EMLSAG00000005163, EMLSAG00000005163-687929 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000005163
Unique NameEMLSAG00000005163-687929
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000005163 vs. GO
Match: - (symbol:CYP2J2 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0005506 "iron ion binding" evidence=IEA] [GO:0008404 "arachidonic acid 14,15-epoxygenase activity" evidence=IEA] [GO:0008405 "arachidonic acid 11,12-epoxygenase activity" evidence=IEA] [GO:0016712 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen" evidence=IEA] [GO:0019373 "epoxygenase P450 pathway" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0043651 "linoleic acid metabolic process" evidence=IEA] [GO:0071614 "linoleic acid epoxygenase activity" evidence=IEA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR008071 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PRINTS:PR01688 PROSITE:PS00086 GO:GO:0005506 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0043651 GO:GO:0016712 GO:GO:0019373 TreeFam:TF352043 GeneTree:ENSGT00730000110385 CTD:1573 KO:K07418 GO:GO:0008405 GO:GO:0008404 GO:GO:0071614 EMBL:AAEX03003786 RefSeq:XP_852725.1 Ensembl:ENSCAFT00000029950 GeneID:610195 KEGG:cfa:610195 OMA:LEMFIAR Uniprot:F6Y7G5)

HSP 1 Score: 284.263 bits (726), Expect = 3.662e-87
Identity = 182/508 (35.83%), Postives = 283/508 (55.71%), Query Frame = 0
Query:   20 IKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRF--NVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQT-GGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGD-AILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGD--GESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPRD 521
            +K + P+NYPP P   LP  G+  +L     +F++   ++  RF    G V  +Q+   + + +++   ++K++L   D N    +       +++++     G + S G IWK+QRRF L+TLKNFG GR S+E+ + EEA   +  + EEN Q    + +I N     + N++  I  G RFEY+D + Q+++  + +   L T+++  +  +FP++    PG    Q++ +    +  F+    +NH  +++P  PRDFID YL   K+ E+N      SF  E    NL  + LDLFFAG+ETTS+TL WG+L++  +PEIQ+KVQ E+D  + +    G + R++       +PYT A I E+QR GNI P+ VP    +GD  +  Y +PKG V+   L+ + R+P  +   PD FNP+ FLE       +F K E  +PFSIGKR C GE LAR E+F FFTS++QRF  R  D E  S +F +G+T  P    ++ IPR 
Sbjct:   35 LKRRRPKNYPPGP-VPLPFVGNFFHL-----DFEQSHLKL-QRFVKKYGNVFSVQMGD-MPLVVVTGLPLIKEVLV--DQNQVFVNRPITPIRERVFKN---SGLIMSSGQIWKEQRRFTLATLKNFGLGRKSIEERIQEEAHHLIQAIEEENGQPFNPHFKINN----AVSNIICSITFGKRFEYQDEQFQELLRLLDEVTCLETSMRCQLYNVFPWIIKFLPG--PHQKLFNDWEKLKLFIAHMTENHRRDWNPAEPRDFIDAYL---KEMEKNRGNATSSFHEE----NLIYSTLDLFFAGTETTSTTLRWGLLYLALNPEIQEKVQAEIDRVIGQSQLPGLAVRES-------MPYTNAFIHEVQRMGNIVPLNVPREV-TGDTTLAGYYLPKGTVIVTNLTALHRDPAEWA-TPDTFNPEHFLENG-----QFKKREAFLPFSIGKRVCIGEQLARSELFIFFTSLVQRFTFRPPDNEKLSLEFRTGLTISPVSHRLRAIPRS 502          
BLAST of EMLSAG00000005163 vs. GO
Match: - (symbol:LOC100524940 "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0005506 "iron ion binding" evidence=IEA] [GO:0016712 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR008071 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PRINTS:PR01688 PROSITE:PS00086 GO:GO:0005506 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0016712 GeneTree:ENSGT00730000110385 KO:K07418 EMBL:CU656030 RefSeq:XP_003128009.3 Ensembl:ENSSSCT00000033172 GeneID:100524940 KEGG:ssc:100524940 Uniprot:K7GM60)

HSP 1 Score: 278.1 bits (710), Expect = 9.112e-85
Identity = 178/503 (35.39%), Postives = 275/503 (54.67%), Query Frame = 0
Query:   20 IKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQT-GGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAI-LSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            +K + P+NYPP PP RLP  G+  +L     +      R   ++  G V  L   A +   +I+    +K+     D N+  ++   +   +++++  GV   + S G +WK+QRRF L+TL+NFG G+ S+E+ + EEA   +  + EEN Q    + +I N     + N++  I  G RF+Y+D + Q+++  + + + L T++   I  I P++    PG    Q + S    +  F+   ++NH  +++P   RDFI+ YL +I   E++      SF+ E    NL  + LDLF AG+ETTS+TL WG+L+M  +PEIQ+KVQ E+D  L +      ++  +  R  +PYT A I E+QR GNI P+ VP    + D  +  Y +PKG +V A L+ +  +P  +   PD FNP+ FLE       KF K E  +PFS+GKR+C GE LAR E+F FFTS+LQ+F  R  D E  S  F  G+T  P  + I  +PR
Sbjct:   35 LKKRRPKNYPPGPP-RLPFIGNLFHLDLDKGHL--SLQRFVKKY--GNVFSLDFGA-LSSVVITGLPFIKEAFVHQDKNF--SNRPIVPIQQRVFKDKGV---VMSNGQVWKEQRRFALTTLRNFGLGKKSLEERIQEEAQYLIQAIGEENGQPFNPHFKINN----AVSNIICSITFGERFDYQDNQFQELLKLLDEVMCLQTSVWCQIYNIIPWIMKFLPG--PHQTLFSNWEKLKMFVAHVIENHRRDWNPAEARDFIEAYLQEI---EKHKGDATSSFQEE----NLICSTLDLFVAGTETTSTTLRWGLLYMALYPEIQEKVQAEIDRVLGQ-----LQQPSTAARESMPYTNAVIHEVQRMGNIIPLNVPREV-AEDTTLAGYHLPKGTMVIANLTALHSDPTEWA-TPDTFNPEHFLENG-----KFKKREAFLPFSVGKRACLGEQLARTELFVFFTSLLQKFSFRPPDNEKLSLKFRMGLTLSPVTYRICAVPR 501          
BLAST of EMLSAG00000005163 vs. GO
Match: - (symbol:cyp2p8 "cytochrome P450, family 2, subfamily P, polypeptide 8" species:7955 "Danio rerio" [GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0005506 "iron ion binding" evidence=IEA] [GO:0016712 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen" evidence=IEA] [GO:0016491 "oxidoreductase activity" evidence=IEA] [GO:0004497 "monooxygenase activity" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR008069 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PRINTS:PR01686 PROSITE:PS00086 ZFIN:ZDB-GENE-061030-1 GO:GO:0005506 eggNOG:COG2124 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0016712 OrthoDB:EOG7RBZ85 HOGENOM:HOG000036991 HOVERGEN:HBG015789 TreeFam:TF352043 GeneTree:ENSGT00730000110385 KO:K07418 EMBL:BX322665 EMBL:BC162546 EMBL:BC162547 RefSeq:NP_001076504.1 UniGene:Dr.139771 STRING:7955.ENSDARP00000063107 Ensembl:ENSDART00000063108 GeneID:100034366 KEGG:dre:100034366 CTD:100034366 InParanoid:Q5TZ86 NextBio:20788180 Uniprot:Q5TZ86)

