSPLE---NG---LRHPNAPLTPTGAVQQYSQMVENERKKKGSSSR-PAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDE---LFRFCRAMSRMK---------------EPKR--------VEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            Y +N G  P  P E   +G   LR   A     G ++     V  + +   S+ R   +ELC+VCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK  G+C +DMYMRRKCQ CRL+KC   GM AEC++ E  C  KR  K     A   D T+     N    G     + S  K       L P+++ L++ ++    +   P E   N++           E  ++  F  +TEM    VQ++VEF+K LPGFQ L  +DQI LLKG + E M LR A  ++ +    + A +    +E   K+G+ ++    +F F ++++ +K                P R        VEK+QE  +D LQ      + +N    FA LL  LTELR+   +++E+  S ++ + K  P L EIWD++
Sbjct:   66 YYSNLGFYPQHPEEWYSSGIYELRRMPAETVYQGEIEVAEIPVTKKARMGASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQECRLRKCKEMGMLAECLLTEIQCKSKRLRKNVKQHA---DQTI-----NEDSEGRDLRQVTSTTKSCREKTELTPDQQNLLHYIMDSYSKQRMPQEI-ANKIL--------KEEFSAEENFLILTEMATSHVQILVEFTKTLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKK----LPAGHADLLEERIRKSGISDEYITPMFSFYKSVAELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIYQPENPQ-HFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ 472          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:NR1H4 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0000980 "RNA polymerase II distal enhancer sequence-specific DNA binding" evidence=IEA] [GO:0001190 "RNA polymerase II transcription factor binding transcription factor activity involved in positive regulation of transcription" evidence=IEA] [GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IEA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004887 "thyroid hormone receptor activity" evidence=IEA] [GO:0005719 "nuclear euchromatin" evidence=IEA] [GO:0008206 "bile acid metabolic process" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0034255 "regulation of urea metabolic process" evidence=IEA] [GO:0038181 "bile acid receptor activity" evidence=IEA] [GO:0038185 "intracellular bile acid receptor signaling pathway" evidence=IEA] [GO:0046965 "retinoid X receptor binding" evidence=IEA] [GO:0070858 "negative regulation of bile acid biosynthetic process" evidence=IEA] [GO:0071229 "cellular response to acid" evidence=IEA] [GO:0071417 "cellular response to organonitrogen compound" evidence=IEA] [GO:1902122 "chenodeoxycholic acid binding" evidence=IEA] [GO:2001250 "positive regulation of ammonia assimilation cycle" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR001728 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PRINTS:PR00546 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0008206 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0071417 GO:GO:0003705 GO:GO:0000980 GO:GO:0000122 GO:GO:0006366 GO:GO:0001190 GO:GO:0005719 GO:GO:0071229 GO:GO:0004887 GeneTree:ENSGT00720000108423 GO:GO:0070858 GO:GO:0038181 KO:K08537 OMA:MKPAKGV TreeFam:TF316304 GO:GO:1902122 GO:GO:0038185 GO:GO:2001250 GO:GO:0034255 EMBL:AAEX03009974 RefSeq:XP_005629331.1 Ensembl:ENSCAFT00000011000 GeneID:612928 Uniprot:E2RCF6)

HSP 1 Score: 223.016 bits (567), Expect = 2.344e-64
Identity = 153/429 (35.66%), Postives = 218/429 (50.82%), Query Frame = 0
Query:  119 YLNNSGESPSSPLE---NG---LRHPNAPLTPTGAVQQYSQMVENERKKKGSSSR-PAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDE---LFRFCRAMSRMK---------------EPKR--------VEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            Y +N G  P  P E   +G   LR   A     G ++     V  + +   S+ R   +ELC+VCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK  G+C +DMYMRRKCQ CRL+KC   GM AEC++ E  C  KR  K     A   D T+     N    G     + S  K       L P+++ L++ ++    +   P E   N++           E  ++  F  +TEM    VQ++VEF+K LPGFQ L  +DQI LLKG + E M LR A  ++ +    + A +    +E   K+G+ ++    +F F ++++ +K                P R        VEK+QE  +D LQ      + +N    FA LL  LTELR+   +++E+  S ++ + K  P L EIWD++
Sbjct:   75 YYSNLGFYPQHPEEWYSSGIYELRRMPAETVYQGEIEVAEIPVTKKARMGASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQECRLRKCKEMGMLAECLLTEIQCKSKRLRKNVKQHA---DQTI-----NEDSEGRDLRQVTSTTKSCREKTELTPDQQNLLHYIMDSYSKQRMPQEI-ANKIL--------KEEFSAEENFLILTEMATSHVQILVEFTKTLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKK----LPAGHADLLEERIRKSGISDEYITPMFSFYKSVAELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIYQPENPQ-HFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ 481          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:FXR "Farnesoid X receptor" species:9031 "Gallus gallus" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0000980 "RNA polymerase II distal enhancer sequence-specific DNA binding" evidence=IEA] [GO:0001190 "RNA polymerase II transcription factor binding transcription factor activity involved in positive regulation of transcription" evidence=IEA] [GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IEA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004887 "thyroid hormone receptor activity" evidence=IEA] [GO:0005719 "nuclear euchromatin" evidence=IEA] [GO:0008206 "bile acid metabolic process" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0034255 "regulation of urea metabolic process" evidence=IEA] [GO:0038181 "bile acid receptor activity" evidence=IEA] [GO:0038185 "intracellular bile acid receptor signaling pathway" evidence=IEA] [GO:0046965 "retinoid X receptor binding" evidence=IEA] [GO:0070858 "negative regulation of bile acid biosynthetic process" evidence=IEA] [GO:0071229 "cellular response to acid" evidence=IEA] [GO:0071417 "cellular response to organonitrogen compound" evidence=IEA] [GO:1902122 "chenodeoxycholic acid binding" evidence=IEA] [GO:2001250 "positive regulation of ammonia assimilation cycle" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR001728 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PRINTS:PR00546 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0008206 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0071417 GO:GO:0003705 GO:GO:0000980 GO:GO:0000122 GO:GO:0006366 GO:GO:0001190 GO:GO:0005719 GO:GO:0071229 GO:GO:0004887 GeneTree:ENSGT00720000108423 OrthoDB:EOG7DC25S GO:GO:0070858 GO:GO:0038181 HOVERGEN:HBG108655 CTD:9971 eggNOG:NOG302915 HOGENOM:HOG000220843 KO:K08537 OMA:MKPAKGV TreeFam:TF316304 GO:GO:1902122 GO:GO:0038185 GO:GO:2001250 GO:GO:0034255 EMBL:AADN03000781 EMBL:AF492497 RefSeq:NP_989444.1 UniGene:Gga.127 ProteinModelPortal:Q8JHU2 SMR:Q8JHU2 STRING:9031.ENSGALP00000018906 Ensembl:ENSGALT00000018929 GeneID:373902 KEGG:gga:373902 InParanoid:Q8JHU2 NextBio:20813434 PRO:PR:Q8JHU2 Uniprot:Q8JHU2)

HSP 1 Score: 221.09 bits (562), Expect = 1.199e-63
Identity = 139/372 (37.37%), Postives = 193/372 (51.88%), Query Frame = 0
Query:  169 AEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRMK---------------EPKR--------VEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
             EELC+VCGD+ASGYHYNAL CEGCKGFFRRSITKN+ Y CK  G+CE+DMYMRRKCQ CRL+KC   GM AEC++ E  C  KR  K         D TV     N    G     + S  K         PE++ L++ ++    + + P E     V    +H   S+E      F  +TEM    VQ++VEF+K LPGFQ L  +DQI LLKG + E M LR A  +  +    +   +    +E    +G+ ++    +F F +++  +K                P R        VE++QE  +D LQ +   +   N    FA LL  LTELR+   +++E+  S ++ + K  P L EIWD++
Sbjct:  124 GEELCVVCGDKASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCEMDMYMRRKCQECRLRKCKQMGMLAECLLTEIQCKSKRLRKNVKQLP---DQTV-----NEDNEGHDMKQVTSTTKMYREKVEFTPEQQNLLDYIMDSYSKQQIPQE-----VSKKLLHEEFSAEGN----FLILTEMATSHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFSRK----LPTGHTVLLEERIRNSGISDEFITPMFNFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDRESVERLQEPLLDILQKFCKLHHPDNPQ-HFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ 473          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:Nr1h4 "Bile acid receptor" species:10116 "Rattus norvegicus" [GO:0000980 "RNA polymerase II distal enhancer sequence-specific DNA binding" evidence=IEA] [GO:0001190 "RNA polymerase II transcription factor binding transcription factor activity involved in positive regulation of transcription" evidence=IEA] [GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IEA] [GO:0004887 "thyroid hormone receptor activity" evidence=IEA] [GO:0005719 "nuclear euchromatin" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0032052 "bile acid binding" evidence=IPI] [GO:0034255 "regulation of urea metabolic process" evidence=IEA] [GO:0038181 "bile acid receptor activity" evidence=IDA] [GO:0038185 "intracellular bile acid receptor signaling pathway" evidence=IEA] [GO:0046965 "retinoid X receptor binding" evidence=IEA] [GO:0070858 "negative regulation of bile acid biosynthetic process" evidence=IEA] [GO:0071229 "cellular response to acid" evidence=IEA] [GO:0071417 "cellular response to organonitrogen compound" evidence=IEA] [GO:1902122 "chenodeoxycholic acid binding" evidence=IEA] [GO:2001250 "positive regulation of ammonia assimilation cycle" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR001728 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PRINTS:PR00546 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 RGD:628831 GO:GO:0005634 GO:GO:0006109 GO:GO:0008206 GO:GO:0003677 GO:GO:0009749 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0032496 GO:GO:0045944 GO:GO:0071417 GO:GO:0003705 GO:GO:0000980 GO:GO:0000122 GO:GO:0006366 GO:GO:0042277 GO:GO:0001190 GO:GO:0005719 GO:GO:0032052 GO:GO:0048565 GO:GO:0071229 GO:GO:0004887 GeneTree:ENSGT00720000108423 OrthoDB:EOG7DC25S GO:GO:0070858 GO:GO:0038181 PDB:1OSV PDBsum:1OSV HOVERGEN:HBG108655 CTD:9971 eggNOG:NOG302915 HOGENOM:HOG000220843 KO:K08537 OMA:MKPAKGV GO:GO:1902122 GO:GO:0038185 GO:GO:2001250 GO:GO:0034255 EMBL:U18374 PIR:A56918 RefSeq:NP_068513.1 UniGene:Rn.42943 PDB:1OT7 PDBsum:1OT7 ProteinModelPortal:Q62735 SMR:Q62735 PhosphoSite:Q62735 PRIDE:Q62735 Ensembl:ENSRNOT00000009910 GeneID:60351 KEGG:rno:60351 UCSC:RGD:628831 EvolutionaryTrace:Q62735 NextBio:612015 PRO:PR:Q62735 Genevestigator:Q62735 Uniprot:Q62735)

HSP 1 Score: 219.935 bits (559), Expect = 3.053e-63
Identity = 144/379 (37.99%), Postives = 199/379 (52.51%), Query Frame = 0
Query:  169 AEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELI----NRLVYFQEEYEHPSEADLNRVYHVPMHSTN---SSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDE---LFRFCRAMSRMK---------------EPKR--------VEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
             +ELC+VCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK  G+C +DMYMRRKCQ CRL+KC   GM AEC++ E  C  KR  K     A   D TV+  S   G++           ++++ST  L  E+ EL       L Y  + Y             +P   TN     E  ++  F  +TEM    VQ++VEF+K LPGFQ L  +DQI LLKG + E M LR A  ++ +    + A +    +E   K+G+ ++    +F F +++  +K                P R        VEK+QE  +D LQ      + +N    FA LL  LTELR+   +++E+  S ++ + K  P L EIWD++
Sbjct:  120 GDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQDCRLRKCREMGMLAECLLTEIQCKSKRLRKNVKQHA---DQTVNEDS--EGRD----------LRQVTSTTKLCREKTELTVDQQTLLDYIMDSYSKQ---------RMPQEITNKILKEEFSAEENFLILTEMATSHVQILVEFTKRLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKK----LPAGHADLLEERIRKSGISDEYITPMFSFYKSVGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIYQPENPQ-HFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ 469          
BLAST of EMLSAG00000005090 vs. GO
Match: - (symbol:Nr1h4 "nuclear receptor subfamily 1, group H, member 4" species:10116 "Rattus norvegicus" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=ISO;IMP] [GO:0000980 "RNA polymerase II distal enhancer sequence-specific DNA binding" evidence=IEA;ISO] [GO:0001190 "RNA polymerase II transcription factor binding transcription factor activity involved in positive regulation of transcription" evidence=IEA;ISO] [GO:0003677 "DNA binding" evidence=IDA] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISO] [GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IEA;ISO] [GO:0003707 "steroid hormone receptor activity" evidence=IDA] [GO:0004872 "receptor activity" evidence=IDA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=ISO] [GO:0004887 "thyroid hormone receptor activity" evidence=IEA] [GO:0005634 "nucleus" evidence=IDA] [GO:0005719 "nuclear euchromatin" evidence=IEA;ISO] [GO:0006109 "regulation of carbohydrate metabolic process" evidence=IMP] [GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=ISO] [GO:0006366 "transcription from RNA polymerase II promoter" evidence=ISO] [GO:0008206 "bile acid metabolic process" evidence=ISO;IDA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0009749 "response to glucose" evidence=IEP] [GO:0030522 "intracellular receptor signaling pathway" evidence=ISO] [GO:0032052 "bile acid binding" evidence=ISO;IDA;IPI] [GO:0032496 "response to lipopolysaccharide" evidence=IEP] [GO:0034255 "regulation of urea metabolic process" evidence=IEA;ISO] [GO:0038181 "bile acid receptor activity" evidence=ISO;IDA] [GO:0038185 "intracellular bile acid receptor signaling pathway" evidence=IEA;ISO] [GO:0042277 "peptide binding" evidence=IDA] [GO:0043565 "sequence-specific DNA binding" evidence=ISO] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=ISO;IMP] [GO:0046965 "retinoid X receptor binding" evidence=IEA;ISO] [GO:0048565 "digestive tract development" evidence=IEP] [GO:0070858 "negative regulation of bile acid biosynthetic process" evidence=IEA;ISO] [GO:0071229 "cellular response to acid" evidence=IEA;ISO] [GO:0071417 "cellular response to organonitrogen compound" evidence=IEA;ISO] [GO:1902122 "chenodeoxycholic acid binding" evidence=IEA;ISO] [GO:2000213 "positive regulation of glutamate metabolic process" evidence=ISO] [GO:2001250 "positive regulation of ammonia assimilation cycle" evidence=IEA;ISO] [GO:0003690 "double-stranded DNA binding" evidence=IDA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR001728 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PRINTS:PR00546 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 RGD:628831 GO:GO:0005634 GO:GO:0006109 GO:GO:0008206 GO:GO:0003677 GO:GO:0009749 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0032496 GO:GO:0045944 GO:GO:0071417 GO:GO:0003705 GO:GO:0000980 GO:GO:0000122 GO:GO:0006366 GO:GO:0042277 GO:GO:0001190 GO:GO:0005719 GO:GO:0032052 GO:GO:0048565 GO:GO:0071229 GO:GO:0004887 GeneTree:ENSGT00720000108423 OrthoDB:EOG7DC25S GO:GO:0070858 GO:GO:0038181 PDB:1OSV PDBsum:1OSV HOVERGEN:HBG108655 CTD:9971 eggNOG:NOG302915 HOGENOM:HOG000220843 KO:K08537 OMA:MKPAKGV GO:GO:1902122 GO:GO:0038185 GO:GO:2001250 GO:GO:0034255 EMBL:U18374 PIR:A56918 RefSeq:NP_068513.1 UniGene:Rn.42943 PDB:1OT7 PDBsum:1OT7 ProteinModelPortal:Q62735 SMR:Q62735 PhosphoSite:Q62735 PRIDE:Q62735 Ensembl:ENSRNOT00000009910 GeneID:60351 KEGG:rno:60351 UCSC:RGD:628831 EvolutionaryTrace:Q62735 NextBio:612015 PRO:PR:Q62735 Genevestigator:Q62735 Uniprot:Q62735)

HSP 1 Score: 219.935 bits (559), Expect = 3.053e-63
Identity = 144/379 (37.99%), Postives = 199/379 (52.51%), Query Frame = 0
Query:  169 AEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELI----NRLVYFQEEYEHPSEADLNRVYHVPMHSTN---SSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDE---LFRFCRAMSRMK---------------EPKR--------VEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
             +ELC+VCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK  G+C +DMYMRRKCQ CRL+KC   GM AEC++ E  C  KR  K     A   D TV+  S   G++           ++++ST  L  E+ EL       L Y  + Y             +P   TN     E  ++  F  +TEM    VQ++VEF+K LPGFQ L  +DQI LLKG + E M LR A  ++ +    + A +    +E   K+G+ ++    +F F +++  +K                P R        VEK+QE  +D LQ      + +N    FA LL  LTELR+   +++E+  S ++ + K  P L EIWD++
Sbjct:  120 GDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQDCRLRKCREMGMLAECLLTEIQCKSKRLRKNVKQHA---DQTVNEDS--EGRD----------LRQVTSTTKLCREKTELTVDQQTLLDYIMDSYSKQ---------RMPQEITNKILKEEFSAEENFLILTEMATSHVQILVEFTKRLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKK----LPAGHADLLEERIRKSGISDEYITPMFSFYKSVGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIYQPENPQ-HFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ 469          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592844279|gb|GAXK01113265.1| (TSA: Calanus finmarchicus comp95139_c2_seq2 transcribed RNA sequence)

HSP 1 Score: 112.464 bits (280), Expect = 3.810e-25
Identity = 96/363 (26.45%), Postives = 158/363 (43.53%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQXXXXXXXXXXXDTTVDPXXXXXXXXXXXXXDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMV-TFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLME 509
            LC VCGD A+  HY    CEGCKGFF+R++ KN+ Y C  + +C +D   R +CQ CR +KC   GM  E V      ++ R+ +  +   +  +T   P  +         +D          T P      +L N L Y Q  Y   SE DL          +   E+E+ ++ +    +T  ++ +I  F + +PG   L   D+  L +    E+  LR A R   ES    + +     + N A++  G+  + +    R++  M+                      EPK VE +Q   +++L+ +V  N    +    F+++L  L +LRSL +   +  F LKL++    P L+E
Sbjct: 1832 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLTVGMVKEVV--RTDSLKGRRGRLPSKPKSPQETPPSPPVSLITALVRAHVD----------TNP------DLSN-LDYSQ--YVEISEEDLET-------KSGLMENEAAKITQFYNLLTT-SIDVIRNFCERIPGISELSNKDRELLFQSACLELFTLRLAYRTQPESLKFTFCSGLVLHR-NQARSTFGDWLNGIIELSRSLHSMELDVSAFSCLAALTLVNERHGLSEPKIVENLQNKIINSLRDHVTYNSDAQRKPHYFSRILDKLPQLRSLSVQGLQRIFYLKLEDLVQAPPLIE 2830          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592844280|gb|GAXK01113264.1| (TSA: Calanus finmarchicus comp95139_c2_seq1 transcribed RNA sequence)

HSP 1 Score: 112.464 bits (280), Expect = 3.840e-25
Identity = 96/363 (26.45%), Postives = 158/363 (43.53%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQXXXXXXXXXXXDTTVDPXXXXXXXXXXXXXDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMV-TFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLME 509
            LC VCGD A+  HY    CEGCKGFF+R++ KN+ Y C  + +C +D   R +CQ CR +KC   GM  E V      ++ R+ +  +   +  +T   P  +         +D          T P      +L N L Y Q  Y   SE DL          +   E+E+ ++ +    +T  ++ +I  F + +PG   L   D+  L +    E+  LR A R   ES    + +     + N A++  G+  + +    R++  M+                      EPK VE +Q   +++L+ +V  N    +    F+++L  L +LRSL +   +  F LKL++    P L+E
Sbjct: 1832 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLTVGMVKEVV--RTDSLKGRRGRLPSKPKSPQETPPSPPVSLITALVRAHVD----------TNP------DLSN-LDYSQ--YVEISEEDLET-------KSGLMENEAAKITQFYNLLTT-SIDVIRNFCERIPGISELSNKDRELLFQSACLELFTLRLAYRTQPESLKFTFCSGLVLHR-NQARSTFGDWLNGIIELSRSLHSMELDVSAFSCLAALTLVNERHGLSEPKIVENLQNKIINSLRDHVTYNSDAQRKPHYFSRILDKLPQLRSLSVQGLQRIFYLKLEDLVQAPPLIE 2830          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592853768|gb|GAXK01103776.1| (TSA: Calanus finmarchicus comp167181_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 108.997 bits (271), Expect = 4.169e-24
Identity = 43/71 (60.56%), Postives = 55/71 (77.46%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAE 241
            ELC+VCGDRASG HY A++CEGCKGFF+RSI K   Y C+ N +CE+  + R +CQ CRL+KC A GMR++
Sbjct: 2397 ELCVVCGDRASGRHYGAISCEGCKGFFKRSIRKQLGYQCRGNKECEVTKHARNRCQYCRLQKCLAMGMRSD 2609          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592874334|gb|GAXK01083228.1| (TSA: Calanus finmarchicus comp389578_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 104.375 bits (259), Expect = 9.736e-23
Identity = 50/127 (39.37%), Postives = 73/127 (57.48%), Query Frame = 0
Query:  135 LRHPNAPLTPTGAV--------QQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKR 253
            L HP AP +P  +V         +       + +  GS S    + C +CGDRA+G HY A +C+GCKGFFRRS+ K   Y+C+++ +C +D   R +C+ CRL+KC+  GM+ + V  ER  I KR
Sbjct:  515 LLHPPAPPSPINSVPSLVNDDIAELDHSHSPDLQCNGSQSGVIPQNCAICGDRATGKHYGAASCDGCKGFFRRSVRKKHAYSCRFSRNCTVDKDKRNQCRYCRLRKCFKAGMKKDAVQNERDRISKR 895          

HSP 2 Score: 41.2022 bits (95), Expect = 8.057e-3
Identity = 27/107 (25.23%), Postives = 53/107 (49.53%), Query Frame = 0
Query:  360 LIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATN--YPFTKENYAKAGLG--NDELFR--FCRAMSRMKEPKRVEKIQEIYVDALQAYV 460
            ++VE++KH+P F  L  DDQ+ LL+  + E ++L  ARR     + ++   +   P    ++  A +    D + R    R M+ + +P +  ++ +     L+A V
Sbjct: 1088 ILVEWAKHIPAFSELVLDDQVALLRAHAGEHLLLGLARRSMNLQNILLLGNDMIIPRDIRDWGTAWITEPQDTVVRDIGIRVMNELVQPFKAIQMDDTEFACLKAIV 1408          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592874006|gb|GAXK01083556.1| (TSA: Calanus finmarchicus comp176094_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 104.375 bits (259), Expect = 1.268e-22
Identity = 50/116 (43.10%), Postives = 68/116 (58.62%), Query Frame = 0
Query:  133 NGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEEL-CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPER 247
            +GL  P     P+  + Q S   + +          A++L C+VCGD++SG HY  + CEGCK FF+RS+ +N  Y C+ N +C ID + R +CQ CRLKKCY  GMR E V P R
Sbjct:  700 SGLISPTTTCIPSSNMSQSS---DGDSTNLKDGDLGADDLQCVVCGDKSSGKHYGQVTCEGCKSFFKRSVRRNLTYQCRGNKNCPIDQHHRNQCQHCRLKKCYKMGMRKEAVQPGR 1038          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592848671|gb|GAXK01108873.1| (TSA: Calanus finmarchicus comp297344_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 102.834 bits (255), Expect = 1.669e-22
Identity = 40/71 (56.34%), Postives = 54/71 (76.06%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAE 241
            E C+VCGDRASG HY  ++CEGCKGFF+RS+ K+  Y C+ N DC+++   R +CQ CRL+KC A GMR++
Sbjct: 1186 EFCVVCGDRASGRHYGVVSCEGCKGFFKRSMRKDQGYRCRLNKDCDVNKNYRNRCQYCRLQKCLAMGMRSD 1398          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592848672|gb|GAXK01108872.1| (TSA: Calanus finmarchicus comp297344_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 102.834 bits (255), Expect = 2.270e-22
Identity = 40/71 (56.34%), Postives = 54/71 (76.06%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAE 241
            E C+VCGDRASG HY  ++CEGCKGFF+RS+ K+  Y C+ N DC+++   R +CQ CRL+KC A GMR++
Sbjct: 1344 EFCVVCGDRASGRHYGVVSCEGCKGFFKRSMRKDQGYRCRLNKDCDVNKNYRNRCQYCRLQKCLAMGMRSD 1556          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592848673|gb|GAXK01108871.1| (TSA: Calanus finmarchicus comp297344_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 102.834 bits (255), Expect = 2.450e-22
Identity = 40/71 (56.34%), Postives = 54/71 (76.06%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAE 241
            E C+VCGDRASG HY  ++CEGCKGFF+RS+ K+  Y C+ N DC+++   R +CQ CRL+KC A GMR++
Sbjct: 1407 EFCVVCGDRASGRHYGVVSCEGCKGFFKRSMRKDQGYRCRLNKDCDVNKNYRNRCQYCRLQKCLAMGMRSD 1619          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592878692|gb|GAXK01079209.1| (TSA: Calanus finmarchicus comp267685_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 103.219 bits (256), Expect = 3.160e-22
Identity = 90/365 (24.66%), Postives = 156/365 (42.74%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQXXXXXXXXXXXDTTVDPXXXXXXXXXXXXXDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN-----DELFRFCRAMS-------------------RMKEPKRVEKIQEIYVDALQAYVMAN---RKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLME 509
            LC VCGD A+  HY    CEGCKGFF+R++ KN+ Y C  + +C +D   R +CQ CR +KC A GM  E V  +   ++ R+ +      +  D    P            ++     + L  ++ ++  +EE+ ++      E      A +++ Y +   S        D +F+               F   +PGF +LC+ D+  L +    E+  LR + R    S  + +  N      N  ++  G+      EL +  +A+                     + EPK+VE +Q   +++L+ +V  N   ++K Q   F+++L  L  LRSL     +  F L+L+     P ++E
Sbjct: 1161 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDG--LKGRRGRLPTKPRSNQDPPPSPPVAMITSLVRAHVESTPKLESLDYSQYVEMNDEEMDSKAGLIALE-----AARISQFYSLLTSSI-------DVIFK---------------FCDKIPGFNDLCKQDRELLFRSACLELFTLRLSHRTLPNSMKLTFC-NGTVLHRNQVRSTFGDWLNGITELSKSLQAIDIDASAYACLSALTLVNERHGLLEPKKVENLQTKIINSLRDHVTYNPDAQRKPQY--FSRILDKLQVLRSLSQQALQRIFYLRLEGLVPEPPIIE 2159          
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Match: gi|592814756|gb|GAXK01139812.1| (TSA: Calanus finmarchicus comp832560_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 99.7525 bits (247), Expect = 8.878e-22
Identity = 48/102 (47.06%), Postives = 63/102 (61.76%), Query Frame = 0
Query:  150 QYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITK----NSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPER 247
            QY +M+  ERK         + LC VCGD+ASG HY   +C+GC+GFF+RSI +    N +Y CK NG C +D+  R +CQ+CR KKC A  M+ E V  ER
Sbjct:  730 QYIKMLSLERK--------GDILCQVCGDKASGKHYGVPSCDGCRGFFKRSIRRLAAGNLDYMCKENGRCIVDVTRRNQCQSCRFKKCLAVNMKKEAVQHER 1011          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000005090 (pep:novel supercontig:LSalAtl2s:LSalAtl2s269:306853:308464:-1 gene:EMLSAG00000005090 transcript:EMLSAT00000005090 description:"augustus_masked-LSalAtl2s269-processed-gene-3.0")

HSP 1 Score: 1059.28 bits (2738), Expect = 0.000e+0
Identity = 514/514 (100.00%), Postives = 514/514 (100.00%), Query Frame = 0
Query:    1 MSTTQYTAIIQPRPXHDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            MSTTQYTAIIQPRPXHDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE
Sbjct:    1 MSTTQYTAIIQPRPXHDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000001919 (pep:novel supercontig:LSalAtl2s:LSalAtl2s132:616435:622808:1 gene:EMLSAG00000001919 transcript:EMLSAT00000001919 description:"augustus_masked-LSalAtl2s132-processed-gene-6.5")