HSP 1 Score: 277.715 bits (709), Expect = 1.070e-84
Identity = 182/521 (34.93%), Postives = 287/521 (55.09%), Query Frame = 0
Query:    4 ALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKIL--KTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEE-NIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAI-LSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            +++I +C+ L    Y IK K P+N+PP P + LP+ G   ++ ++  + Q  F +  +R+  G +   ++    R+ +++ ++++K++   + D+L  R             Y+ +G  G + S G  WK QRRF LSTL+NFG G+ S+E  +  E      FLNE  + + G       L N  + NV+  +V G RF+Y D   Q ++  + +A+ L  ++   +  +FP+L    PG    + + +    V +F++  V  H  ++DP++PRD+ID +L ++       +K  D         NL    LDLF AG+ETTS+TL WG+L+M+++PEIQ KVQEE+D  +    G S R+    DR ++PYT A I EIQR GNI P+ +  +T S D ++G+Y +PKG +V + L+ +  +   +   P  FNP  FL    D   KF + +  +PFS+GKR C GE LARME+F FF+S+LQRF      G  PS D+  G T  PKPF +  +PR
Sbjct:   14 SILIFLCVFLLLGDY-IKNKAPKNFPPGP-WSLPIIGDLHHIDNSKIHLQ--FTKFAERY--GNIFSFRLFGP-RIVVLNGYNLVKEVYIKQGDNLADRPVLPL-------FYEIVGDKGLILSSGYKWKHQRRFALSTLRNFGLGKKSLEPSINVEC----GFLNEAISNEQGRPFDPRLLLNNAVSNVICVLVFGNRFDYSDHHFQTLLKNISEAVYLEGSICNQLYNMFPWLMERLPG--PHKTIITLWRKVTDFVREKVNEHRVDYDPSNPRDYIDCFLTEM-------EKLKDDTAAGFDVENLCICSLDLFVAGTETTSTTLYWGLLYMIKYPEIQAKVQEEIDAVV----GGS-RQPSVSDRDNMPYTNAVIHEIQRMGNIAPINLARST-SEDTQIGNYSIPKGTMVTSNLTSVLFDESEW-ETPHSFNPGHFL----DAEGKFRRRDAFLPFSLGKRVCLGEQLARMELFLFFSSLLQRFTFSPPAGVEPSLDYKMGGTHCPKPFKLCAVPR 496          
BLAST of EMLSAG00000005163 vs. GO
Match: - (symbol:LOC100524940 "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0005506 "iron ion binding" evidence=IEA] [GO:0016712 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR008071 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PRINTS:PR01688 PROSITE:PS00086 GO:GO:0005506 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0016712 TreeFam:TF352043 GeneTree:ENSGT00730000110385 OMA:KHKGDAT EMBL:CU656030 Ensembl:ENSSSCT00000004234 Uniprot:F1S7C1)

HSP 1 Score: 277.715 bits (709), Expect = 3.443e-84
Identity = 178/503 (35.39%), Postives = 275/503 (54.67%), Query Frame = 0
Query:   20 IKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQT-GGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAI-LSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            +K + P+NYPP PP RLP  G+  +L     +      R   ++  G V  L   A +   +I+    +K+     D N+  ++   +   +++++  GV   + S G +WK+QRRF L+TL+NFG G+ S+E+ + EEA   +  + EEN Q    + +I N     + N++  I  G RF+Y+D + Q+++  + + + L T++   I  I P++    PG    Q + S    +  F+   ++NH  +++P   RDFI+ YL +I   E++      SF+ E    NL  + LDLF AG+ETTS+TL WG+L+M  +PEIQ+KVQ E+D  L +      ++  +  R  +PYT A I E+QR GNI P+ VP    + D  +  Y +PKG +V A L+ +  +P  +   PD FNP+ FLE       KF K E  +PFS+GKR+C GE LAR E+F FFTS+LQ+F  R  D E  S  F  G+T  P  + I  +PR
Sbjct:   72 LKKRRPKNYPPGPP-RLPFIGNLFHLDLDKGHL--SLQRFVKKY--GNVFSLDFGA-LSSVVITGLPFIKEAFVHQDKNF--SNRPIVPIQQRVFKDKGV---VMSNGQVWKEQRRFALTTLRNFGLGKKSLEERIQEEAQYLIQAIGEENGQPFNPHFKINN----AVSNIICSITFGERFDYQDNQFQELLKLLDEVMCLQTSVWCQIYNIIPWIMKFLPG--PHQTLFSNWEKLKMFVAHVIENHRRDWNPAEARDFIEAYLQEI---EKHKGDATSSFQEE----NLICSTLDLFVAGTETTSTTLRWGLLYMALYPEIQEKVQAEIDRVLGQ-----LQQPSTAARESMPYTNAVIHEVQRMGNIIPLNVPREV-AEDTTLAGYHLPKGTMVIANLTALHSDPTEWA-TPDTFNPEHFLENG-----KFKKREAFLPFSVGKRACLGEQLARTELFVFFTSLLQKFSFRPPDNEKLSLKFRMGLTLSPVTYRICAVPR 538          
BLAST of EMLSAG00000005163 vs. GO
Match: - (symbol:CYP2J34 "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0005506 "iron ion binding" evidence=IEA] [GO:0016712 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR008071 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PRINTS:PR01688 PROSITE:PS00086 GO:GO:0005506 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0016712 OrthoDB:EOG7RBZ85 TreeFam:TF352043 GeneTree:ENSGT00730000110385 EMBL:CU656030 Ensembl:ENSSSCT00000026469 OMA:RICAVHR Uniprot:I3L9H9)

HSP 1 Score: 275.018 bits (702), Expect = 1.338e-83
Identity = 178/504 (35.32%), Postives = 277/504 (54.96%), Query Frame = 0
Query:   19 EIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQT-GGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILS-TNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            + K + P+NYPP PP RL   G+  +L     +      R    +  G ++ L  ++     +I+   ++K+     D ++  A+   I   +++++    +G + S G +WK+QRRF L+TL+NFG G+ S+E+ + EEA   +  + EEN Q    + +I N     + N++  I  G RF+Y+D + Q+++  + +     T+++  +  +FP +    PG    Q + S    +  F+   ++NH+ +++P   RDFID YL +I+  + N      SF+ E    NL  T LDLFFAG+ETTS+TL WG+L+M  +PEIQ+KVQ E+D  L    G+S ++  +  R  +PYT A I E+QR GNI P+ VP    + D  +  Y +PKG +V   L+ + R+P  +   PD FNP+ FLE       KF K E  +PFSIGKR+C GE LAR E+F FFTS+LQ+F  R  D E  S  F  G+T  P  + I  + R
Sbjct:   33 DFKKRSPKNYPPGPP-RLLFLGNFFHLDVEKGHL--ALQRFVKEY--GNIISLD-SSVFSSVVITGLPLIKEAFVHQDQHF--ANRPMIPTQERVFKK---NGLIMSNGQVWKEQRRFALTTLRNFGLGKKSLEERIQEEAQYLIQAIGEENGQPFNPHFKINN----AVSNIICSITFGKRFDYQDDQFQELLRLLDEVTCQHTSVQVQLYNMFPRIMKFLPG--PHQTLFSNWEKLQIFVACVIENHKRDWNPAEARDFIDAYLQEIEKHKGN---ATSSFQEE----NLIFTTLDLFFAGTETTSTTLRWGLLYMALYPEIQEKVQAEIDRVL----GQS-QQPSTAARESMPYTNAVIHEVQRMGNIIPLNVPREV-AEDTTLAGYHLPKGTMVLTNLTALHRDPAEWA-TPDTFNPEHFLENG-----KFKKREAFLPFSIGKRACLGEQLARTELFVFFTSLLQKFSFRPPDNEKLSLKFRVGLTLSPVTYRICAVHR 500          
BLAST of EMLSAG00000005163 vs. GO
Match: - (symbol:Cyp2j3 "Cytochrome P450 2J3" species:10116 "Rattus norvegicus" [GO:0005506 "iron ion binding" evidence=IEA] [GO:0005789 "endoplasmic reticulum membrane" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0070330 "aromatase activity" evidence=IEA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR008071 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PRINTS:PR01688 PROSITE:PS00086 RGD:631442 GO:GO:0005789 GO:GO:0005506 eggNOG:COG2124 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0070330 HOGENOM:HOG000036991 HOVERGEN:HBG015789 KO:K07418 EMBL:U39943 EMBL:BC089766 RefSeq:NP_786942.1 UniGene:Rn.28757 ProteinModelPortal:P51590 MINT:MINT-4577944 STRING:10116.ENSRNOP00000013087 PaxDb:P51590 PRIDE:P51590 GeneID:313375 KEGG:rno:313375 UCSC:RGD:631442 CTD:313375 InParanoid:P51590 NextBio:666056 Genevestigator:P51590 Uniprot:P51590)

HSP 1 Score: 270.396 bits (690), Expect = 7.304e-82
Identity = 178/505 (35.25%), Postives = 270/505 (53.47%), Query Frame = 0
Query:   20 IKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGI-GVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNI--GILNVLWRIVAGTRFEYRDPELQKIVHKVGDAI-LSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            +K + P+NYPP P +RLPL G   +L     +      +   ++  G VL L  A  I   +++   ++K+I        ++ H+F       L + +   +G ++S G  WK+QRRF L TL+NFG G+ S+E  + EEA   V     E I+  G +     FNI   + N++  +  G RFEY D + Q+++  + +A+ L +++   +  IFP +    PG    Q + S    +  F+   +KNH  ++DP+ PRDFID +L   K+  + PDK   SF  E    NL  + LDLFFAG+ETTS+TL W +L M  +PE+Q+K+Q E+D  + +G     R+    DR  +PYT A I E+QR GNI P  VP    + D  +  + +PKG ++   L+ + R+PK +   PD FNP+ FLE       +F K E  +PFS+GKR+C GE LAR E+F F TS++Q+F  +    E  S  F   +T  P    +  IPR
Sbjct:   35 LKHRRPKNYPPGP-WRLPLVGCLFHLDPKQPHL--SLQQFVKKY--GNVLSLDFA-NIPSVVVTGMPLIKEIFT------QMEHNFLNRPVTLLRKHLFNKNGLIFSSGQTWKEQRRFALMTLRNFGLGKKSLEQRIQEEAYHLV-----EAIKDEGGLPFDPHFNINKAVSNIICSVTFGERFEYHDSQFQEMLRLLDEAMCLESSMMCQLYNIFPRILQYLPG--SHQTLFSNWRKLKLFISDIIKNHRRDWDPDEPRDFIDAFL---KEMAKYPDKTTTSFNEE----NLICSTLDLFFAGTETTSTTLRWALLCMALYPEVQEKMQAEIDRVIGQG-----RQPNLADRDSMPYTNAVIHEVQRIGNIIPFNVPREV-AVDTYLAGFNLPKGTMILTNLTALHRDPKEWA-TPDTFNPEHFLENG-----QFKKRESFLPFSMGKRACLGEQLARSELFIFITSLIQKFTFKPPVNEKLSLQFRMSVTISPVSHRLCAIPR 501          
BLAST of EMLSAG00000005163 vs. GO
Match: - (symbol:Cyp2j3 "cytochrome P450, family 2, subfamily j, polypeptide 3" species:10116 "Rattus norvegicus" [GO:0005506 "iron ion binding" evidence=IEA] [GO:0005789 "endoplasmic reticulum membrane" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0070330 "aromatase activity" evidence=IEA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR008071 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PRINTS:PR01688 PROSITE:PS00086 RGD:631442 GO:GO:0005789 GO:GO:0005506 eggNOG:COG2124 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0070330 HOGENOM:HOG000036991 HOVERGEN:HBG015789 KO:K07418 EMBL:U39943 EMBL:BC089766 RefSeq:NP_786942.1 UniGene:Rn.28757 ProteinModelPortal:P51590 MINT:MINT-4577944 STRING:10116.ENSRNOP00000013087 PaxDb:P51590 PRIDE:P51590 GeneID:313375 KEGG:rno:313375 UCSC:RGD:631442 CTD:313375 InParanoid:P51590 NextBio:666056 Genevestigator:P51590 Uniprot:P51590)

HSP 1 Score: 270.396 bits (690), Expect = 7.304e-82
Identity = 178/505 (35.25%), Postives = 270/505 (53.47%), Query Frame = 0
Query:   20 IKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGI-GVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNI--GILNVLWRIVAGTRFEYRDPELQKIVHKVGDAI-LSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            +K + P+NYPP P +RLPL G   +L     +      +   ++  G VL L  A  I   +++   ++K+I        ++ H+F       L + +   +G ++S G  WK+QRRF L TL+NFG G+ S+E  + EEA   V     E I+  G +     FNI   + N++  +  G RFEY D + Q+++  + +A+ L +++   +  IFP +    PG    Q + S    +  F+   +KNH  ++DP+ PRDFID +L   K+  + PDK   SF  E    NL  + LDLFFAG+ETTS+TL W +L M  +PE+Q+K+Q E+D  + +G     R+    DR  +PYT A I E+QR GNI P  VP    + D  +  + +PKG ++   L+ + R+PK +   PD FNP+ FLE       +F K E  +PFS+GKR+C GE LAR E+F F TS++Q+F  +    E  S  F   +T  P    +  IPR
Sbjct:   35 LKHRRPKNYPPGP-WRLPLVGCLFHLDPKQPHL--SLQQFVKKY--GNVLSLDFA-NIPSVVVTGMPLIKEIFT------QMEHNFLNRPVTLLRKHLFNKNGLIFSSGQTWKEQRRFALMTLRNFGLGKKSLEQRIQEEAYHLV-----EAIKDEGGLPFDPHFNINKAVSNIICSVTFGERFEYHDSQFQEMLRLLDEAMCLESSMMCQLYNIFPRILQYLPG--SHQTLFSNWRKLKLFISDIIKNHRRDWDPDEPRDFIDAFL---KEMAKYPDKTTTSFNEE----NLICSTLDLFFAGTETTSTTLRWALLCMALYPEVQEKMQAEIDRVIGQG-----RQPNLADRDSMPYTNAVIHEVQRIGNIIPFNVPREV-AVDTYLAGFNLPKGTMILTNLTALHRDPKEWA-TPDTFNPEHFLENG-----QFKKRESFLPFSMGKRACLGEQLARSELFIFITSLIQKFTFKPPVNEKLSLQFRMSVTISPVSHRLCAIPR 501          
BLAST of EMLSAG00000005163 vs. GO
Match: - (symbol:LOC521656 "Uncharacterized protein" species:9913 "Bos taurus" [GO:0005506 "iron ion binding" evidence=IEA] [GO:0016712 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR008071 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PRINTS:PR01688 PROSITE:PS00086 GO:GO:0005506 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0016712 OrthoDB:EOG7RBZ85 TreeFam:TF352043 GeneTree:ENSGT00730000110385 EMBL:DAAA02008725 EMBL:DAAA02008726 EMBL:DAAA02008727 Ensembl:ENSBTAT00000013230 Uniprot:F1MTI6)

HSP 1 Score: 270.396 bits (690), Expect = 8.288e-82
Identity = 178/502 (35.46%), Postives = 268/502 (53.39%), Query Frame = 0
Query:   20 IKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAI-LSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            +K ++P+NYPP P  RLP  G+  +L   GK       ++  ++  G ++ L     I   +I+    +K+ L   + N+   +   I   K ++      G + S G +WK+QRRF L+TL+NFG GR S+E+ + EE T  +  + EEN   G       + N  + N++  I  G RF+Y+D + Q+++  + + + +  ++   +   FP +    PG      +  K   +  F+   ++NH  +++P   RDFID YL +I+  + N      SF  E    NL  + LDLF AG+ETTS+TL WG+LFM  +PEIQ+KVQ E+D  L    G+S +K  +  R  +PYT A I E+QR GNI PM VP    + D  +  Y + KG +V   L+ + R+P  +   PD FNP+ FLE       +F K E  +PFSIGKR C GE LAR E+F FFTS+LQ+F  R  + E  S  F   +TS P  + +  IPR
Sbjct:   35 LKRQHPKNYPPGP-LRLPFIGNFFHL-DLGKGILVP-QQVVKKY--GNIIRLDFGV-IHFIVITGLPYIKEALVNQEQNF--VNRPMIPLQKHIFNN---KGLVRSNGQVWKEQRRFTLTTLRNFGLGRKSLEERIQEEVTYLIQAIGEEN---GQPFDPHFIINNAVSNIICSITFGERFDYKDDQFQELLRLLDEILCIQASVCCQLYNAFPRIMNFLPG--SHHTLFRKWEKLKMFVANVIENHRKDWNPAEARDFIDAYLQEIEKHKGN---ATSSFDDE----NLICSTLDLFLAGTETTSTTLRWGLLFMALNPEIQEKVQAEIDRVL----GQS-QKVSTASRESMPYTNAVIHEVQRMGNIVPMNVPREV-TVDTVLAGYHLVKGTMVLTNLTALHRDPAEWA-TPDTFNPEHFLENG-----QFKKRESFLPFSIGKRMCLGEQLARTELFIFFTSLLQKFTFRPPENEKLSLKFRESLTSSPASYRLCAIPR 501          
BLAST of EMLSAG00000005163 vs. GO
Match: - (symbol:cyp2p9 "cytochrome P450, family 2, subfamily P, polypeptide 9" species:7955 "Danio rerio" [GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0005506 "iron ion binding" evidence=IEA] [GO:0016712 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen" evidence=IEA] [GO:0016491 "oxidoreductase activity" evidence=IEA] [GO:0004497 "monooxygenase activity" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR008069 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PRINTS:PR01686 PROSITE:PS00086 ZFIN:ZDB-GENE-040120-2 GO:GO:0005506 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0016712 TreeFam:TF352043 GeneTree:ENSGT00730000110385 EMBL:BX322665 Ensembl:ENSDART00000063128 ArrayExpress:E7FEJ8 Bgee:E7FEJ8 Uniprot:E7FEJ8)