HSP 1 Score: 110.153 bits (274), Expect = 2.612e-26
Identity = 91/358 (25.42%), Postives = 148/358 (41.34%), Query Frame = 0
Query:  169 AEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE--RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPK--------------------------RVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKL 498
            ++  C +CGDRASG HY   +CEGCKGFF+R++ K   Y C+ N DC ID   R +CQ CR  KC  TGM+ E V  E  R                    + + +S+ +G  G + I+      R+   + +   +++    L+            D N          +          + +    I   +L+  FS+       L  +DQ+ L++G  +E+++   A      +D I+       T+EN  +AG+G+         +++MKE +                          +VE ++E     L+ Y  +   +N+   FAKLL  L  LRS+G+   E  F  KL
Sbjct:   87 SKHFCSICGDRASGKHYGVYSCEGCKGFFKRTVRKELTYACRENRDCVIDKRQRNRCQYCRYMKCLDTGMKREAVQEERHRGSNGPNHNNNNNNNNNNSRNSEEVESSTSGGGGDMPIE------RIIEAEDVGEMKQDTSEFLLL-----------DNNSSMSGGGSIGDMEIQRFGLAKKRIIHQLIEWAKLVPHFSE-------LKVEDQVTLIRGGWNELLVAGLAFXSIKLNDGILLGNGTIVTRENAHEAGVGHIFDRVLVELIAKMKEMQMDKAELGCLRAIILFNPDAKGLSDVTKVENLREKVYATLEEYTRSVH-ENEPSRFAKLLLRLPALRSIGLKCLEHLFFYKL 419          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000007361 (pep:novel supercontig:LSalAtl2s:LSalAtl2s418:374353:376789:1 gene:EMLSAG00000007361 transcript:EMLSAT00000007361 description:"maker-LSalAtl2s418-augustus-gene-3.13")

HSP 1 Score: 110.153 bits (274), Expect = 6.362e-26
Identity = 82/291 (28.18%), Postives = 125/291 (42.96%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFR--FCRAMSRMKEPKRVEKIQEIYVDALQAYVM 461
            C VCGDRA+G HY A +C+GCKGFFRRS+ K   Y C+ N  C ++   R  C+ CRLK C   GM+   V  ER  I  R+  +A    +  + TV    N + K G  S+ + S      +T     EE  L N+ +   E+  H                              M E  I    ++VE++KH+  F  L  DDQ+ LL+  S E +++  A+R    +  ++   +    K+         D   R    R M+ + +  +   I +  +  L+A V 
Sbjct:  151 CAVCGDRATGKHYGAASCDGCKGFFRRSVRKERVYGCRQNRACIVNKDKRNNCRYCRLKMCIKAGMKKSAVQNERDRISCRKKTSAKDMNSANELTVTALLNAD-KVGQKSL-LNSIVGGNINTNNFITEENVLANKQLASIEDIGHS-----------------------------MKEQLI----VLVEWAKHIKAFCELSVDDQVRLLRAHSGEHLLMGVAKRSMNLNGILLLGNDMIIVKDERKWNSESQDAAVRSIGVRVMNELVDTFKRINIDDAELACLKAIVF 406          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000012486 (pep:novel supercontig:LSalAtl2s:LSalAtl2s91:348479:353390:-1 gene:EMLSAG00000012486 transcript:EMLSAT00000012486 description:"maker-LSalAtl2s91-snap-gene-4.8")

HSP 1 Score: 107.842 bits (268), Expect = 5.626e-25
Identity = 58/146 (39.73%), Postives = 79/146 (54.11%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRA------ECVVPERTCIQ--KRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELIN 308
            E C+VCGDRASG HY A++CEGCKGFF+RSI K   Y C+ N DCE+  + R +CQ CRL+KC A GMR         + P  + +Q  +R    A  + A      +  S +N KN S    +   P  LS    L P  + +++
Sbjct:  218 EACVVCGDRASGRHYGAISCEGCKGFFKRSIRKQLGYQCRGNKDCEVTKHHRNRCQYCRLQKCLAMGMRIMKQIYESYLAPRVSAVQSERRPIVPANVSNAVTAALAENISISNAKNSSPVYHIYDSPTLLSRNS-LGPSSDSILS 362          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000009941 (pep:novel supercontig:LSalAtl2s:LSalAtl2s649:484085:485655:-1 gene:EMLSAG00000009941 transcript:EMLSAT00000009941 description:"maker-LSalAtl2s649-snap-gene-4.11")

HSP 1 Score: 103.99 bits (258), Expect = 1.734e-24
Identity = 92/352 (26.14%), Postives = 147/352 (41.76%), Query Frame = 0
Query:  158 ERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSE----VMMLRGARRYDAE----SDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNR 501
            E  K    S  ++  C+VCGD++SG HY    CEGCK FF+RS+ +N  Y C+ + +C +D + R +CQ CRLKKC+  GMR E V       Q+ +             + DP S     +  IS+ + + P                            +P+    +R   +PM +      E      ++ E     +   VE+++ +PGF  L   DQ+ LL+   SE    V  L+G     AE       +++ T+ P         GL + ++               +E++QE    AL+ Y   ++  NQ   F KLL  L  LR++     E  F ++L  +
Sbjct:   68 EHAKPSELSESSDINCVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYQCRGSKNCPVDQHHRNQCQHCRLKKCFKMGMRREAV-------QRGRVPPTPQGVFGLGFSSDPLSGTTYLSSYISMLLRAEP----------------------------YPT----SRYGQMPMPTNGMIGIE------NICEFAARLLFSAVEWTRSIPGFPELQVTDQVALLRLVWSELFEQVEKLKGLHVDSAEYVCMKAIVLFTTDAP---------GLCDMQV---------------IEQLQEKSQCALEEYC-RSQYPNQPTRFGKLLLRLPSLRTVSSTVIEQLFFVRLVGK 349          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000013004 (pep:novel supercontig:LSalAtl2s:LSalAtl2s98:942409:953748:1 gene:EMLSAG00000013004 transcript:EMLSAT00000013004 description:"augustus_masked-LSalAtl2s98-processed-gene-9.1")

HSP 1 Score: 103.99 bits (258), Expect = 1.292e-23
Identity = 96/389 (24.68%), Postives = 155/389 (39.85%), Query Frame = 0
Query:  169 AEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAK-------------------AAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPF----TKENYAKAGLGNDELFRFCRAMS----------------------RMKEPKRVEKIQEIYVDALQAYVMAN---RKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLME 509
            A  LC VCGD A+  HY    CEGCKGFF+R++ KN+ Y C  + +C +D   R +CQ CR +KC A GM  E V  +   ++ R+ +                     A   A  DT+  P  NN        +D + F +  S       +E  L N  +             + + YHV   S                      +++I  F + +PG   L  +D+  L +    E+ +LR A R + +SD   +           ++ +     G +E  R   +M                        + +PK+VE I+   +++L+ +V  N   +KK   +T  ++L  L  LRSL +   +  F LK ++    P L+E
Sbjct:  405 ASLLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDS--LKGRRGRLPSKPKSPTESPPSPPVSLITALVRAHIDTS--PDMNN--------LDYSQFVET-SIEDERDSKENMLANEAI------------KIGQFYHVLTSS----------------------IEVIRNFCERIPGISELSLNDRDLLFQTSCLELFVLRLAYRSNPDSDRYTFCNGVVLHVSQCEQTFGDWLNGINEFARGLHSMELDISAFSCLCGLILVNGKDERHGLSDPKKVESIENKIINSLKDHVTYNPEAQKKEHYMT--RILDRLPALRSLSMQGLQRIFFLKWEDLVPAPPLIE 744          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000008071 (pep:novel supercontig:LSalAtl2s:LSalAtl2s47:304551:317770:1 gene:EMLSAG00000008071 transcript:EMLSAT00000008071 description:"snap_masked-LSalAtl2s47-processed-gene-3.10")

HSP 1 Score: 98.2117 bits (243), Expect = 5.852e-22
Identity = 70/252 (27.78%), Postives = 107/252 (42.46%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGL 424
            CLVCGD ASG+HY   +CE CK FF+R+I  N  YT   + +CEI+   R+ CQACR +KC   GM  E V  +R     R  +            + P                  PK+         E+ +L+  L + +     P    +N    +P +   +  + SD   R +           +E++K +PGF NL  +DQ+ LL+   SE+++L    R    +  I    N+   +      GL
Sbjct:  271 CLVCGDIASGFHYGVSSCEACKAFFKRTIQGNIEYTXPASNECEINKRRRKACQACRFQKCLRMGMLKEGVRLDRV----RGGRQKYRRMIESSPYIQPP-----------------PKK-------TLEDNKLLQVLRHCE-----PEAFLVNMDMTLPNYKIRTISTLSDFYNRELIGT--------IEWAKQIPGFSNLTINDQMKLLQSSWSEILVLSLVYRSLPYNGKISLTNNFSLDESQARLCGL 481          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000009969 (pep:novel supercontig:LSalAtl2s:LSalAtl2s651:302705:304416:-1 gene:EMLSAG00000009969 transcript:EMLSAT00000009969 description:"maker-LSalAtl2s651-augustus-gene-2.5")

HSP 1 Score: 97.0561 bits (240), Expect = 1.198e-21
Identity = 64/228 (28.07%), Postives = 101/228 (44.30%), Query Frame = 0
Query:  170 EELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGAR 397
            E LC+VCGD++SG HY    CEGCK FF+R + ++  + C+    C +D + R +CQ CR KKC   GM+ E V   RT            +A   + + D  S N G     S  ++++   L   +P             Y   +Y     A  N +  +     N  E  +  LF              +E+++++PGF  L   DQ+ LL+   SE+ +L  ++
Sbjct:   72 EILCVVCGDKSSGKHYGQFTCEGCKSFFKRCVRRSLTFQCRSKKSCPVDQHHRNQCQHCRFKKCLNMGMKKEAVQKGRT---------TTTSAPIFNYSNDLFSPNTG-----SSYLSTYISLLLRAEP-------------YTTSQYGQLQMAASNNIIGI----DNICEFAARLLFS------------AIEWARNIPGFPELQITDQVGLLRMVWSELFVLNASQ 256          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000008902 (pep:novel supercontig:LSalAtl2s:LSalAtl2s554:572309:581835:1 gene:EMLSAG00000008902 transcript:EMLSAT00000008902 description:"maker-LSalAtl2s554-snap-gene-5.6")

HSP 1 Score: 94.7449 bits (234), Expect = 7.072e-21
Identity = 39/78 (50.00%), Postives = 49/78 (62.82%), Query Frame = 0
Query:  170 EELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPER 247
            EELC VCGD+ SGYHY  L CE CKGFF+R++     YTC  +  C ID   R++C  CR +KC   GM+ E V  +R
Sbjct:  183 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDR 260          
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Match: EMLSAP00000004451 (pep:novel supercontig:LSalAtl2s:LSalAtl2s231:945915:949068:1 gene:EMLSAG00000004451 transcript:EMLSAT00000004451 description:"snap_masked-LSalAtl2s231-processed-gene-9.18")