HSP 1 Score: 267.7 bits (683), Expect = 7.641e-81
Identity = 186/522 (35.63%), Postives = 284/522 (54.41%), Query Frame = 0
Query:    4 ALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKIL--KTDDLNYRLAHDFSIDYTKKLYQGIG-VDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEE-NIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAI-LSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            +++I +C+ L    Y IK K P+N+PP P + LP+ G   ++ ++  + Q  F +  +R+  G +  L++    R+ +++ ++++K++   + D+L  R             Y+ IG   G + S G  WK QRRF LSTL+NFG G+ S+E  +  E      FLNE  + + G       L N  + NV+  +V G RF+Y D   Q ++  + +AI L   +   +  +FP+L    PG    ++V +    V +F++  V  H+ + DP +PRD+ID +L ++   E+  D     F  E    NL    LDLF AG+ETTS+TL WG+L+M+++P IQ KVQEE+D  +    G S R     DR ++PYT A I EIQR GNI P+ V   T S D ++G Y VPKG +V + L+ +  +   +   P  FNP  FL        KF + +  +PFS+GKR C GE LARME+F FF+S+LQRF      G  PS D+  G T  P+P+ +  +PR
Sbjct:   14 SILIFLCVFLLLGDY-IKNKAPKNFPPGP-WSLPIIGDLHHIDNSKIHLQ--FTKFAERY--GNIFSLRLFGP-RIVVLNGYNLVKEVYIKQGDNLADRPVLPL-------FYEIIGDKAGIVLSSGYKWKHQRRFALSTLRNFGLGKKSLEPSINLEC----GFLNEAISNEQGRPFDPRLLLNNAVSNVICVLVFGNRFDYSDHHFQTLLKHINEAIYLEGGICAQLYNMFPWLMQRLPG--SHKKVITLWKKVIDFIRQKVNEHKVDHDPLNPRDYIDCFLAEM---EKLKDDTAAGFDVE----NLCICTLDLFVAGTETTSTTLYWGLLYMMKYPVIQAKVQEEIDRVV----GGS-RHPSVSDRDNMPYTNAVIHEIQRMGNIIPINVTRTT-SEDIRIGKYSVPKGTMVTSNLTSVLFDESEW-ETPHSFNPGHFLNAEG----KFRRRDAFLPFSLGKRVCLGEQLARMELFLFFSSLLQRFTFSPPAGVEPSLDYKLGATHCPQPYKLCAVPR 497          
BLAST of EMLSAG00000005163 vs. GO
Match: - (symbol:cyp2p10 "cytochrome P450, family 2, subfamily P, polypeptide 10" species:7955 "Danio rerio" [GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0005506 "iron ion binding" evidence=IEA] [GO:0016712 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen" evidence=IEA] [GO:0016491 "oxidoreductase activity" evidence=IEA] [GO:0004497 "monooxygenase activity" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] InterPro:IPR001128 InterPro:IPR002401 InterPro:IPR008069 InterPro:IPR017972 Pfam:PF00067 PRINTS:PR00385 PRINTS:PR00463 PRINTS:PR01686 PROSITE:PS00086 ZFIN:ZDB-GENE-040120-1 GO:GO:0005506 GO:GO:0020037 Gene3D:1.10.630.10 SUPFAM:SSF48264 GO:GO:0016712 HOVERGEN:HBG015789 KO:K07418 EMBL:BC049521 RefSeq:NP_958919.1 UniGene:Dr.133560 ProteinModelPortal:Q7ZU60 GeneID:399485 KEGG:dre:399485 CTD:399485 InParanoid:Q7ZU60 NextBio:20816595 Uniprot:Q7ZU60)