HSP 1 Score: 94.7449 bits (234), Expect = 8.139e-21
Identity = 60/229 (26.20%), Postives = 101/229 (44.10%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERT--------CIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMML 393
            C VCGD+ SG+HY   +CE CKGFF+R++    NY C     C + +  R+KC ACR  KC   GM+ E +  +RT        C          +  +    T+  +S  +  N    ++        SS  P+   E   +  L ++       S +  +   +    +T++S+       + +T +    +  +V + K LP F+N+  DDQI LL     E+++ 
Sbjct:  155 CPVCGDKISGFHYGIFSCESCKGFFKRTVQNKKNYVCLRGSQCPVTISTRKKCPACRFDKCLNIGMKLEAIREDRTRGGRSTYQCSYNLPTTGVCSTNSTTIPTIKRESRGDDHNTETKVNQ-------SSGIPVLLHEIMSVEHLWFW-------STSMPSLSLNNSSSNTDTSQESPSNPVQTLTLLADKRLYKLVRWCKSLPLFKNILVDDQITLLINAWCELLVF 369          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|205371750|sp|P49880.2|ECR_AEDAE (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; Short=AaEcR; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 380.178 bits (975), Expect = 1.228e-122
Identity = 221/525 (42.10%), Postives = 292/525 (55.62%), Query Frame = 0
Query:   42 PPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAP--------LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSI-SIDMASFP----------------KRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSR----------------------MKEPKRVEKIQEIYVDALQAYVMANRKKNQ---MVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            P PP ++    S++ S  ++   ++ L     SN    S+PSP    +     P  P P   +TT            Y        SSP+  G   P +P        L+P+ ++  Y+   + +++KKG + R  EELCLVCGDR SGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K A        T     + N+     I  I M   P                 RL +   L   +  +I +L+++Q+ YE PSE DL R+    + S N  E + D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYDA +DSI++A N  +T+++Y  AG+ +  ++L  FCR M                        +++ + VE IQ  Y+D L+ Y++ NR        V FAKLL +LTELR+LG  NSE+CFSLKLKNRKLP FL EIWD++
Sbjct:  170 PMPPVAAGTNVSSNGSVTVYASGKRRL----ESNEEWISSPSP--GSVPGSAPPLSPSPGSQSTT------------YTTTMSNGYSSPMSTGSYDPYSPNGKMGREDLSPSSSLNGYTDGSDAKKQKKGPTPRQQEELCLVCGDRESGYHYNALTCEGCKGFFRRSVTKNAVYCCKFGHACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAIKRKEKKAQKEKDKVQTNATVSTTNSTYRSEILPILMKCDPPPHQAIPLLPEKLLQENRLRNIPLLTANQMAVIYKLIWYQDGYEQPSEEDLKRIM---IGSPNEEEDQHDVHFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDAATDSILFANNRSYTRDSYRMAGMADTIEDLLHFCRQMFSLTVDNVEYALLTAIVIFSDRPGLEQAELVEHIQSYYIDTLRIYIL-NRHAGDPKCSVIFAKLLSILTELRTLGNQNSEMCFSLKLKNRKLPRFLEEIWDVQ 672          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|1706576|sp|P49883.1|ECR_MANSE (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 365.925 bits (938), Expect = 8.847e-120
Identity = 203/415 (48.92%), Postives = 248/415 (59.76%), Query Frame = 0
Query:  142 LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAA---AAAAAXXDTTVD----------PKSNNNGKNGSIS----IDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQ--MVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P  ++   S   E  R+KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE TC  KR+ K A           TTVD          P      +   +      +      RL +  PL   ++ LI RLV++QE YE PSE DL RV           E E+D  FR +TEMTILTVQLIVEF+K LPGF  + + DQI LLK  SSEVMMLR ARRYDA +DS+++A N  +T++NY KAG+    ++L  FCR M  M                      ++P  VE+IQ  Y+  L+ Y++     +    V F K+L VLTELR+LG  NS +C SLKLKNRKLPPFL EIWD+
Sbjct:  116 LSPASSINGCSTDGEPRRQKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYICKFGHACEMDMYMRRKCQECRLKKCLAVGMRPECVVPESTCKNKRREKEAQREKDKLPVSTTTVDDHMPAIMQCDPPPPEAARIHEVVPRFLTEKLMEQNRLKNVTPLSANQKSLIARLVWYQEGYEQPSEEDLKRVTQT-WQLEEEEEEETDMPFRQITEMTILTVQLIVEFAKGLPGFSKISQSDQITLLKASSSEVMMLRVARRYDAATDSVLFANNQAYTRDNYRKAGMSYVIEDLLHFCRCMYSMSMDNVHYALLTAIVIFSDRPGLEQPLLVEEIQRYYLKTLRVYILNQHSASPRCAVLFGKILGVLTELRTLGTQNSNMCISLKLKNRKLPPFLEEIWDV 529          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|461984|sp|P34021.1|ECR_DROME (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 374.785 bits (961), Expect = 1.542e-119
Identity = 203/445 (45.62%), Postives = 268/445 (60.22%), Query Frame = 0
Query:  126 SPSSPLENGLRHPNAPLTPTGAVQQYS--QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSIS------------IDMASFPKRLSSTKPLKPEE-----------------EELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQM--VTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            +P S   N +      L+P+ ++  YS  +  + ++ KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TK++ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K    A    D      S+ +G NGS++            +D+ +      +T PL P+E                   +I +L+++Q+ YE PSE DL R+   P    + +ES++D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD  SDSI +A N  +T+++Y  AG+ +  ++L  FCR M  MK                      + + VE IQ  Y+D L+ Y++     + M  V +AKLL +LTELR+LG  N+E+CFSLKLKNRKLP FL EIWD+
Sbjct:  215 TPRSDSVNSISSGRDDLSPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREK---KAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILAKCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQP----DENESQTDVSFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYTRDSYKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQSYYIDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDV 652          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|146328613|sp|O18531.2|ECR_LUCCU (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 369.007 bits (946), Expect = 1.693e-118
Identity = 204/433 (47.11%), Postives = 260/433 (60.05%), Query Frame = 0
Query:  126 SPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKK--KGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEE-----------------EELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQM--VTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            +P S   N +      L+P+ ++  +S    ++ KK  KG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K A        T+V            ++ +  S P     T PL PE+                   +I +L+++Q+ YE PSE DL R+    M S + +ES+ D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD  SDSI +A N  +T+++Y  AG+ +  ++L  FCR M  MK                      E + VE IQ  Y+D L+ Y++     + M  V FAKLL +LTELR+LG  N+E+CFSLKLKNRKLP FL EIWD+
Sbjct:  252 TPRSESANSISSGRDDLSPSSSLNGFSTSDASDVKKIKKGPAPRLQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYCCKFGHACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREKKAQKEKDKIQTSVCATEIKKEILDLMTCEPPSHP-----TCPLLPEDILAKCQARNIPPLSYNQLAVIYKLIWYQDGYEQPSEEDLKRI----MSSPDENESQHDASFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHNSDSIFFANNRSYTRDSYKMAGMADNIEDLLHFCRQMYSMKVDNVEYALLTAIVIFSDRPGLEEAELVEAIQSYYIDTLRIYILNRHCGDPMSLVFFAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDV 675          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|6015050|sp|O18473.1|ECR_HELVI (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=HvEcR; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 358.992 bits (920), Expect = 8.147e-117
Identity = 199/424 (46.93%), Postives = 251/424 (59.20%), Query Frame = 0
Query:  142 LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAA---XXDTTVD-------------PKSNNNGKNGSISIDMASFPK----------RLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKN--QMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P  +V   S   E  R+KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+D+YMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K A           TTVD             P++    +     +     P+          RL +  PL   ++ LI RLV++QE YE PSE DL RV        +S        FR +TEMTILTVQLIVEF+K LPGF  + + DQI LLK CSSEVMMLR ARRYDA +DS+++A N  +T++NY KAG+    ++L  FCR M  M                      ++P  VE+IQ  Y++ L+ Y++     +    V F ++L +LTE+R+LG+ NS +C SLKLKNRKLPPFL EIWD+
Sbjct:  132 LSPASSVNGCSTDGEARRQKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYICKFGHACEMDIYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRKEKKAQREKDKLPVSTTTVDDHMPPIMQCDPPPPEAARILE----CVQHEVVPRFLNEKLMEQNRLKNVPPLTANQKSLIARLVWYQEGYEQPSEEDLKRVTQSDEDDEDSDMP-----FRQITEMTILTVQLIVEFAKGLPGFAKISQSDQITLLKACSSEVMMLRVARRYDAATDSVLFANNQAYTRDNYRKAGMAYVIEDLLHFCRCMYSMMMDNVHYALLTAIVIFSDRPGLEQPLLVEEIQRYYLNTLRVYILNQNSASPRGAVIFGEILGILTEIRTLGMQNSNMCISLKLKNRKLPPFLEEIWDV 546          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|1706574|sp|P49881.1|ECR_BOMMO (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 355.525 bits (911), Expect = 4.790e-115
Identity = 194/420 (46.19%), Postives = 249/420 (59.29%), Query Frame = 0
Query:  142 LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVV--PERTCIQKRQAKAAAAAAAXXDTTV----------DPKSNNNGKNGSISIDMASFPKRLS----------STKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQ--MVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P  ++   S   +  R+KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECV+  P +   ++RQ K          TTV          DP      +   +       P+ LS          +  PL   ++ LI RLV++QE YE PS+ DL RV       ++  + ESD  FR +TEMTILTVQLIVEF+K LPGF  + + DQI LLK  SSEVMMLR ARRYDA SDS+++A N  +T++NY + G+    ++L  FCR M  M                      ++P  VE+IQ  Y++ L+ Y++     +    V + ++L VLTELR+LG  NS +C SLKLKNRKLPPFL EIWD+
Sbjct:  176 LSPASSINGCSADADARRQKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYICKFGHACEMDMYMRRKCQECRLKKCLAVGMRPECVIQEPSKNKDRQRQKKDKGILLPVSTTTVEDHMPPIMQCDPPPPEAARIHEV------VPRYLSEKLMEQNRQKNIPPLSANQKSLIARLVWYQEGYEQPSDEDLKRVTQT--WQSDEEDEESDLPFRQITEMTILTVQLIVEFAKGLPGFSKISQSDQITLLKASSSEVMMLRVARRYDAASDSVLFANNKAYTRDNYRQGGMAYVIEDLLHFCRCMFAMGMDNVHFALLTAIVIFSDRPGLEQPSLVEEIQRYYLNTLRIYIINQNSASSRCAVIYGRILSVLTELRTLGTQNSNMCISLKLKNRKLPPFLEEIWDV 587          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|1706575|sp|P49882.1|ECR_CHITE (RecName: Full=Ecdysone receptor; AltName: Full=20-hydroxy-ecdysone receptor; Short=20E receptor; AltName: Full=EcRH; AltName: Full=Ecdysteroid receptor; AltName: Full=Nuclear receptor subfamily 1 group H member 1)

HSP 1 Score: 330.872 bits (847), Expect = 1.936e-106
Identity = 187/414 (45.17%), Postives = 237/414 (57.25%), Query Frame = 0
Query:  161 KKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVD-----------PKSNNNGKNGSISI-----------------------DMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSR----------------------MKEPKRVEKIQEIYVDALQAYVMANRKKNQ---MVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            KKG   R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+  +CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K A          V              +N + KN  IS                        +      R   T  L   +  +I +L+++Q+ YE PSE DL R+        +     +   FR++TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD +SDSI++A N  +TK+ Y  AG+    D+L  FCR M                        +++ + V+ IQ  Y + L+ Y++ NR   +    V FAKLL +LTELR++G  NSE+CFSLKL+NRKLP FL E+WD+
Sbjct:  103 KKGPVPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYCCKFGHECEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAIKRKEKKAQKEKDKVPGIVGSNTSSSSLLNQSLNNGSLKNLEISYREELLEQLMKCDPPPHPMQQLLPEKLLMENRAKGTPQLTANQVAVIYKLIWYQDGYEQPSEEDLKRITTELEEEEDQEHEAN---FRYITEVTILTVQLIVEFAKGLPAFIKIPQEDQITLLKACSSEVMMLRMARRYDHDSDSILFANNTAYTKQTYQLAGMEETIDDLLHFCRQMYALSIDNVEYALLTAIVIFSDRPGLEKAEMVDIIQSYYTETLKVYIV-NRHGGESRCSVQFAKLLGILTELRTMGNKNSEMCFSLKLRNRKLPRFLEEVWDV 512          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|341942229|sp|Q9Z0Y9.3|NR1H3_MOUSE (RecName: Full=Oxysterols receptor LXR-alpha; AltName: Full=Liver X receptor alpha; AltName: Full=Nuclear receptor subfamily 1 group H member 3)

HSP 1 Score: 266.544 bits (680), Expect = 1.095e-82
Identity = 156/405 (38.52%), Postives = 226/405 (55.80%), Query Frame = 0
Query:  138 PNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P A L     + + +++   +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ K + Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T+V P+             ++S P+ L     L PE+  +I +LV  Q++    S +D  RV   P+     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F RAM+ +                       ++  +VE++Q  YV+AL AYV  N   + ++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   61 PTALLPRAETLPEPTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAQA-----TSVSPR-------------VSSPPQVLPQ---LSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPIAPDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSINHPHDPLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 443          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|23503089|sp|Q13133.2|NR1H3_HUMAN (RecName: Full=Oxysterols receptor LXR-alpha; AltName: Full=Liver X receptor alpha; AltName: Full=Nuclear receptor subfamily 1 group H member 3)

HSP 1 Score: 266.159 bits (679), Expect = 1.892e-82
Identity = 156/405 (38.52%), Postives = 228/405 (56.30%), Query Frame = 0
Query:  138 PNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P A LT      + +++   +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ K ++Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T++ P+++             S P+ L     L PE+  +I +LV  Q++    S +D  RV   PM     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F RAM+ +                       ++  +VE++Q  YV+AL AYV  +   ++++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   63 PTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAHA-----TSLPPRAS-------------SPPQILPQ---LSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 445          
BLAST of EMLSAG00000005090 vs. SwissProt
Match: gi|75060925|sp|Q5E9B6.1|NR1H3_BOVIN (RecName: Full=Oxysterols receptor LXR-alpha; AltName: Full=Liver X receptor alpha; AltName: Full=Nuclear receptor subfamily 1 group H member 3)

HSP 1 Score: 265.774 bits (678), Expect = 2.197e-82
Identity = 156/405 (38.52%), Postives = 225/405 (55.56%), Query Frame = 0
Query:  138 PNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPE---RTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGND---ELFRFCRAMSRM-----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P A L    A  + +++   +RKK  +      ELC VCGD+ASG+HYN L+CEGCKGFFRRS+ K + Y C   G C +D YMRRKCQ CRL+KC   GMR ECV+ E   R    KRQ +  A A     T+  P+++             S P+ L     L PE+  +I +LV  Q+     S +D  RV   PM     S     + F H TE+ I++VQ IV+F+K LPGF  L R+DQI LLK  + EVM+L  +RRY+  S+SI +  ++ + +E++AKAGL  +    +F F RAM+ +                       ++  +VE++Q  YV+AL AYV  +   ++++ F ++L  L  LR+L   +SE  F+L+L+++KLPP L EIWD+
Sbjct:   63 PTALLPGVEAPPESTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKMKRQEEEQAQA-----TSAPPRAS-------------SPPQVLPQ---LSPEQLGMIEKLVAAQQLCNRRSFSDQLRVTPWPMAPDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLM-FPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDV 445          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: AAG22334.2 (ecdysone receptor, isoform D [Drosophila melanogaster])

HSP 1 Score: 379.793 bits (974), Expect = 5.116e-122
Identity = 209/465 (44.95%), Postives = 277/465 (59.57%), Query Frame = 0
Query:  114 QNTHYYLNNSGESPSSPLENGLRHPNAP--------LTPTGAVQQYS--QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSIS------------IDMASFPKRLSSTKPLKPEE-----------------EELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQM--VTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            QN  Y ++N     +SP+  G   P +P        L+P+ ++  YS  +  + ++ KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TK++ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K    A    D      S+ +G NGS++            +D+ +      +T PL P+E                   +I +L+++Q+ YE PSE DL R+   P    + +ES++D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD  SDSI +A N  +T+++Y  AG+ +  ++L  FCR M  MK                      + + VE IQ  Y+D L+ Y++     + M  V +AKLL +LTELR+LG  N+E+CFSLKLKNRKLP FL EIWD+
Sbjct:  169 QNHSYNMSNG---YASPMSAGSYDPYSPTGKTGRDDLSPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREK---KAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILAKCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQP----DENESQTDVSFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYTRDSYKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQSYYIDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDV 623          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: AAF57278.3 (ecdysone receptor, isoform A [Drosophila melanogaster])

HSP 1 Score: 379.793 bits (974), Expect = 5.116e-122
Identity = 209/465 (44.95%), Postives = 277/465 (59.57%), Query Frame = 0
Query:  114 QNTHYYLNNSGESPSSPLENGLRHPNAP--------LTPTGAVQQYS--QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSIS------------IDMASFPKRLSSTKPLKPEE-----------------EELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQM--VTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            QN  Y ++N     +SP+  G   P +P        L+P+ ++  YS  +  + ++ KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TK++ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K    A    D      S+ +G NGS++            +D+ +      +T PL P+E                   +I +L+++Q+ YE PSE DL R+   P    + +ES++D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD  SDSI +A N  +T+++Y  AG+ +  ++L  FCR M  MK                      + + VE IQ  Y+D L+ Y++     + M  V +AKLL +LTELR+LG  N+E+CFSLKLKNRKLP FL EIWD+
Sbjct:  169 QNHSYNMSNG---YASPMSAGSYDPYSPTGKTGRDDLSPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREK---KAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILAKCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQP----DENESQTDVSFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYTRDSYKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQSYYIDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDV 623          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: AAM68347.1 (ecdysone receptor, isoform C [Drosophila melanogaster])

HSP 1 Score: 373.244 bits (957), Expect = 1.730e-121
Identity = 200/429 (46.62%), Postives = 263/429 (61.31%), Query Frame = 0
Query:  142 LTPTGAVQQYS--QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSIS------------IDMASFPKRLSSTKPLKPEE-----------------EELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQM--VTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P+ ++  YS  +  + ++ KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TK++ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K    A    D      S+ +G NGS++            +D+ +      +T PL P+E                   +I +L+++Q+ YE PSE DL R+   P    + +ES++D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD  SDSI +A N  +T+++Y  AG+ +  ++L  FCR M  MK                      + + VE IQ  Y+D L+ Y++     + M  V +AKLL +LTELR+LG  N+E+CFSLKLKNRKLP FL EIWD+
Sbjct:   22 LSPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREK---KAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILAKCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQP----DENESQTDVSFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYTRDSYKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQSYYIDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDV 443          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: ACZ94341.1 (ecdysone receptor, isoform G [Drosophila melanogaster])

HSP 1 Score: 374.785 bits (961), Expect = 7.472e-120
Identity = 203/445 (45.62%), Postives = 268/445 (60.22%), Query Frame = 0
Query:  126 SPSSPLENGLRHPNAPLTPTGAVQQYS--QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSIS------------IDMASFPKRLSSTKPLKPEE-----------------EELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQM--VTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            +P S   N +      L+P+ ++  YS  +  + ++ KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TK++ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K    A    D      S+ +G NGS++            +D+ +      +T PL P+E                   +I +L+++Q+ YE PSE DL R+   P    + +ES++D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD  SDSI +A N  +T+++Y  AG+ +  ++L  FCR M  MK                      + + VE IQ  Y+D L+ Y++     + M  V +AKLL +LTELR+LG  N+E+CFSLKLKNRKLP FL EIWD+
Sbjct:  215 TPRSDSVNSISSGRDDLSPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREK---KAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILAKCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQP----DENESQTDVSFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYTRDSYKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQSYYIDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDV 652          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: AAF57280.2 (ecdysone receptor, isoform B [Drosophila melanogaster])

HSP 1 Score: 374.785 bits (961), Expect = 7.472e-120
Identity = 203/445 (45.62%), Postives = 268/445 (60.22%), Query Frame = 0
Query:  126 SPSSPLENGLRHPNAPLTPTGAVQQYS--QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSIS------------IDMASFPKRLSSTKPLKPEE-----------------EELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQM--VTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            +P S   N +      L+P+ ++  YS  +  + ++ KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TK++ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K    A    D      S+ +G NGS++            +D+ +      +T PL P+E                   +I +L+++Q+ YE PSE DL R+   P    + +ES++D  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYD  SDSI +A N  +T+++Y  AG+ +  ++L  FCR M  MK                      + + VE IQ  Y+D L+ Y++     + M  V +AKLL +LTELR+LG  N+E+CFSLKLKNRKLP FL EIWD+
Sbjct:  215 TPRSDSVNSISSGRDDLSPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREK---KAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILAKCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQP----DENESQTDVSFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYTRDSYKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQSYYIDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFLEEIWDV 652          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: EAA00117.5 (AGAP012211-PA, partial [Anopheles gambiae str. PEST])

HSP 1 Score: 355.91 bits (912), Expect = 3.743e-117
Identity = 199/424 (46.93%), Postives = 259/424 (61.08%), Query Frame = 0
Query:  142 LTPTGAVQQYS-QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRL------SSTKPLKPE-----------------EEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSR----------------------MKEPKRVEKIQEIYVDALQAYVMANRKKNQ---MVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            L+P+ ++  Y+    E +++KKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRS+TKN+ Y CK+   CE+DMYMRRKCQ CRLKKC A GMR ECVVPE  C  KR+ K   A         +P +       S S      P  +      ++  PL PE                 +  +I +L+++Q+ YE PSE DL R+    ++S N  E   +  FRH+TE+TILTVQLIVEF+K LP F  + ++DQI LLK CSSEVMMLR ARRYDAE+DSI++A N  +T+++Y  AG+ +  ++L  FCR M                        +++ + VE IQ  Y+D L+ Y++ NR        VTFAKLL +LTELR+LG  NSE+CFSLKLKNRKLP FL EIWD++
Sbjct:   56 LSPSSSLNGYTGDGSEAKKQKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYCCKFGHACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAIKRKEK--KAQKEKDKVPPNPSTTTVSTTNSSSYKSELLPVLMKCESPPTAAIPLLPEKLLNENRQRNIPLLTANQMAVIYKLIWYQDGYEQPSEEDLKRIM---INSPNEEEDPHEIHFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDAETDSILFANNRSYTRDSYKMAGMADTIEDLLHFCRQMYTLTVDNVEYALLTAIVIFSDRPGLEKAELVETIQSYYIDTLRVYIL-NRHGGDPKCSVTFAKLLSILTELRTLGNQNSEMCFSLKLKNRKLPRFLEEIWDVQ 473          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: EFX68327.1 (hypothetical protein DAPPUDRAFT_301472 [Daphnia pulex])

HSP 1 Score: 336.265 bits (861), Expect = 6.472e-111
Identity = 181/381 (47.51%), Postives = 231/381 (60.63%), Query Frame = 0
Query:  157 NERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            N  KK   S  P  +LCLVCGD ASG+HY  L+CEGCKGFFRRSI K   Y CK++  C+IDMYMRRKCQ CRLKKC   GMR+E  V     +  + A+                    GK                +TK +  + E+LINRL+YFQ E++ PSE D+ ++    M+     ESE++  F+H+TEMTILTV+L V+FSK LPGF +L R DQI LLK CSSEVMMLR ARRYD ++DSI++A N  +T+E Y  AGLG+  D +FRF + + +MK                      E ++VE IQ IYV+ALQ YV+  R    M   AKLL +LTELR L   NS++ +SLKLKN+KLPPFL+EIWD+
Sbjct:   37 NTVKKLSKSQAP--QLCLVCGDLASGFHYGVLSCEGCKGFFRRSIVKKEVYQCKYDNSCDIDMYMRRKCQQCRLKKCLTVGMRSEGKVSTTVSVVMKSAR--------------------GKE---------------TTKQISADIEDLINRLIYFQAEFQLPSEDDMKKISTPGMY-----ESEAEFQFKHITEMTILTVKLTVDFSKRLPGFDSLLRQDQITLLKACSSEVMMLRCARRYDPKTDSILFANNSSYTRETYCIAGLGDTVDSIFRFGKKLCQMKIDNAEYALLTAIDIFSERPGLVEAQKVENIQNIYVEALQDYVVNQRTYRPMNHLAKLLSILTELRKLSNLNSQMWYSLKLKNKKLPPFLVEIWDV 375          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: EFX79409.1 (hypothetical protein DAPPUDRAFT_319648 [Daphnia pulex])

HSP 1 Score: 333.183 bits (853), Expect = 8.038e-110
Identity = 178/321 (55.45%), Postives = 214/321 (66.67%), Query Frame = 0
Query:  142 LTPTGAVQQ---YS-QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAA--------AAAAAXXDT------TVD--PKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK 440
            L+P G+V     YS     + +KKKG   R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+   C+IDMYMRRKCQ CRLKKC   GMR ECVVPE  C  KR+AK A        +++    D        +D  P       NG +   +A         KPL PE+EELINRLVYFQEE++ PSE DL ++    +H     ES++D  F+H+TEMTILTVQL VEFSK LPGF  L R+DQI LLK CSSEVMMLR ARRYDA +DSIV+A N P+T+E+Y  AG+G+  + LFRF ++MS+MK
Sbjct:   22 LSPPGSVNGGGGYSVDSFADAKKKKGPVPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNGCDIDMYMRRKCQECRLKKCLTVGMRPECVVPEYQCAVKREAKKAQKEKDRPNSSSLGSPDMKEPEIKVLDEKPMVVCGTANGGVGNGLA--------VKPLSPEQEELINRLVYFQEEFDQPSEEDLRKISTSGIH-----ESDADAKFKHITEMTILTVQLTVEFSKRLPGFDTLLREDQITLLKACSSEVMMLRCARRYDANTDSIVFANNLPYTRESYNMAGVGDTAEPLFRFGKSMSQMK 329          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: AFH04493.1 (Ecdysone-induced protein 75B, isoform F [Drosophila melanogaster])

HSP 1 Score: 135.961 bits (341), Expect = 7.614e-33
Identity = 107/373 (28.69%), Postives = 173/373 (46.38%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYT-CKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLV--YFQEEYEHPSEADLNRVYHVPMHSTN--SSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKE---NYAKAGLGNDELFRFCRAMSRMK---------------EPKR-----VEKIQEIY--VDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            LC VCGD+ASG+HY   +CEGCKGFFRRSI +   Y  C  N  C I    R +CQ CRLKKC A GM  + V   R  + KR+ KA   AA    T       N G+  +++ ++   P+ L++      E  E     V    Q   + PS + +  +   P++      SE E  + F H+       ++ +++F+  +PGFQ L +DD+  LLK    + + +R    +D+  +SI+        ++   N A A    D  F F   M+ M                 P R     +E I+++Y  +     Y++A  + +Q    AKLL  + +LR+L   ++E     + ++++L     ++W +E
Sbjct:  457 LCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCSILRINRNRCQYCRLKKCIAVGMSRDAVRFGR--VPKRE-KARILAAMQQST------QNRGQQRALATELDDQPRLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYS-MPTLLACPLNPAPELQSEQEFSQRFAHV-------IRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQNRPDQPEFLAKLLETMPDLRTLSTLHTEKLVVFRTEHKEL--LRQQMWSME 810          
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Match: AFH04492.1 (Ecdysone-induced protein 75B, isoform E [Drosophila melanogaster])

HSP 1 Score: 135.961 bits (341), Expect = 7.614e-33
Identity = 107/373 (28.69%), Postives = 173/373 (46.38%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYT-CKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLV--YFQEEYEHPSEADLNRVYHVPMHSTN--SSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKE---NYAKAGLGNDELFRFCRAMSRMK---------------EPKR-----VEKIQEIY--VDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            LC VCGD+ASG+HY   +CEGCKGFFRRSI +   Y  C  N  C I    R +CQ CRLKKC A GM  + V   R  + KR+ KA   AA    T       N G+  +++ ++   P+ L++      E  E     V    Q   + PS + +  +   P++      SE E  + F H+       ++ +++F+  +PGFQ L +DD+  LLK    + + +R    +D+  +SI+        ++   N A A    D  F F   M+ M                 P R     +E I+++Y  +     Y++A  + +Q    AKLL  + +LR+L   ++E     + ++++L     ++W +E
Sbjct:  457 LCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCSILRINRNRCQYCRLKKCIAVGMSRDAVRFGR--VPKRE-KARILAAMQQST------QNRGQQRALATELDDQPRLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYS-MPTLLACPLNPAPELQSEQEFSQRFAHV-------IRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQNRPDQPEFLAKLLETMPDLRTLSTLHTEKLVVFRTEHKEL--LRQQMWSME 810          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|729058610|gb|AIZ04022.1| (ecdysone receptor, partial [Lepeophtheirus salmonis salmonis])

HSP 1 Score: 1050.81 bits (2716), Expect = 0.000e+0
Identity = 507/536 (94.59%), Postives = 507/536 (94.59%), Query Frame = 0
Query:    1 MSTTQYTAIIQPRPXHDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            MSTTQYTAIIQPRP HDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIK  PHP  PPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAA  DTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM                      KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE
Sbjct:    1 MSTTQYTAIIQPRPTHDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKTEPHPYSPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAAADTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKVDNAEYALITAIVIFSDRNSLKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 536          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|291190960|gb|ADD82902.1| (ecdysone receptor [Tigriopus japonicus])

HSP 1 Score: 531.561 bits (1368), Expect = 0.000e+0
Identity = 280/490 (57.14%), Postives = 333/490 (67.96%), Query Frame = 0
Query:   66 QSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXD---TTVDPKSNNNGKNGSISIDMASFP-------------KRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSS---ESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            Q ++++T S +  +   SP+ +EIK  P         +  +     +Q N    L++ G SPSS   + L    +P     + Q Y +M ENERKKKG   RP EE C VCGDRASGYHYNALACEGCKGFFRRSITKNS Y+CK+   CEIDMYMRRKCQACR KKCY  GMRAECVVPE  C +KR  K A  AA   D   TT    +N  G    +S++ +  P             +   S + LKPEEEELINR+VY+Q+EYE+PSE DLNRVYHVP+   N S   ESESDRLF+H+TEMTILTVQLIVEFSKHLPGFQ LCR+DQ+NLLKGCSSEVMMLRGARRYD + DSI+YA NYPF+K+NY KAGL ND LFRFCR+M +M                      KEP RVEKIQEIYV+ALQ+YVMA +KK  MVTFAKLL VLTELRSLG +N++ CF+L++ NR+LP FL EIWDI+
Sbjct:   72 QPIYVDTSSPSSQFQASSPLTTEIKSEPPSSY-----SPPSNSLGFTQGN----LSSVG-SPSSQQSSFLVKSESP-----SSQDYPRMQENERKKKGQVPRPQEEFCTVCGDRASGYHYNALACEGCKGFFRRSITKNSTYSCKYGDGCEIDMYMRRKCQACRFKKCYTVGMRAECVVPESQCQKKRAIKRAQKAAQKGDASSTTAITNANGVGGVSGVSLNGSHTPNFAGLGLGLTLGARSTLSQRHLKPEEEELINRIVYYQDEYENPSEDDLNRVYHVPLQYANDSNGIESESDRLFQHITEMTILTVQLIVEFSKHLPGFQTLCREDQVNLLKGCSSEVMMLRGARRYDPQRDSIIYANNYPFSKDNYVKAGLSNDSLFRFCRSMCKMKVDNAEYALITAIVIFSERHNVKEPNRVEKIQEIYVEALQSYVMAKQKKEPMVTFAKLLSVLTELRSLGNSNAKTCFNLRMINRQLPAFLAEIWDIK 546          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|335355357|gb|AEH43772.1| (ecdysone receptor isoform 2 [Amphiascus tenuiremis])