HSP 1 Score: 266.544 bits (680), Expect = 2.055e-80
Identity = 187/529 (35.35%), Postives = 288/529 (54.44%), Query Frame = 0
Query:    4 ALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFG-------HSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVD-GXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGG---NIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAI-LSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            +++I +C+ L    Y IK K P+N+PP P + LP  G       + ++L+     F E + +IF  F + G          R+ +++ ++++K++      N  LA   ++  T  +   IG + G + S G  WK QRRF L+TL+NFG G+ ++E  +  E      FLNE      G   N R+  L N  + NV+  +V G RFEY D   Q +++K+ +++ L  ++   +  +FP+L  + PG    +++ +    V +F++  V  H  ++DP+  RD+ID +L ++   E++ D     F  E    NL    LDLF AG+ETTS+TL WG+L+M+++PEIQ KVQ+E+D  +    G S R+    DR ++PYT A I EIQR GNI P+ V   T S D ++  Y +PKG +V   L+ +  +   +   P  FNP  FL    D   KF + +  +PFS+GKR C GE LARME+F FF+S+LQRF      G  PS DF  G T  PKP+ +  +PR
Sbjct:   14 SILIFLCVFLLLSDY-IKNKAPKNFPPGP-WSLPFIGDLHHIDPNKIHLQFT--EFAEKYGKIFS-FRLFGS---------RIVVLNGYNLVKEVYTQQGDN--LADRPTLPITSAI---IGDNRGLVASSGYKWKHQRRFALTTLRNFGLGKKNLELSINFEC----GFLNEAISNEQGRPFNPRL--LLNNAVSNVICVLVFGNRFEYSDHHFQNLLNKINESVYLEGSIFVHLYNMFPWLMQLLPG--PHKKLITLWQRVTDFVREKVNEHRVDYDPSSLRDYIDCFLAEM---EKHKDDTAAGFDVE----NLCMCTLDLFVAGTETTSTTLYWGLLYMIKYPEIQAKVQQEIDAVV----GSS-RQPSGSDRDNMPYTNAVIHEIQRMGNIIPLNVVRTT-SEDTRIEKYSIPKGTLVIGSLTSVLFDESEW-ETPHSFNPGHFL----DAEGKFRRRDAFLPFSLGKRVCLGEQLARMELFLFFSSVLQRFTFSPPAGVEPSLDFKMGFTRCPKPYKLCAVPR 497          
BLAST of EMLSAG00000005163 vs. C. finmarchicus
Match: gi|592903285|gb|GAXK01055090.1| (TSA: Calanus finmarchicus comp84427_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 311.997 bits (798), Expect = 1.821e-97
Identity = 194/529 (36.67%), Postives = 296/529 (55.95%), Query Frame = 0
Query:    3 VALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGH-SLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSID-YTKKLYQGIG-----VDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFL-NEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPT--IAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFEL-RSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
             AL + VC+++    Y+  W    ++ P+P   +P  GH  + L +        +D ++ +F+  G+L  + A   R  ++ DFD LK +    D+  R   +F  D  TK + +  G      +G ++S G IW  QRRF L TL++FGFG+S ME M+ EE   F + L N EN+     + IA   N+ ILN LWR+ AG  FEY +P L  ++ ++ + +L  + +P   I   FP +  I+P   +  E       +   ++ +++ H+  FD N PRDFID YL +I    EN    N SF G+ G  NL+ TL DLF AGSETTS+TL+W VL+MVR+ E+Q+KVQ+E+D  + +     ++     D+ +LPYTEA + EIQR  NI P GV H T S D  V   V+PK   V +  + I +    +  N   F P+RFL+  ++G  K  K+++L+PFSIGKR C GE LA+ E+F FF  +LQ F++   + G +PS +++ G T++P+ F I++  R
Sbjct:  109 TALAVLVCVLIFKKTYKNAW----SHLPSPGLPIPFLGHLRMILINPNDPVNAAWD-LYKKFSQKGLLFTK-AFHFRTVLVGDFDTLKFLFNHPDVQARTGANFHTDTLTKMIKEERGSPSGPTEGVIFSQGKIWADQRRFTLRTLRDFGFGKSGMEGMVQEEMVKFRSLLENHENLP----LDIAGKMNLPILNSLWRVAAGEHFEYDNPFLVDLLSRMTE-MLQRSARPEALILMTFPSISKIWPSFLERDEDIRINRDMMNMMRKSIEKHQQTFDQNDPRDFIDKYLTEI----ENTKDPNSSFFGKNGIENLASTLTDLFIAGSETTSTTLTWAVLYMVRNKEVQQKVQKEIDSAIGQ-----YKLPSLADKPNLPYTEAVLMEIQRCANIAPDGVQHYT-SKDVTVNGVVIPKDTFVQSLNAEILKGD--YWENGKSFKPERFLD--AEGKAK--KDDHLVPFSIGKRQCLGETLAKAELFIFFAGLLQHFKIEEEVPGILPSDNYVVGATTLPESFKIRMTKR 1614          
BLAST of EMLSAG00000005163 vs. C. finmarchicus
Match: gi|592903286|gb|GAXK01055089.1| (TSA: Calanus finmarchicus comp84427_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 311.997 bits (798), Expect = 3.822e-97
Identity = 194/529 (36.67%), Postives = 296/529 (55.95%), Query Frame = 0
Query:    3 VALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGH-SLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSID-YTKKLYQGIG-----VDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFL-NEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPT--IAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFEL-RSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
             AL + VC+++    Y+  W    ++ P+P   +P  GH  + L +        +D ++ +F+  G+L  + A   R  ++ DFD LK +    D+  R   +F  D  TK + +  G      +G ++S G IW  QRRF L TL++FGFG+S ME M+ EE   F + L N EN+     + IA   N+ ILN LWR+ AG  FEY +P L  ++ ++ + +L  + +P   I   FP +  I+P   +  E       +   ++ +++ H+  FD N PRDFID YL +I    EN    N SF G+ G  NL+ TL DLF AGSETTS+TL+W VL+MVR+ E+Q+KVQ+E+D  + +     ++     D+ +LPYTEA + EIQR  NI P GV H T S D  V   V+PK   V +  + I +    +  N   F P+RFL+  ++G  K  K+++L+PFSIGKR C GE LA+ E+F FF  +LQ F++   + G +PS +++ G T++P+ F I++  R
Sbjct:  197 TALAVLVCVLIFKKTYKNAW----SHLPSPGLPIPFLGHLRMILINPNDPVNAAWD-LYKKFSQKGLLFTK-AFHFRTVLVGDFDTLKFLFNHPDVQARTGANFHTDTLTKMIKEERGSPSGPTEGVIFSQGKIWADQRRFTLRTLRDFGFGKSGMEGMVQEEMVKFRSLLENHENLP----LDIAGKMNLPILNSLWRVAAGEHFEYDNPFLVDLLSRMTE-MLQRSARPEALILMTFPSISKIWPSFLERDEDIRINRDMMNMMRKSIEKHQQTFDQNDPRDFIDKYLTEI----ENTKDPNSSFFGKNGIENLASTLTDLFIAGSETTSTTLTWAVLYMVRNKEVQQKVQKEIDSAIGQ-----YKLPSLADKPNLPYTEAVLMEIQRCANIAPDGVQHYT-SKDVTVNGVVIPKDTFVQSLNAEILKGD--YWENGKSFKPERFLD--AEGKAK--KDDHLVPFSIGKRQCLGETLAKAELFIFFAGLLQHFKIEEEVPGILPSDNYVVGATTLPESFKIRMTKR 1702          
BLAST of EMLSAG00000005163 vs. C. finmarchicus
Match: gi|592812829|gb|GAXK01141739.1| (TSA: Calanus finmarchicus comp190848_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 291.197 bits (744), Expect = 3.151e-89
Identity = 178/535 (33.27%), Postives = 294/535 (54.95%), Query Frame = 0
Query:    8 TVCLILAXILYEIKW-KYPE---NYPPTPPFRLPLFGH--SLY----LRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGI---GVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIF--PFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELR-SIDGEIPSTDFISGITSIPKPFNIKLIPRDVKIIV 526
            +VC++   IL  + W KY +      P P  ++P  GH  SL     L     N +  +  +F  +N+ G+  + + +         ++++   LK  +++ R+          K+   I   G+ G + + G  W++QRRF   TLKNFGFG+SSME ++ EE   F   L +E+    G + +AN FN+ ++NVLWRI+ G RF+Y+D +  ++V  + +   +    P +A +F  PFL+   P +   + +      VYEFL+  +K+H+ N D ++P+DFID YL+++K  ++N D  + SF  E+G   L   L DLF AGSET+S+ L W ++F++R P+ Q ++  ELD  + +      R A  ED+   P+T A I E+ R  +  P+ V H T + D +VG +V+P   ++   +S +  + K +G +P+ F P+RFL    D   +F+K+E +IP+SIG R CPGE+LA+ EIF F T +L+ F        E PS ++  G T +PK F + ++PR + I++
Sbjct:  130 SVCIVFLSILTALLWIKYSQRKKGSAPGPFLKIPFLGHLESLLGGSDLVKKSANLRRKYGDMFS-YNIIGMNTVHLCS---------YELISSALKKREISSRIPFQ-KFSNISKVMSDIYIHGLHGIVVTEGKEWQEQRRFCFKTLKNFGFGKSSMESIMHEEVINFSEQLRKES--ENGPVDLANKFNVMVINVLWRIIGGKRFDYQDEKFAELVGHLNEGFSALAPTPRLAFLFAFPFLKDWAPKLTGFENIKRGYHGVYEFLKEEIKSHQENLDLDNPKDFIDAYLIEMKKKKDNGDT-SSSFYEEMGIECLFCVLHDLFLAGSETSSTFLLWSIIFLMRDPKSQARIHAELDAVVDQD-----RLAGIEDQSKTPFTLAFIDEVHRMASHVPLAVQHWT-NEDVEVGGFVIPANSIIIPNISEVHHDHKTWG-DPEVFRPERFL----DNSGQFVKSERVIPYSIGARRCPGESLAKSEIFLFLTGLLKNFSFHIPHQEEGPSLEYNFGFTLLPKSFKVDIVPRSL*IVL 1659          
BLAST of EMLSAG00000005163 vs. C. finmarchicus
Match: gi|592804503|gb|GAXK01150065.1| (TSA: Calanus finmarchicus comp1970789_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 267.7 bits (683), Expect = 1.080e-81
Identity = 159/461 (34.49%), Postives = 244/461 (52.93%), Query Frame = 0
Query:   69 LCLQVAARIRMXMISDFDILKKILKTDDLNYRLA------HDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKP--TIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSID-GEIPSTDFISGITSIPKPFNIKLIPR 520
            LC      I +  + DF  LK +    D+  R+A        F +DY  +   G  + G   S G  WKQQRRF + TL +FGFG+SSME+++ EEA  F   L     +    ++++ LFNI +LN+LWRI  G  F Y D  +++  H V + +     +P   +  I P++  ++P + + +   +  A V   +Q  +K H+ + D NHPRDFID YL +I ++E+       SF  E G+ NL+  L+DLF  G +TT + L++ +LF+VR+ ++ K+VQ E+DL L        R    EDR  LPYT A I E+ R  N  P G   +T + D  V   ++PK  ++    + I +   +     + FNP RFL    D      ++++LIPFSIGKR CPG+ LA +++F +FT ++Q F  R +D   +P   F +GI + P PF +    R
Sbjct:   36 LCFIPLMNIPLLFVGDFKKLKLLYNHPDVQGRVALPGGQLFKFFLDYRSQKMPGESLVGLFLSQGETWKQQRRFTVKTLGDFGFGKSSMEELVWEEAEKFCESLTS---RVEKPVQVSGLFNISMLNILWRITTGDTFAYDDHRIKQFSHNVAEFLSKAFGRPDTVLTIICPWILKVFPNMANRKMNKAGYADVVRMIQDLIKTHKISHDKNHPRDFIDCYLTEILNTED----PESSFYKETGEDNLTTLLIDLFVGGDDTTPNALNFALLFLVRNRDVLKRVQLEIDLVLGS------RCPTMEDREKLPYTYATILEVLRFANTVPHGGSRST-TADVVVDGLLIPKDTIIFGIFAEILKGDCW--DQGECFNPSRFL----DDNECLKQDDHLIPFSIGKRICPGQTLANVQLFLYFTRVVQLFNFRPVDENNLPQDTFTAGIATTPTPFELIFTTR 1358          
BLAST of EMLSAG00000005163 vs. C. finmarchicus
Match: gi|592804504|gb|GAXK01150064.1| (TSA: Calanus finmarchicus comp1970789_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 266.544 bits (680), Expect = 2.865e-81
Identity = 158/461 (34.27%), Postives = 244/461 (52.93%), Query Frame = 0
Query:   69 LCLQVAARIRMXMISDFDILKKILKTDDLNYRLA------HDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKP--TIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSID-GEIPSTDFISGITSIPKPFNIKLIPR 520
            +C      I +  + DF  LK +    D+  R+A        F +DY  +   G  + G   S G  WKQQRRF + TL +FGFG+SSME+++ EEA  F   L     +    ++++ LFNI +LN+LWRI  G  F Y D  +++  H V + +     +P   +  I P++  ++P + + +   +  A V   +Q  +K H+ + D NHPRDFID YL +I ++E+       SF  E G+ NL+  L+DLF  G +TT + L++ +LF+VR+ ++ K+VQ E+DL L        R    EDR  LPYT A I E+ R  N  P G   +T + D  V   ++PK  ++    + I +   +     + FNP RFL    D      ++++LIPFSIGKR CPG+ LA +++F +FT ++Q F  R +D   +P   F +GI + P PF +    R
Sbjct:   39 ICFVPLMNIPLLFVGDFKKLKLLYNHPDVQGRVALPGGQLFKFFLDYRSQKMPGESLVGLFLSQGETWKQQRRFTVKTLGDFGFGKSSMEELVWEEAEKFCESLTS---RVEKPVQVSGLFNISMLNILWRITTGDTFAYDDHRIKQFSHNVAEFLSKAFGRPDTVLTIICPWILKVFPNMANRKMNKAGYADVVRMIQDLIKTHKISHDKNHPRDFIDCYLTEILNTED----PESSFYKETGEDNLTTLLIDLFVGGDDTTPNALNFALLFLVRNRDVLKRVQLEIDLVLGS------RCPTMEDREKLPYTYATILEVLRFANTVPHGGSRST-TADVVVDGLLIPKDTIIFGIFAEILKGDCW--DQGECFNPSRFL----DDNECLKQDDHLIPFSIGKRICPGQTLANVQLFLYFTRVVQLFNFRPVDENNLPQDTFTAGIATTPTPFELIFTTR 1361          
BLAST of EMLSAG00000005163 vs. C. finmarchicus
Match: gi|592806346|gb|GAXK01148222.1| (TSA: Calanus finmarchicus comp1026677_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 240.35 bits (612), Expect = 4.998e-70
Identity = 164/516 (31.78%), Postives = 278/516 (53.88%), Query Frame = 0
Query:    6 VITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGF-DRIFDRFNVGGVLC-LQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQR--FELRSIDGEIPSTDFISGITSIPKPFNIKL 517
            +IT  L LA IL    W       P  P+R+PL G   +L     + ++G    + DR      +C + + A   + +++DFD+ K++   D+ + R     ++ +  + YQ     G +++    W  QRRF L TLK+FGFG+ S+E    E   L ++ L EE     G+ ++A  FN+ I+N+LW++ A  RF   D +  ++V KV ++I S  + P +  ++  +  I+P +   +E    +    ++++  ++ H+ N D N+PRDFID YL +++  ++N  + N+    ELG +     L+D F AG+ET+S+TL W VL++  + ++Q + ++E+   L    G S  +A+  D  HLP+  A I E+QR   + P+ +PH T +    V  Y  P G V +A LS I  +P +F   P++F P+RF  + +DG  +F K+E + PF +GKR C GE LAR EIF F  ++LQ+  F+      +   +++I  +T IP  F +K+
Sbjct:  346 LITGLLFLAAIL--TLWYKSRKKSPPGPYRVPLLGSLPFL-----DLRKGVVGWVLDRNITQHKICSIGLFAMEEIFVVNDFDLSKELFARDEFSGRQVSKLTLLH--RFYQR-KAQGIIFTENKQWTAQRRFSLKTLKDFGFGKQSLE----EAINLEIDCLIEEFASCHGDFKMATNFNLPIINILWQLAANMRFTKEDSKGIEMVEKV-NSIFSNGVIPVLLPMW--INKIFPKMTGYRERVEVLQEQKKYVRDIIEEHKKNIDSNNPRDFIDVYLQEMEIQKKNEVQFNEE---ELGSI-----LVDFFQAGTETSSTTLKWIVLYLCLYQDVQDRCRKEISTIL----GNS--RAQVSDMPHLPFVMATINEVQRVARVAPISLPHKT-TAPTTVEGYFFPAGSVFHANLSYIMNDPNHFH-RPEKFRPERF--IKNDG--RFEKDERVAPFGLGKRYCMGELLARNEIFLFLVTMLQKTHFKPPEFHPKPDPSNYIVNLTRIPDDFYVKM 1782          
BLAST of EMLSAG00000005163 vs. C. finmarchicus
Match: gi|592939284|gb|GAXK01019269.1| (TSA: Calanus finmarchicus comp81223_c0_seq4 transcribed RNA sequence)