HSP 1 Score: 473.011 bits (1216), Expect = 1.325e-160
Identity = 256/457 (56.02%), Postives = 303/457 (66.30%), Query Frame = 0
Query:  123 SGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKG----------SSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKA------AAAAAAXXDTTVDPKSNNNGKNGSISIDMAS---FPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVP------------------------MHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            S  SP+    +      +PLTPTGAV QY+QM E ERKKK              +P EELCLVCGDRASGYHYNALACEGCKGFFR SITK+S Y CK+   CEIDMYMRRKCQACRLKKCY  GMRAECVVPE  C +KRQAK                T    ++NNN   GS++  +AS      RL+    LKPE+E LINR+V++Q+E+E P++ DL+RVYHVP                          S    ++ESD+ FRHMTEMT+LTVQLIVEFSKHLPGFQ LCRDDQ++LLK CSSEV+M+RGARRYD + + I+YATNYPF++ENY  AGLGN+ LFRFC+ M  MK                      EPKRVEKIQEIYV+ALQ+YVMA RK+  MV FAKLL VLT LRSLG NN++ CF++K+ NRKLP FL EIWDI+
Sbjct:    3 SAGSPAGSANSFFPPGGSPLTPTGAVHQYAQMQEAERKKKSHHNSGGNSSNGGGKPQEELCLVCGDRASGYHYNALACEGCKGFFR-SITKSSKYACKYGDGCEIDMYMRRKCQACRLKKCYLVGMRAECVVPESQCQKKRQAKQAQKAQQGGEGGDITTTNNSVQNNNNNLLGSLAASVASTSALKNRLTPPWTLKPEQEGLINRIVFYQDEFEKPTDEDLSRVYHVPPLQPGHLDPGSGGGPGTNSLTANGSGSNGELDNESDKYFRHMTEMTVLTVQLIVEFSKHLPGFQTLCRDDQVSLLKACSSEVIMIRGARRYDPQRECIIYATNYPFSQENYDMAGLGNEALFRFCKLMCSMKVDNAEYALLTAIVIFSDRENVREPKRVEKIQEIYVEALQSYVMARRKEEHMVAFAKLLSVLTTLRSLGNNNAKTCFNMKMVNRKLPAFLAEIWDIK 458          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|1111332457|gb|APH81342.1| (ecdysone receptor [Paracyclopina nana])

HSP 1 Score: 464.537 bits (1194), Expect = 6.560e-157
Identity = 232/393 (59.03%), Postives = 276/393 (70.23%), Query Frame = 0
Query:  164 SSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSS--------------------TKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            S+SRP E+LCLVCGDRASGYHYNALACEGCKGFFRRSITKN +Y CK+  +CEIDMYMRRKCQACRLKKCYA GMRA+CVVPE  C++KR AK+                NNNG+   + I      + LS                      +PLKPEEEELINRLVYFQ ++E+P+E DL +VYHVP+HS   +E+E D LFRH+TEMTILTV LIV+F KHLPGF +L +DDQ+ +LKGCSSEVMMLR ARRYD +++SI++A N+PFTKENY +AGL  + LFRFCR M +M                      K+ KRVEKIQEIYVDAL++YVM++RKK+  V FAKLL  L ELRSLG  NS  CF LKL NR+LP FL EIWDI+
Sbjct:  113 SNSRPQEDLCLVCGDRASGYHYNALACEGCKGFFRRSITKNQSYKCKYGDNCEIDMYMRRKCQACRLKKCYAVGMRADCVVPEEQCVKKRMAKS---------------KNNNGETSPLMITNGGHMRHLSGGSDTNGATLVLKRPAPLVHVVRPLKPEEEELINRLVYFQLQFEYPNEEDLKKVYHVPLHS-QGAENEGDCLFRHITEMTILTVNLIVDFCKHLPGFASLEKDDQVVILKGCSSEVMMLRAARRYDPQTESIIFANNHPFTKENYKQAGLRFEALFRFCRRMIKMKVDNAEFGLLTAITIFSERKNLKQRKRVEKIQEIYVDALRSYVMSHRKKDPTVAFAKLLGALVELRSLGNLNSRTCFDLKLVNRRLPDFLAEIWDIK 489          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|1110961968|gb|APG80611.1| (ecdysone receptor [Paracyclopina nana])

HSP 1 Score: 464.537 bits (1194), Expect = 6.778e-157
Identity = 232/393 (59.03%), Postives = 276/393 (70.23%), Query Frame = 0
Query:  164 SSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSS--------------------TKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            S+SRP E+LCLVCGDRASGYHYNALACEGCKGFFRRSITKN +Y CK+  +CEIDMYMRRKCQACRLKKCYA GMRA+CVVPE  C++KR AK+                NNNG+   + I      + LS                      +PLKPEEEELINRLVYFQ ++E+P+E DL +VYHVP+HS   +E+E D LFRH+TEMTILTV LIV+F KHLPGF +L +DDQ+ +LKGCSSEVMMLR ARRYD +++SI++A N+PFTKENY +AGL  + LFRFCR M +M                      K+ KRVEKIQEIYVDAL++YVM++RKK+  V FAKLL  L ELRSLG  NS  CF LKL NR+LP FL EIWDI+
Sbjct:  113 SNSRPQEDLCLVCGDRASGYHYNALACEGCKGFFRRSITKNQSYKCKYGDNCEIDMYMRRKCQACRLKKCYAVGMRADCVVPEEQCVKKRMAKS---------------KNNNGETSPLMITNGGHMRHLSGGSDTNGATLVLKRPAPLVHVVRPLKPEEEELINRLVYFQLQFEYPNEEDLKKVYHVPLHS-QGAENEGDCLFRHITEMTILTVNLIVDFCKHLPGFASLEKDDQVVILKGCSSEVMMLRAARRYDPQTESIIFANNHPFTKENYKQAGLRFEALFRFCRRMIKMKVDNAEFGLLTAITIFSERKNLKQRKRVEKIQEIYVDALRSYVMSHRKKDPTVAFAKLLGALVELRSLGNLNSRTCFDLKLVNRRLPDFLAEIWDIK 489          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|242019559|ref|XP_002430228.1| (Ecdysone receptor, putative [Pediculus humanus corporis] >gi|212515324|gb|EEB17490.1| Ecdysone receptor, putative [Pediculus humanus corporis])

HSP 1 Score: 434.106 bits (1115), Expect = 2.066e-144
Identity = 238/466 (51.07%), Postives = 286/466 (61.37%), Query Frame = 0
Query:   95 PXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAP--------LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFP---------------KRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P  P P P     H Q++  +  Y         SSP+ +G   P +P        L+P G++  YS    + +KKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+   CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A        +T          NGS  + MA  P                  +  KP+ PE+EELI+RLVYFQ EYE PS+ DL R+ + P    +  E +SD  FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMMLR ARRYD  SDSI++A N P+T+++Y+ AG+G   D+L RFCR M  MK                      E  +VEKIQEIY++AL+ YV   RK      FAKLL VLTELR+LG  NSE+CFSLKLKN+KLPPFL EIWD+
Sbjct:   80 PLTPSPGP-----HNQYTVISNGY---------SSPMSSGSYDPYSPNGKLGREDLSPPGSLNGYSVDSSDSKKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGDSCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEIQCEVKRREKKAQREKGKPSSTT---------NGSPELIMADTPAIKTEPNTTQSHNEKSSANGVKPISPEQEELIHRLVYFQNEYEQPSDEDLKRISNAP----SEGEDQSDLNFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMLRMARRYDVGSDSILFANNQPYTRDSYSLAGMGETVDDLLRFCRQMYGMKVDNAEYALLTAIVIFSERPSLIEGWKVEKIQEIYLEALKVYVDNRRKPRSGTIFAKLLSVLTELRTLGNLNSEMCFSLKLKNKKLPPFLAEIWDV 518          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|939669806|ref|XP_014281743.1| (PREDICTED: ecdysone receptor isoform X1 [Halyomorpha halys])

HSP 1 Score: 429.483 bits (1103), Expect = 1.410e-143
Identity = 222/409 (54.28%), Postives = 273/409 (66.75%), Query Frame = 0
Query:  142 LTPTGAVQQYS-QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISI------------DMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P  ++  +S    +  +KKKGS++R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A            P S  NG   SI +            D    P  ++  KP+ PE+EELI+RLVYFQ EYEHPSE DL R+     ++ N  E +SD+ FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMMLR AR+YDA +DSI++A N P+ +E+Y+ AG+G+  ++L RFCR M  MK                      E  +VEKIQEIY++AL++YV    +      FAKLL VLTELR+LG  NSE+CFSLKL+N+KLPPFL EIWD+
Sbjct:   53 LSPANSLNGFSADSCDGSKKKKGSAARQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEYQCAVKRKEKKAQKDKDK------PVSTTNGSPESIKVEEPHRVVYKTESDTLGRPVPMNGIKPVSPEQEELIHRLVYFQNEYEHPSEEDLRRIVS---NTPNEDEEQSDQRFRHLTEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMLRMARKYDANTDSILFANNQPYNRESYSLAGMGDVIEDLLRFCRHMYNMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYLEALKSYVDNRSRPRSPAIFAKLLSVLTELRTLGNQNSEMCFSLKLQNKKLPPFLAEIWDV 452          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|939669809|ref|XP_014281744.1| (PREDICTED: ecdysone receptor isoform X2 [Halyomorpha halys])

HSP 1 Score: 429.098 bits (1102), Expect = 1.730e-143
Identity = 222/409 (54.28%), Postives = 273/409 (66.75%), Query Frame = 0
Query:  142 LTPTGAVQQYS-QMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISI------------DMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            L+P  ++  +S    +  +KKKGS++R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A            P S  NG   SI +            D    P  ++  KP+ PE+EELI+RLVYFQ EYEHPSE DL R+     ++ N  E +SD+ FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMMLR AR+YDA +DSI++A N P+ +E+Y+ AG+G+  ++L RFCR M  MK                      E  +VEKIQEIY++AL++YV    +      FAKLL VLTELR+LG  NSE+CFSLKL+N+KLPPFL EIWD+
Sbjct:   53 LSPANSLNGFSADSCDGSKKKKGSAARQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEYQCAVKRKEKKAQKDKDK------PVSTTNGSPESIKVEEPHRVVYKTESDTLGRPVPMNGIKPVSPEQEELIHRLVYFQNEYEHPSEEDLRRI-----NTPNEDEEQSDQRFRHLTEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMLRMARKYDANTDSILFANNQPYNRESYSLAGMGDVIEDLLRFCRHMYNMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYLEALKSYVDNRSRPRSPAIFAKLLSVLTELRTLGNQNSEMCFSLKLQNKKLPPFLAEIWDV 450          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|952543055|gb|ALO17612.1| (ecysone receptor isoform A [Schistocerca gregaria])

HSP 1 Score: 431.409 bits (1108), Expect = 3.460e-143
Identity = 253/521 (48.56%), Postives = 305/521 (58.54%), Query Frame = 0
Query:   31 PDNSSPTVIGLPPPPSSSPIFASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSS------PLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGS------ISIDMASFPKR--LSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDI 513
            P + S  ++    P  +  +FA A SSP      +  L  + +S+ GS + PSP        PHP           L    +       L N   SP S      P   G +     L+P  ++  YS    + +KKKG++ R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC   GMR ECVVPE  C  KR+ K A           D    N+  NGS        ID    P+R   +  KP+ PE+EELI+RLVYFQ EYE PSE DL RV   P       E +SD  FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMM R ARRYD  SDSI++A N P+TK++Y  AG+G   +++ RFCR M  MK                      E  +VEKIQEIY++AL+AYV   R+      FAKLL VLTELR+LG  NSE+CFSLKLKN+KLPPFL EIWD+
Sbjct:   42 PASVSDALVVKTEPREAGSLFA-AISSPGPGPAKRARLDSDWLSSPGSNAAPSP-------PPHP-----------LFGGAASAGAPAALPNGYASPLSSGGSYDPYSPGGKIGREDLSPLSSLNGYSADSCDAKKKKGAAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLTVGMRPECVVPEYQCAVKRKEKKAQK---------DKDKPNSTTNGSPEVMMLKDIDAKVEPERPLSNGIKPVSPEQEELIHRLVYFQNEYESPSEEDLRRVTSQPTE----GEDQSDVRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVNSDSILFANNQPYTKDSYNLAGMGETIEDMLRFCRQMYAMKVDNAEYALLTAIVIFSERPSLVEGWKVEKIQEIYLEALKAYVDNRRRPKSGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFLAEIWDV 530          
BLAST of EMLSAG00000005090 vs. nr
Match: gi|1080033213|ref|XP_018560850.1| (PREDICTED: ecdysone receptor isoform X1 [Anoplophora glabripennis])

HSP 1 Score: 432.565 bits (1111), Expect = 4.007e-143
Identity = 228/427 (53.40%), Postives = 277/427 (64.87%), Query Frame = 0
Query:  128 SSPLENGLRHPNAP--------LTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSST--------KPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            SSP+ +G   P +P        L+P  ++  YS    + +KKKG + R  EELCLVCGDRASGYHYNAL CEGCKGFFRRSITKN+ Y CK+  +CEIDMYMRRKCQ CRLKKC + GMR ECVVPE  C  KR+ K A            P S  NG    I ++   F  +LS +        KP+ PE+EELI+RLVYFQ EYEHPSE D+ R+ + PM      E + D  FRH+TE+TILTVQLIVEF+K LPGF  L R+DQI LLK CSSEVMM R ARRYD +SDSI++  N P+++++Y  AG+G   ++L  FCR M  MK                      E  +VEKIQEIY++AL+AYV   RK      FAKLL VLTELR+LG  NSE+CFSLKLKN+KLPPFL EIWD++
Sbjct:  151 SSPMSSGSYDPYSPNGKIGREDLSPPSSLNGYSADSCDAKKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEVQCAVKRKEKKAQKEKDK------PNSTTNGSPEMIKLEPEMFFLQLSDSEKTLTNGVKPISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPME----GEDQCDIRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSILFVNNQPYSRDSYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYLEALRAYVDNRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFLAEIWDVD 567          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold106_size358372-processed-gene-0.6 (protein:Tk03534 transcript:snap_masked-scaffold106_size358372-processed-gene-0.6-mRNA-1 annotation:"ecdysone receptor")