HSP 1 Score: 239.965 bits (611), Expect = 5.406e-70
Identity = 156/474 (32.91%), Postives = 259/474 (54.64%), Query Frame = 0
Query:   20 IKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTD-------DLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQ 486
            ++ + P N+P T P   P+ G  L   S G + +  F+R   R   G ++  ++  ++ + +ISDFD+L +  K D       +L    A  FS D  +K   GI     ++S+G  W++QRRF + TLK FG G+S ++ ++ +E    V  L EE   +G +I +    N+ ++N LW+I+ G + + +DP++ K+     + ++  +L   +  I P+LR +       ++       + +    ++K H   FD  H RDFID Y+ K+K   E  D+++  F+G  G+ N+ +T++DLF AGSETTSS L++   ++ R+P++Q+K+Q E+D  +        R    EDR  +PYT+A I E+ R   I     PHAT + + +   + +P G  V A +S I  +P+Y+  NP+QFNP+RF+    D   +F K+E  IPF +GKR C G+ LA+ E+F F T +LQ
Sbjct:  186 LRQQKPNNFP-TGPRSFPIIGSIL---SVGFDLKNAFNRW--RKEYGAIVGFKLGNQLSV-VISDFDMLNEAFKDDRFCGRPSNLQEVFAAFFSKDKNEKSSGGI-----VFSHGDHWREQRRFAMRTLKEFGVGKSFLQTVINDEVAKLVEELREE---SGESINLKFRTNLAVVNTLWQILNGEKSDMKDPQMAKVFRSTAEFVVENSLSGPVM-IMPWLRHLPFFNTKFEKARRSPQEMRKLTSMSIKKHMDTFDEEHQRDFIDCYIKKMK---ETSDEKSSFFKGH-GEGNIQRTVMDLFGAGSETTSSVLTFAFNYLTRYPDMQEKIQAEIDTVIGS------RMPLIEDRPQMPYTDAFIHEVLRHSCII-YTTPHAT-TEEVQFHGHTLPAGTSVYANVSWIMNDPEYWH-NPEQFNPERFI----DESGQFRKDERCIPFLVGKRYCLGQQLAQHELFLFLTGLLQ 1508          
BLAST of EMLSAG00000005163 vs. C. finmarchicus
Match: gi|592939285|gb|GAXK01019268.1| (TSA: Calanus finmarchicus comp81223_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 239.965 bits (611), Expect = 5.406e-70
Identity = 156/474 (32.91%), Postives = 259/474 (54.64%), Query Frame = 0
Query:   20 IKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTD-------DLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQ 486
            ++ + P N+P T P   P+ G  L   S G + +  F+R   R   G ++  ++  ++ + +ISDFD+L +  K D       +L    A  FS D  +K   GI     ++S+G  W++QRRF + TLK FG G+S ++ ++ +E    V  L EE   +G +I +    N+ ++N LW+I+ G + + +DP++ K+     + ++  +L   +  I P+LR +       ++       + +    ++K H   FD  H RDFID Y+ K+K   E  D+++  F+G  G+ N+ +T++DLF AGSETTSS L++   ++ R+P++Q+K+Q E+D  +        R    EDR  +PYT+A I E+ R   I     PHAT + + +   + +P G  V A +S I  +P+Y+  NP+QFNP+RF+    D   +F K+E  IPF +GKR C G+ LA+ E+F F T +LQ
Sbjct:  186 LRQQKPNNFP-TGPRSFPIIGSIL---SVGFDLKNAFNRW--RKEYGAIVGFKLGNQLSV-VISDFDMLNEAFKDDRFCGRPSNLQEVFAAFFSKDKNEKSSGGI-----VFSHGDHWREQRRFAMRTLKEFGVGKSFLQTVINDEVAKLVEELREE---SGESINLKFRTNLAVVNTLWQILNGEKSDMKDPQMAKVFRSTAEFVVENSLSGPVM-IMPWLRHLPFFNTKFEKARRSPQEMRKLTSMSIKKHMDTFDEEHQRDFIDCYIKKMK---ETSDEKSSFFKGH-GEGNIQRTVMDLFGAGSETTSSVLTFAFNYLTRYPDMQEKIQAEIDTVIGS------RMPLIEDRPQMPYTDAFIHEVLRHSCII-YTTPHAT-TEEVQFHGHTLPAGTSVYANVSWIMNDPEYWH-NPEQFNPERFI----DESGQFRKDERCIPFLVGKRYCLGQQLAQHELFLFLTGLLQ 1508          
BLAST of EMLSAG00000005163 vs. C. finmarchicus
Match: gi|592939286|gb|GAXK01019267.1| (TSA: Calanus finmarchicus comp81223_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 238.039 bits (606), Expect = 4.392e-69
Identity = 154/464 (33.19%), Postives = 253/464 (54.53%), Query Frame = 0
Query:   30 PTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTD-------DLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQ 486
            PT P   P+ G  L   S G + +  F+R   R   G ++  ++  ++ + +ISDFD+L +  K D       +L    A  FS D  +K   GI     ++S+G  W++QRRF + TLK FG G+S ++ ++ +E    V  L EE   +G +I +    N+ ++N LW+I+ G + + +DP++ K+     + ++  +L   +  I P+LR +       ++       + +    ++K H   FD  H RDFID Y+ K+K   E  D+++  F+G  G+ N+ +T++DLF AGSETTSS L++   ++ R+P++Q+K+Q E+D  +        R    EDR  +PYT+A I E+ R   I     PHAT + + +   + +P G  V A +S I  +P+Y+  NP+QFNP+RF+    D   +F K+E  IPF +GKR C G+ LA+ E+F F T +LQ
Sbjct:  248 PTGPRSFPIIGSIL---SVGFDLKNAFNRW--RKEYGAIVGFKLGNQLSV-VISDFDMLNEAFKDDRFCGRPSNLQEVFAAFFSKDKNEKSSGGI-----VFSHGDHWREQRRFAMRTLKEFGVGKSFLQTVINDEVAKLVEELREE---SGESINLKFRTNLAVVNTLWQILNGEKSDMKDPQMAKVFRSTAEFVVENSLSGPVM-IMPWLRHLPFFNTKFEKARRSPQEMRKLTSMSIKKHMDTFDEEHQRDFIDCYIKKMK---ETSDEKSSFFKGH-GEGNIQRTVMDLFGAGSETTSSVLTFAFNYLTRYPDMQEKIQAEIDTVIGS------RMPLIEDRPQMPYTDAFIHEVLRHSCII-YTTPHAT-TEEVQFHGHTLPAGTSVYANVSWIMNDPEYWH-NPEQFNPERFI----DESGQFRKDERCIPFLVGKRYCLGQQLAQHELFLFLTGLLQ 1543          
BLAST of EMLSAG00000005163 vs. C. finmarchicus
Match: gi|592750666|gb|GAXK01203747.1| (TSA: Calanus finmarchicus comp385039_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 230.72 bits (587), Expect = 2.857e-67
Identity = 145/453 (32.01%), Postives = 248/453 (54.75%), Query Frame = 0
Query:   74 AARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIAN--LFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPS-TDFISGITSIPKPFNIKLIPRDVK 523
            AA   M MI+D+ + K +   ++ + R  ++++I++ + +  G    G + + G  W  QR F +  LKNFGFG+  MED+++++A   V     E+I++ G+I   N  LF + +LNVLW +VAG  F+  D +L+K++ ++   I ++ L   IA   P++R I+P +    +    +  +   ++  +K HE + D N+PRDFID+YL++IK   +N D        E  +  L     DL  AGSETT+STL W +L++  HPE+Q +  EE++    E  G+S      ED  +L + +A I EIQR G +    + H           +++P+G    + +     +P  +   P++F+P+RFL    D    F K E+ +P   G+R C GE LA+ E+F FF +++Q+ +   ++G+ P    ++ GIT +P+ FN+K+ PR +K
Sbjct:  254 AAAYPMVMINDWKLAKTLFAQEEFSGR-PNNYTINWARSM--GGKSLGVIMTDGAQWTGQRNFTVKQLKNFGFGKRGMEDIVIKQANDLV-----EHIKSVGDIIKVNGELFAVPVLNVLWDMVAGYAFDRDDEDLKKLL-ELNTFIFTSKLF-VIATSAPWVRFIFPSLTGYNKRLEALRVMRGHIRKEIKKHELDLDENNPRDFIDSYLIEIK---KNTDP-------EFCEEQLIMVGFDLMGAGSETTASTLVWVILYLALHPEVQDRCYEEIE----ENIGQS--SVTLEDTANLNFCQATIAEIQRVGQVAVASLQHRVLKDVKLPSGHIIPEGSFAMSNIKRFLTDPLLWD-EPEKFSPNRFL----DSSGTFFKPEHFVPLGHGRRVCMGEPLAKAELFIFFVTLVQKIKFDVVEGKEPDPKKYMVGITKVPEDFNVKVSPRFIK 1519          
BLAST of EMLSAG00000005163 vs. L. salmonis peptides
Match: EMLSAP00000005163 (pep:novel supercontig:LSalAtl2s:LSalAtl2s272:555567:557147:-1 gene:EMLSAG00000005163 transcript:EMLSAT00000005163 description:"augustus_masked-LSalAtl2s272-processed-gene-5.4")

HSP 1 Score: 1067.37 bits (2759), Expect = 0.000e+0
Identity = 526/526 (100.00%), Postives = 526/526 (100.00%), Query Frame = 0
Query:    1 MSVALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPRDVKIIV 526
            MSVALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPRDVKIIV
Sbjct:    1 MSVALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPRDVKIIV 526          
BLAST of EMLSAG00000005163 vs. L. salmonis peptides
Match: EMLSAP00000002359 (pep:novel supercontig:LSalAtl2s:LSalAtl2s144:369128:376155:1 gene:EMLSAG00000002359 transcript:EMLSAT00000002359 description:"snap_masked-LSalAtl2s144-processed-gene-3.3")

HSP 1 Score: 228.024 bits (580), Expect = 9.576e-68
Identity = 159/505 (31.49%), Postives = 266/505 (52.67%), Query Frame = 0
Query:   22 WKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVD-GXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEY---RDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELR-SIDGEIPSTD-FISGITSIPKPFNIKLIPR 520
            ++    +PP PP  LP+ G   Y+   G N     D  F ++   G L       I + +I+++ + K +   +D++YR    ++++      +G G   G + + G +WK+QRRF +  LK+FGFG+++++ ++  EA   +  + +E+    G +R+ + FN+GI+N+LW+I+AG RF+    +  E+   +H+V     S  L    AA F   R     +DD       +    EF ++ ++ H  ++D ++PRDFID Y+ ++ D     D+EN  F  E     L  T LD F AG ET+++TL W VL++  +PE Q K  EE++  L + D         E    + Y  A + EIQR  ++ P+ +PH T   D  +  Y +P+G  +   +     NPK+F P+P  F P+RF+E   +G +K  K E   PF +GKR C GE++A+ ++F FF  +LQ+ ++  S +  +P  + +  GIT IPKPF I +  R
Sbjct:   20 YRRKSKFPPGPP-NLPIVGTLPYMNGIGSNALT--DPKFGKY---GDLYSLFIGNIHLVVINNYQLAKDLFAREDVSYRRETWWTLNV-----RGDGHPLGIINTSGHVWKEQRRFAVRNLKDFGFGKNTLDAVIQNEARFTIEDIIKESKNNNGVLRMESTFNVGIINILWQIIAGYRFDKDNEKTKEMMGHLHEVYSEGYSI-LHYIPAARFFIKRD--KRMDD-------MLRTKEFFRSQIREHMKDYDASNPRDFIDVYIKEMLDE----DREN--FHEE----QLMTTCLDFFQAGGETSATTLLWSVLYISLYPEAQAKCVEEIEAVLGKED------PSQEVYKDMVYCNATLMEIQRMASVGPLTLPHVTIK-DLFIDGYCIPRGTEIYGNIIAFHNNPKFF-PSPKSFRPERFIE---NGKLK--KLEAFAPFGVGKRICMGESMAKNQLFIFFVMMLQKLKISVSENHGVPDPEAYTMGITKIPKPFYISVSSR 480          
BLAST of EMLSAG00000005163 vs. L. salmonis peptides
Match: EMLSAP00000007758 (pep:novel supercontig:LSalAtl2s:LSalAtl2s453:376415:377986:-1 gene:EMLSAG00000007758 transcript:EMLSAT00000007758 description:"maker-LSalAtl2s453-augustus-gene-3.8")