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 284/490 (57.96%), Postives = 340/490 (69.39%), Query Frame = 0
Query:   66 QSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNN-------GKNGS--------ISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTN----SSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            Q ++++T S +  +   SP ++EIK  P     PP        Q+H+  N+   +++    P         +P  PLTP  AVQ+Y+++ ENERKKKG   RP EELC VCGDRASGYHYNALACEGCKGFFRRSITKNS+Y+CK+   CEIDMYMRRKCQACRLKKCY  GMRAECVVPE  C +KR  K A  AA   D +      NN       G  G+        +S +  S P  L+  + LKPEEEELINR+VY+Q+E+E+P+  DLNRVYHVP+H  N     +ESESDRLF+HMTEMTILTVQLIVEF+KHLPGF  LCR+DQ++LLKGCSSEVMMLRGARRYD + DSI+YATNYPF+K+NY KAGLGND LFRFCR M +M                      KEPKRVEKIQEIYV+ALQ+YVMA +KK  MV FAKLL VLTELRSLG NN++ CF+L++ NRKLP FL EIWDI+
Sbjct:   73 QPIYVDTSSPSSHFQASSPQITEIKTEPPSSFSPPVNGYGHAPQRHNSSNSS--VSSPSSQPGGFFVKSESNP--PLTPNQAVQEYARLQENERKKKGPVPRPQEELCTVCGDRASGYHYNALACEGCKGFFRRSITKNSSYSCKYGDGCEIDMYMRRKCQACRLKKCYTVGMRAECVVPESQCQKKRAIKQAQKAAQNGDASSTTLMANNSSLSGGMGGRGTPLAIGGPGLSSNHNSIPSALAP-RHLKPEEEELINRIVYYQDEFENPTAEDLNRVYHVPLHPVNNDATGNESESDRLFQHMTEMTILTVQLIVEFTKHLPGFPTLCREDQVSLLKGCSSEVMMLRGARRYDPQRDSIIYATNYPFSKDNYVKAGLGNDALFRFCRNMCKMKVDNAEYALITAIVIFSERHNVKEPKRVEKIQEIYVEALQSYVMAKQKKEPMVAFAKLLSVLTELRSLGNNNAKTCFNLRMINRKLPAFLAEIWDIK 557          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold1253_size52701-processed-gene-0.0 (protein:Tk01373 transcript:snap_masked-scaffold1253_size52701-processed-gene-0.0-mRNA-1 annotation:"ecdysone receptor")

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 284/490 (57.96%), Postives = 340/490 (69.39%), Query Frame = 0
Query:   66 QSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPPPPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNN-------GKNGS--------ISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTN----SSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRM----------------------KEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLMEIWDIE 514
            Q ++++T S +  +   SP ++EIK  P     PP        Q+H+  N+   +++    P         +P  PLTP  AVQ+Y+++ ENERKKKG   RP EELC VCGDRASGYHYNALACEGCKGFFRRSITKNS+Y+CK+   CEIDMYMRRKCQACRLKKCY  GMRAECVVPE  C +KR  K A  AA   D +      NN       G  G+        +S +  S P  L+  + LKPEEEELINR+VY+Q+E+E+P+  DLNRVYHVP+H  N     +ESESDRLF+HMTEMTILTVQLIVEF+KHLPGF  LCR+DQ++LLKGCSSEVMMLRGARRYD + DSI+YATNYPF+K+NY KAGLGND LFRFCR M +M                      KEPKRVEKIQEIYV+ALQ+YVMA +KK  MV FAKLL VLTELRSLG NN++ CF+L++ NRKLP FL EIWDI+
Sbjct:   73 QPIYVDTSSPSSHFQASSPQITEIKTEPPSSFSPPVNGYGHAPQRHNSSNSS--VSSPSSQPGGFFVKSESNP--PLTPNQAVQEYARLQENERKKKGPVPRPQEELCTVCGDRASGYHYNALACEGCKGFFRRSITKNSSYSCKYGDGCEIDMYMRRKCQACRLKKCYTVGMRAECVVPESQCQKKRAIKQAQKAAQNGDASSTTLMANNSSLSGGMGGRGTPLAIGGPGLSSNHNSIPSALAP-RHLKPEEEELINRIVYYQDEFENPTAEDLNRVYHVPLHPVNNDATGNESESDRLFQHMTEMTILTVQLIVEFTKHLPGFPTLCREDQVSLLKGCSSEVMMLRGARRYDPQRDSIIYATNYPFSKDNYVKAGLGNDALFRFCRNMCKMKVDNAEYALITAIVIFSERHNVKEPKRVEKIQEIYVEALQSYVMAKQKKEPMVAFAKLLSVLTELRSLGNNNAKTCFNLRMINRKLPAFLAEIWDIK 557          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold192_size271026-snap-gene-1.22 (protein:Tk07205 transcript:maker-scaffold192_size271026-snap-gene-1.22-mRNA-1 annotation:"retinoid x receptor")

HSP 1 Score: 138.658 bits (348), Expect = 1.962e-36
Identity = 107/365 (29.32%), Postives = 155/365 (42.47%), Query Frame = 0
Query:  169 AEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEM-------TILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPK----------------------------RVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKL 498
            ++  C +CGDRASG HY   +CEGCKGFF+R++ K   Y C+ N  C ID   R +CQ CR  KC ATGMR E V  ER     + A+AA          V+  +   G  G ++ID                       R+V  +               H+       S  ESD L  HM              +Q +VE++KH+P F +L  +D+I L++   +E+++   A R   + D I++A +    +EN   AG+G+         + +MKE K                            +VE  +E     L+ Y   N  +N+   FAKLL  L  LRS+G+   E  F  KL
Sbjct:   64 SKHFCSICGDRASGKHYGVYSCEGCKGFFKRTVRKELVYACRENKACIIDKRQRNRCQYCRYMKCLATGMRREAVQEERNRGGHKGAEAA--------EPVESSTGAGGLGGEMAID-----------------------RIVAAE---------------HISEQGGAFSRQESDDLQAHMPGGFDGDQPNKRKMLQQLVEWAKHIPHFTDLKIEDRIKLIRAGWNELLIAGCAFRSMNQEDGILWADSQFIKRENAHLAGVGDIFDRVLVELVGKMKEMKMDKAELGCLRAIILFNPDAKGLEQDPALQVESFREKVYATLEEYCRTNH-ENEPSRFAKLLLRLPALRSIGLKCVEHLFFYKL 381          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold106_size358372-snap-gene-1.13 (protein:Tk03536 transcript:maker-scaffold106_size358372-snap-gene-1.13-mRNA-1 annotation:"ecdysone-inducible protein e75 isoform x3")

HSP 1 Score: 118.627 bits (296), Expect = 2.195e-28
Identity = 100/357 (28.01%), Postives = 158/357 (44.26%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYT-CKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECV----VPERTCIQKRQAKAAAAAAAXXDTTVDPKS----NNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN-----DELFRFCRAMSR-----------------------MKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSE 491
            LC VCGD+ASG+HY   +CEGCKGFFRRSI +   Y  C  N  C I    R +CQ CRLKKC A GM  + V    VP+R      +AK  AA       T + K     N++GK    +I  A +     +   ++P          + Q+    PS A  + +   PM          D      +E  +  V+ +  F+K +PGF+ L  DDQ+ LLK C  EV+++R A  +  E+  ++        KE   +   GN     D +F   + +++                       ++ P+ V+K+Q      L   ++     +  + F +L+ ++ +LR+L   ++E
Sbjct:    1 LCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCNILRINRNRCQYCRLKKCIAAGMSRDAVRFGRVPKR-----EKAKILAAMQTSRMKTQESKVLGEMNDDGKIIE-TIVRAHYDTCDYTRNKMEP----------FIQKAKAQPSFAICSGMT-CPMKG-----RPEDSFLEQFSERFMEHVRQVCTFAKLIPGFKCLHHDDQVTLLKSCVFEVLLVRLAGLF--ENQGLICLNGDIIRKETINQMPPGNAKFLMDSVFDLAQRLNQFRLSDAEIGLFCSVVIITADRPGLRNPELVQKMQNKLKMVLNKILLPQHADHPAI-FTELMTMIHDLRTLNTLHTE 332          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold743_size103610-snap-gene-0.17 (protein:Tk01116 transcript:maker-scaffold743_size103610-snap-gene-0.17-mRNA-1 annotation:"probable nuclear hormone receptor hr38-like")

HSP 1 Score: 113.235 bits (282), Expect = 1.096e-27
Identity = 97/384 (25.26%), Postives = 159/384 (41.41%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAK-------------------AAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMAN---RKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLME 509
            LC VCGD A+  HY    CEGCKGFF+R++ KN+ Y C  + +C +D   R +CQ CR +KC A GM  E V  +   ++ R+ +                     A   A  DT+ D   N        S+D + + +  +S + L+ +E  ++N     Q+ Y                H   SS                  +++I +F   +PG  ++   D+  L +    E+  LR A R   +SD   +       + N  +   G+    +  F R +  M                       +PKRVE +Q   +++L+ +V  N   +KK Q   F+++L  LT LRSL +   +  F LK+++    P ++E
Sbjct:   30 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDS--LKGRRGRLPSKPRSPQEQPPSPPVSLITALVRAHIDTSPDSSPN--------SLDFSQYME--ASVEELETKEGLVVNEATKIQQFY----------------HLLTSS------------------IEVIRKFCDRIPGINDILASDRELLFQSACLELFALRLAYRIQPDSDQFTFCHGLVLHR-NQCQHSFGDWLGSIMEFSRTLHAMDLDIQAFACLCALTLVTDRHGLSDPKRVENLQSKVINSLKDHVTYNPDAQKKQQY--FSRILERLTPLRSLSVQGLQRIFYLKMEDTVPVPAVIE 364          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1408_size42850-snap-gene-0.13 (protein:Tk00739 transcript:maker-scaffold1408_size42850-snap-gene-0.13-mRNA-1 annotation:"probable nuclear hormone receptor hr38-like")

HSP 1 Score: 113.235 bits (282), Expect = 1.096e-27
Identity = 97/384 (25.26%), Postives = 159/384 (41.41%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAK-------------------AAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKENYAKAGLGN--DELFRFCRAMSRMK----------------------EPKRVEKIQEIYVDALQAYVMAN---RKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNRKLPPFLME 509
            LC VCGD A+  HY    CEGCKGFF+R++ KN+ Y C  + +C +D   R +CQ CR +KC A GM  E V  +   ++ R+ +                     A   A  DT+ D   N        S+D + + +  +S + L+ +E  ++N     Q+ Y                H   SS                  +++I +F   +PG  ++   D+  L +    E+  LR A R   +SD   +       + N  +   G+    +  F R +  M                       +PKRVE +Q   +++L+ +V  N   +KK Q   F+++L  LT LRSL +   +  F LK+++    P ++E
Sbjct:   30 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDS--LKGRRGRLPSKPRSPQEQPPSPPVSLITALVRAHIDTSPDSSPN--------SLDFSQYME--ASVEELETKEGLVVNEATKIQQFY----------------HLLTSS------------------IEVIRKFCDRIPGINDILASDRELLFQSACLELFALRLAYRIQPDSDQFTFCHGLVLHR-NQCQHSFGDWLGSIMEFSRTLHAMDLDIQAFACLCALTLVTDRHGLSDPKRVENLQSKVINSLKDHVTYNPDAQKKQQY--FSRILERLTPLRSLSVQGLQRIFYLKMEDTVPVPAVIE 364          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold524_size146631-snap-gene-0.27 (protein:Tk03332 transcript:maker-scaffold524_size146631-snap-gene-0.27-mRNA-1 annotation:"steroid receptor seven- isoforms b c-like")

HSP 1 Score: 112.849 bits (281), Expect = 2.002e-26
Identity = 98/360 (27.22%), Postives = 150/360 (41.67%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSI----SIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLR-----------------GARRYDAESDSIVYATNY--PFTKENYAKAGLGNDE--------LFRFCRAMSRMKEPKRVEKIQEIYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKNR 501
            C+VCGD++SG HY    CEGCK FF+RS+ +N  Y C+ + +C ID + R +CQ CRLKKC+  GMR E V       Q+ +   +AA A              G NG +    +  ++S+   L   +P             Y    Y     A  N +  +     N  E  +  LF              VE+S+++PGF  L   DQ+ LL+   SE+ +L                  G       +D +V   ++   F ++     GL  D         +  F      + E + +E++QE    AL+ Y   N+  NQ   F KLL  L  LR++  +  E  F ++L  +
Sbjct:  470 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYQCRGSRNCPIDQHHRNQCQHCRLKKCFKMGMRKEAV-------QRGRVPPSAAQAMI----------GFGFNGEVTHPGTTYLSSYISMLLRAEP-------------YHTSRYGQMQMAAANNMVGI----DNICEFAARLLFS------------AVEWSRNIPGFPELQVTDQVALLRLVWSELFVLNASQCNMPLHVAPLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKLKGLHVDSAEYSCMKAIVLFTSDACGLSEVQTIEQLQEKSQCALEEYC-RNQYPNQPTRFGKLLLRLPSLRTVSPSVIEQLFFVRLVGK 782          

HSP 2 Score: 111.309 bits (277), Expect = 6.511e-26
Identity = 90/321 (28.04%), Postives = 134/321 (41.74%), Query Frame = 0
Query:  141 PLTPTGAVQQYSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPF-TKENYAKAGL-----GNDELFRFCRAMSRMKEPKRVEKIQEIYVDA 455
            PLTP        Q      ++ G +    + +C+VCGD++SG HY    CEGCK FF+RS+ +N  Y C+ N +C ID   R +CQ CRLKKC   GMR E V         ++ + A    A    T       NG   S +  ++S+   L   +P             Y    Y     A  N +  +     N  E  +  LF              VE+S+++PGF  L   DQ+ LL+   SE+ +L  ++             N P       A AGL       D +  F   +   +E  +VEK++ ++VD+
Sbjct:   62 PLTPMSTTVHPPQESSISSEESGKNDDCQDIICVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYQCRGNRNCPIDQNHRNQCQHCRLKKCLKMGMRREAV---------QRGRVATTPQAMFGITF------NGDPLSGTTYLSSYISMLLRAEP-------------YHTSRYGQMQMAAANNMVGI----DNICEFAARLLFS------------AVEWSRNIPGFPELQVTDQVALLRLVWSELFVLNASQ------------CNMPLHVAPLLAAAGLHASPMAADRVVAFMDHIRIFQE--QVEKLKALHVDS 324          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1013_size70870-snap-gene-0.16 (protein:Tk07036 transcript:maker-scaffold1013_size70870-snap-gene-0.16-mRNA-1 annotation:"transcription factor hnf-4 homolog")

HSP 1 Score: 107.457 bits (267), Expect = 7.289e-25
Identity = 73/245 (29.80%), Postives = 121/245 (49.39%), Query Frame = 0
Query:  173 CLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLKPEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHMTEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYDAESDSIVYATNYPFTKE 417
            C +CGD+A+G HY A +C+GCKGFFRRS+ K   Y C++  +C +    R +C+ CRL+KC   GM+ + V   R  I  +++               P+S ++  N SIS         LS T     E+ EL++R  + Q  Y+   +   NR       ++ +   +S +      ++ IL     VE++KH+P F +L  DDQ+ LL+  + E ++L   RR    +D ++   +    K+
Sbjct:  200 CAICGDKATGKHYGAASCDGCKGFFRRSVRKKQAYICRFYRNCVVTKDKRNQCRFCRLRKCMKAGMKTDSVQHTRDRISSKRST--------------PESESS--NPSIS--------GLSVT---TLEKAELLSR--HGQHGYDIQKDQLTNREIETKQLASIADIGDSMK-----QQLLIL-----VEWAKHIPAFCDLSIDDQVALLRAHAGEHLLLGVTRRSLHLNDILLLGNDMIIPKD 405          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold120_size336265-snap-gene-1.12 (protein:Tk08787 transcript:maker-scaffold120_size336265-snap-gene-1.12-mRNA-1 annotation:"nuclear receptor nhr-48")

HSP 1 Score: 102.064 bits (253), Expect = 3.120e-23
Identity = 41/83 (49.40%), Postives = 57/83 (68.67%), Query Frame = 0
Query:  171 ELCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCIQKR 253
            +LC VCGD+A GY++NAL CE CK FFRR+  KN ++ C ++  CE+ +  RR CQ CRLKKC+  GM+ E ++ +    QKR
Sbjct:  283 KLCAVCGDKALGYNFNALTCESCKAFFRRNALKNKDFKCPFSNKCEVTVVTRRFCQKCRLKKCFDIGMKKEWILSDEEKQQKR 365          
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold58_size443543-processed-gene-3.1 (protein:Tk00704 transcript:snap_masked-scaffold58_size443543-processed-gene-3.1-mRNA-1 annotation:"nuclear hormone receptor")

HSP 1 Score: 90.1225 bits (222), Expect = 2.170e-22
Identity = 39/71 (54.93%), Postives = 49/71 (69.01%), Query Frame = 0
Query:  172 LCLVCGDRASGYHYNALACEGCKGFFRRSITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAEC 242
            L L  GDR    HY A++CEGCKGFF+RSI K   Y C+ N DCE+  + R +CQ CRL+KC A GMR++C
Sbjct:    9 LSLTRGDRR---HYGAISCEGCKGFFKRSIRKQLGYQCRGNKDCEVTKHHRNRCQYCRLQKCLAMGMRSDC 76          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000005090 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-1.816e-6435.66symbol:NR1H4 "Uncharacterized protein" species:961... [more]
-2.344e-6435.66symbol:NR1H4 "Uncharacterized protein" species:961... [more]
-1.199e-6337.37symbol:FXR "Farnesoid X receptor" species:9031 "Ga... [more]
-3.053e-6337.99symbol:Nr1h4 "Bile acid receptor" species:10116 "R... [more]
-3.053e-6337.99symbol:Nr1h4 "nuclear receptor subfamily 1, group ... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592844279|gb|GAXK01113265.1|3.810e-2526.45TSA: Calanus finmarchicus comp95139_c2_seq2 transc... [more]
gi|592844280|gb|GAXK01113264.1|3.840e-2526.45TSA: Calanus finmarchicus comp95139_c2_seq1 transc... [more]
gi|592853768|gb|GAXK01103776.1|4.169e-2460.56TSA: Calanus finmarchicus comp167181_c0_seq1 trans... [more]
gi|592874334|gb|GAXK01083228.1|9.736e-2339.37TSA: Calanus finmarchicus comp389578_c0_seq1 trans... [more]
gi|592874006|gb|GAXK01083556.1|1.268e-2243.10TSA: Calanus finmarchicus comp176094_c0_seq1 trans... [more]
gi|592848671|gb|GAXK01108873.1|1.669e-2256.34TSA: Calanus finmarchicus comp297344_c0_seq3 trans... [more]
gi|592848672|gb|GAXK01108872.1|2.270e-2256.34TSA: Calanus finmarchicus comp297344_c0_seq2 trans... [more]
gi|592848673|gb|GAXK01108871.1|2.450e-2256.34TSA: Calanus finmarchicus comp297344_c0_seq1 trans... [more]
gi|592878692|gb|GAXK01079209.1|3.160e-2224.66TSA: Calanus finmarchicus comp267685_c0_seq1 trans... [more]
gi|592814756|gb|GAXK01139812.1|8.878e-2247.06TSA: Calanus finmarchicus comp832560_c0_seq2 trans... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 25
Match NameE-valueIdentityDescription
EMLSAP000000050900.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s269:30685... [more]
EMLSAP000000019192.612e-2625.42pep:novel supercontig:LSalAtl2s:LSalAtl2s132:61643... [more]
EMLSAP000000073616.362e-2628.18pep:novel supercontig:LSalAtl2s:LSalAtl2s418:37435... [more]
EMLSAP000000124865.626e-2539.73pep:novel supercontig:LSalAtl2s:LSalAtl2s91:348479... [more]
EMLSAP000000099411.734e-2426.14pep:novel supercontig:LSalAtl2s:LSalAtl2s649:48408... [more]
EMLSAP000000130041.292e-2324.68pep:novel supercontig:LSalAtl2s:LSalAtl2s98:942409... [more]
EMLSAP000000080715.852e-2227.78pep:novel supercontig:LSalAtl2s:LSalAtl2s47:304551... [more]
EMLSAP000000099691.198e-2128.07pep:novel supercontig:LSalAtl2s:LSalAtl2s651:30270... [more]
EMLSAP000000089027.072e-2150.00pep:novel supercontig:LSalAtl2s:LSalAtl2s554:57230... [more]
EMLSAP000000044518.139e-2126.20pep:novel supercontig:LSalAtl2s:LSalAtl2s231:94591... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|205371750|sp|P49880.2|ECR_AEDAE1.228e-12242.10RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|1706576|sp|P49883.1|ECR_MANSE8.847e-12048.92RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|461984|sp|P34021.1|ECR_DROME1.542e-11945.62RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|146328613|sp|O18531.2|ECR_LUCCU1.693e-11847.11RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|6015050|sp|O18473.1|ECR_HELVI8.147e-11746.93RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|1706574|sp|P49881.1|ECR_BOMMO4.790e-11546.19RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|1706575|sp|P49882.1|ECR_CHITE1.936e-10645.17RecName: Full=Ecdysone receptor; AltName: Full=20-... [more]
gi|341942229|sp|Q9Z0Y9.3|NR1H3_MOUSE1.095e-8238.52RecName: Full=Oxysterols receptor LXR-alpha; AltNa... [more]
gi|23503089|sp|Q13133.2|NR1H3_HUMAN1.892e-8238.52RecName: Full=Oxysterols receptor LXR-alpha; AltNa... [more]
gi|75060925|sp|Q5E9B6.1|NR1H3_BOVIN2.197e-8238.52RecName: Full=Oxysterols receptor LXR-alpha; AltNa... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
AAG22334.25.116e-12244.95ecdysone receptor, isoform D [Drosophila melanogas... [more]
AAF57278.35.116e-12244.95ecdysone receptor, isoform A [Drosophila melanogas... [more]
AAM68347.11.730e-12146.62ecdysone receptor, isoform C [Drosophila melanogas... [more]
ACZ94341.17.472e-12045.62ecdysone receptor, isoform G [Drosophila melanogas... [more]
AAF57280.27.472e-12045.62ecdysone receptor, isoform B [Drosophila melanogas... [more]
EAA00117.53.743e-11746.93AGAP012211-PA, partial [Anopheles gambiae str. PES... [more]
EFX68327.16.472e-11147.51hypothetical protein DAPPUDRAFT_301472 [Daphnia pu... [more]
EFX79409.18.038e-11055.45hypothetical protein DAPPUDRAFT_319648 [Daphnia pu... [more]
AFH04493.17.614e-3328.69Ecdysone-induced protein 75B, isoform F [Drosophil... [more]
AFH04492.17.614e-3328.69Ecdysone-induced protein 75B, isoform E [Drosophil... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|729058610|gb|AIZ04022.1|0.000e+094.59ecdysone receptor, partial [Lepeophtheirus salmoni... [more]
gi|291190960|gb|ADD82902.1|0.000e+057.14ecdysone receptor [Tigriopus japonicus][more]
gi|335355357|gb|AEH43772.1|1.325e-16056.02ecdysone receptor isoform 2 [Amphiascus tenuiremis... [more]
gi|1111332457|gb|APH81342.1|6.560e-15759.03ecdysone receptor [Paracyclopina nana][more]
gi|1110961968|gb|APG80611.1|6.778e-15759.03ecdysone receptor [Paracyclopina nana][more]
gi|242019559|ref|XP_002430228.1|2.066e-14451.07Ecdysone receptor, putative [Pediculus humanus cor... [more]
gi|939669806|ref|XP_014281743.1|1.410e-14354.28PREDICTED: ecdysone receptor isoform X1 [Halyomorp... [more]
gi|939669809|ref|XP_014281744.1|1.730e-14354.28PREDICTED: ecdysone receptor isoform X2 [Halyomorp... [more]
gi|952543055|gb|ALO17612.1|3.460e-14348.56ecysone receptor isoform A [Schistocerca gregaria][more]
gi|1080033213|ref|XP_018560850.1|4.007e-14353.40PREDICTED: ecdysone receptor isoform X1 [Anoplopho... [more]

Pages

back to top
BLAST of EMLSAG00000005090 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 25
Match NameE-valueIdentityDescription
snap_masked-scaffold106_size358372-processed-gene-0.60.000e+057.96protein:Tk03534 transcript:snap_masked-scaffold106... [more]
snap_masked-scaffold1253_size52701-processed-gene-0.00.000e+057.96protein:Tk01373 transcript:snap_masked-scaffold125... [more]
maker-scaffold192_size271026-snap-gene-1.221.962e-3629.32protein:Tk07205 transcript:maker-scaffold192_size2... [more]
maker-scaffold106_size358372-snap-gene-1.132.195e-2828.01protein:Tk03536 transcript:maker-scaffold106_size3... [more]
maker-scaffold743_size103610-snap-gene-0.171.096e-2725.26protein:Tk01116 transcript:maker-scaffold743_size1... [more]
maker-scaffold1408_size42850-snap-gene-0.131.096e-2725.26protein:Tk00739 transcript:maker-scaffold1408_size... [more]
maker-scaffold524_size146631-snap-gene-0.272.002e-2627.22protein:Tk03332 transcript:maker-scaffold524_size1... [more]
maker-scaffold1013_size70870-snap-gene-0.167.289e-2529.80protein:Tk07036 transcript:maker-scaffold1013_size... [more]
maker-scaffold120_size336265-snap-gene-1.123.120e-2349.40protein:Tk08787 transcript:maker-scaffold120_size3... [more]
snap_masked-scaffold58_size443543-processed-gene-3.12.170e-2254.93protein:Tk00704 transcript:snap_masked-scaffold58_... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s269supercontigLSalAtl2s269:306853..308464 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Descriptionecdysone receptor
Logic nameensemblgenomes
Biotypeprotein_coding
EvidenceIEA
NoteEcdysone receptor
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000005090 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000005090EMLSAT00000005090-700937Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s269:306853..308464-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000005090-687856 ID=EMLSAG00000005090-687856|Name=EMLSAG00000005090|organism=Lepeophtheirus salmonis|type=gene|length=1612bp|location=Sequence derived from alignment at LSalAtl2s269:306853..308464- (Lepeophtheirus salmonis)
ATGTCAACAACTCAATATACGGCTATAATTCAGCCTCGCCCAMCTCACGA TTCRGTGGTYCCTGCCGTTAAACGATTTCGTCCTAATCCTCCAGATAATT CTTCGCCAACTGTTATTGGACTTCCTCCACCGCCTTCCAGTTCGCCAATA TTCGCTAGTGCCTCGTCTTCTCCTTTGATTCACCAACAGCACCAACAATC TCTTTTCATAGAAACTATGAGTAACAATGGGTCTTACTCGACCCCTTCTC CTATACTCTCCGAAATTAAGMCTGAMCCCCATCCTTMCYCCCCGCCMCCT CCGCCAACAACGACGACCCTCCACCAACAGCACTCCCAACAAAATACACA CTATTACCTGAATAACTCGGGAGAAAGTCCCTCTTCTCCATTGGAGAATG GACTGCGACATCCTAATGCTCCTTTAACACCTACTGGAGCTGTTCAGCAG TACTCTCAGATGGTGGAAAATGAGAGGAAAAAGAAAGGATCTTCCTCTCG CCCTGCCGAAGAGTTATGTCTTGTCTGTGGAGATCGAGCATCGGGTTATC ATTATAATGCATTGGCATGTGAGGGATGCAAAGGGTTCTTTCGACGTTCT ATTACCAAAAACTCTAACTATACTTGCAAATGGAATGGGGATTGTGAAAT TGATATGTATATGAGGCGAAAATGTCAGGCGTGTAGACTAAAAAAATGTT ATGCCACGGGTATGAGGGCAGAGTGTGTTGTGCCAGAAAGGACTTGCATT CAGAAAAGACAAGCTAAAGCTGCAGCCGCTGCCGCAGCTSCASCCGACAC AACTGTAGATCCTAAGTCCAATAACAACGGTAAAAATGGAAGCATATCCA TAGATATGGCTTCTTTTCCTAAAAGACTTTCATCCACCAAACCTTTAAAG CCAGAAGAAGAGGAGCTAATTAATCGTTTGGTATATTTTCAAGAAGAATA CGAGCATCCATCTGAAGCGGACCTTAACCGTGTTTACCATGTTCCTATGC ACAGTACTAATTCATCCGAATCCGAGTCTGACCGTTTATTCCGTCATATG ACAGAGATGACTATTCTTACAGTTCAATTAATAGTTGAGTTCTCCAAGCA CCTGCCGGGCTTCCAGAATCTTTGCAGAGACGATCAAATTAATTTACTTA AAGGCTGTTCCTCAGAAGTGATGATGCTGAGGGGAGCCCGTCGTTATGAT GCCGAGTCAGACTCTATTGTTTATGCAACGAACTATCCTTTTACGAAAGA AAATTACGCTAAGGCGGGGCTTGGCAATGACGAGCTCTTTCGTTTCTGCA GGGCCATGTCTCGAATGAAAGTACGATAACGCAGAATACGCTCTCATAAC AGCTATTGTCATTTTTAGTGATAGAAACTCCTTAAAGGAACCTAAAAGAG TTGAAAAGATTCAAGAGATTTATGTAGATGCTCTACAAGCCTACGTAATG GCAAATCGGAAAAAGAATCAAATGGTTACCTTTGCGAAGTTGTTATATGT CCTTACTGAGCTTCGATCCTTAGGGATCAACAACTCAGAACTTTGCTTCT CTCTTAAGCTTAAAAACCGAAAATTGCCCCCATTTCTCATGGAAATTTGG GACATCGAATGA
back to top
Add to Basket