HSP 1 Score: 219.55 bits (558), Expect = 1.411e-64
Identity = 166/504 (32.94%), Postives = 254/504 (50.40%), Query Frame = 0
Query:   30 PTPPFRLPLFGHSLYLRSAGK----NFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLA---HDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAA-IFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTD---FISGITSIPKPFNIKLIPRDV 522
            P  PF LPL G   +L S G     +F  G     ++F  G +  + V    ++ +++DF + K +   +D++ R     H F+     K Y GI   G + + G +W+ QRRF L+ LKN GFG+ S+E ++  E       + +E I    ++ I ++F++ I+NVLW I+A  RFEY   + ++IV K+G      +LK  I   IF  +   Y  +++  E    +  +  F+      H+ N + N P+DFID YL+++  S++              K  L   L D F AGSETTS+TL W +L M  H +IQ K  +E+     +  G +F   R ED   LP+T A I E+QR  NI P  + H       +VG Y++PKG  V A       +PK F P+P +FNP RF +V         K E  +P+  GKR C G++LA+ ++F FF  I+Q + +R +  + P  D      GITS+P PF + +  R V
Sbjct:   30 PPGPFSLPLVGSLPFLSSQGSPGILDFALG-----EKF--GSIYTVDVIWS-KIVVLNDFGMAKDLFNREDVSGRYQGQWHRFT-----KGYDGIAY-GIINNEGPMWQSQRRFALTNLKNLGFGKKSLESVIYNEVHHLFEVI-DEMIDGCSDVLIHDIFHVPIINVLWSIIASHRFEYS--QAREIVEKLG-----LDLKKGIHINIFISIFANYVPLNESDEA---MLYMKRFISKNXDEHKNNLEVNAPKDFIDFYLIEMLKSQD----------PYFSKKQLIVMLFDFFLAGSETTSTTLLWIILLMCLHNDIQLKCYQEIS----QNIGNNF--PREEDMKMLPFTLATISEVQRYANIAPASLVHKVLQ-TIRVGKYLIPKGTSVIANYHKFHMDPKVF-PHPHEFNPYRFYKVP--------KPEQFVPYGFGKRICMGKSLAKKQLFYFFVMIVQNYIIR-VPKDNPRPDPKKCTMGITSVPDPFYVNIQKRVV 481          
BLAST of EMLSAG00000005163 vs. L. salmonis peptides
Match: EMLSAP00000006822 (pep:novel supercontig:LSalAtl2s:LSalAtl2s383:99037:100275:-1 gene:EMLSAG00000006822 transcript:EMLSAT00000006822 description:"maker-LSalAtl2s383-augustus-gene-2.10")

HSP 1 Score: 201.445 bits (511), Expect = 1.077e-58
Identity = 144/416 (34.62%), Postives = 213/416 (51.20%), Query Frame = 0
Query:  112 KLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKI---VHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELR-SIDGEIPSTDFIS-GITSIPKPFNIKLIPRDV 522
            K Y GI   G   S G +W+ QRRF L  LKN GFG+ S+E ++ E+       + E    +  ++ I ++F I ++NVLW+IVA   +++R+   +K+   V++V  A   TN            R   P  D   + T K+  + E L   +  H  N D N P DF+D YL+++K       K  DS      K  L+   +DLF AG+ETT++TL W +L+M  +  +Q+K  EE++  L        R  + ED  +LPYT A + EIQR  N  P  +PH     D K+GDYVVPKG +  A L G   +P  F  NP QFNPDR+L   S         +  +PF  GKR C G +LA+ E++ FF  +++ F +R  +  + P  +  +  +T  P PF + +  RDV
Sbjct:    8 KGYNGIAY-GIASSEGILWQNQRRFSLMKLKNLGFGKKSIEIIIYEQIINLFEMI-ETQKDSFNDLFIKDIFTIPVVNVLWKIVASKSYDWRNSGERKVXAAVNEVFGAAYETNF------FLEKFRHFLP-YDIADKSTLKLRQIMEEL---IDEHTQNLDENSPNDFMDVYLIEMK-------KNVDS---TFSKKQLASLCIDLFLAGAETTNTTLVWALLYMSLYEGVQEKCAEEINSVLGS------RMPQEEDMKNLPYTIATLNEIQRLCNTAPASLPHKNLK-DIKIGDYVVPKGTLFLANLIGFHHDPNIF-ENPQQFNPDRWLHYKSCP-------QQFVPFGFGKRICMGVSLAKKELYYFFVMLIKMFIIRVPLYHKRPDPNETNVSLTKSPSPFYVNITKRDV 386          
BLAST of EMLSAG00000005163 vs. L. salmonis peptides
Match: EMLSAP00000004688 (pep:novel supercontig:LSalAtl2s:LSalAtl2s245:535864:537578:-1 gene:EMLSAG00000004688 transcript:EMLSAT00000004688 description:"maker-LSalAtl2s245-augustus-gene-5.13")

HSP 1 Score: 200.675 bits (509), Expect = 3.939e-57
Identity = 138/464 (29.74%), Postives = 238/464 (51.29%), Query Frame = 0
Query:   66 GGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLST---LKNFGFGRSSMEDM---LMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDX-QEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFEL-RSIDGEIPSTDFISGITSIPKPFNIKLIPRD 521
            G ++ L++     + ++SD+  +KK              FS     +L Q +G  G + S G +WK QR+++L+    +K++  G  S+E +   +  E   F+  L  EN  +   + +  LFN  + NV+  I+   RF Y+DP+ Q+ +    +      +   +    PFL+ + PGI D   ++      +  F++  +  H    DP +P+D ID+YL++    E  PD+  + +  E     L + +LDLF A  ETT ++L W ++FM+ +P+I  KV++EL+  + E +          D I LPYT A + EI RR ++ PMG  HAT   + +   +V+P+   V   +  +  NPK +  NP++F P+RF+   +  GV F K E+ +PF +G+R C G+ LA  E F FFTS++  F+L  + +  +PS    +G+T  P  F++ +  R+
Sbjct:   70 GKIVSLKMGGET-VVVLSDYQTIKKAFS--------CKYFSARPKTELSQLLGGYGIVNSEGPLWKTQRKYLLNQKLGMKHWKSGAGSLEQIESVVSREVQSFLYTL--ENDYSNTFVNLTPLFNCAVSNVICSIIXSRRFRYQDPKFQRFMFLFDEGFRLFTMTGAMT-FLPFLK-VLPGISDTCTKLRQNREEMIAFVREIISEHRQELDPQNPKDLIDSYLVQ----ESTPDQFFEDYDPEQ---QLEQIILDLFSASVETTRTSLLWAIVFMLHNPKILSKVRDELNSVVGEDNLPQL-----SDMIKLPYTRATLYEIMRRSSVVPMGTTHAT-DREVQFEGFVLPQNSHVIPLIHAVHMNPKNW-ENPEEFRPERFI---NKEGVLF-KPEHFMPFGVGQRKCLGDRLAEQEFFLFFTSLVHVFDLGNNPEQTMPSLRGTAGVTVTPSEFSVHIKLRN 502          
BLAST of EMLSAG00000005163 vs. L. salmonis peptides
Match: EMLSAP00000007328 (pep:novel supercontig:LSalAtl2s:LSalAtl2s412:195302:204629:-1 gene:EMLSAG00000007328 transcript:EMLSAT00000007328 description:"maker-LSalAtl2s412-snap-gene-2.12")

HSP 1 Score: 188.348 bits (477), Expect = 2.259e-53
Identity = 141/498 (28.31%), Postives = 241/498 (48.39%), Query Frame = 0
Query:   23 KYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEI---PSTDFISGITSIPKPFNIKL 517
            ++   +PP P   LPL G   ++   G   Q   +  + +F   G L       I + +I+ F + K++   ++++ R    ++I+      Q +G+   + + G  W+ QRRF L  L+ FGFG+ S++ ++ EEA   ++ + +E+ +  G + +A+ FN+ I+NVLW+IVAG RF   DPE      ++        +  ++    P  R          E   K+ ++ EF +  ++ H  + D ++PRDFID YL ++  S E P                       +F   +                  IQKK +EE+   L +GD +  +   SE    LPYT A + E+QR  ++ PM +P  T + D  V  Y +P+G  + +      R+P +F P P +F P+RFL   ++ G +  K+E+ +PF +G+R C GE+LAR ++  FF  ILQ   +    G+    P + F+ GIT IP PF++++
Sbjct:   10 RWVARFPPGPR-NLPLVGSIPFMNGIGT--QGCLNPDYRKF---GDLYTLFIGPIPLIVINSFQLTKELYVKEEISSRRDTWWTINVRGDGKQSLGI---INTGGMKWQTQRRFALRQLREFGFGKRSLDSVIQEEAQASIDTILQESSKNDGKVLMASNFNVSIINVLWQIVAGQRF---DPEESSTKERMEHLNEVFRVGYSVLHYLPIARYFI----KKDERRDKMLSLKEFFREMIREHIKDQDDDNPRDFIDVYLKEVHKSGEKPS----------------------YFHIEQL-----------------IQKKCKEEIKDKL-QGDEKPTQDCISE----LPYTHATLMEVQRLASVGPMSLPRYT-TKDIDVNGYSIPEGTEIYSNFMAFHRDPDFF-PEPLEFKPERFL---TEDGSRVKKDEHFLPFGLGRRICMGESLARHQLIIFFIMILQNLNISVPIGQEKPDPESCFM-GITRIPTPFHVQI 441          
BLAST of EMLSAG00000005163 vs. L. salmonis peptides
Match: EMLSAP00000005721 (pep:novel supercontig:LSalAtl2s:LSalAtl2s309:682709:688189:1 gene:EMLSAG00000005721 transcript:EMLSAT00000005721 description:"maker-LSalAtl2s309-augustus-gene-6.40")

HSP 1 Score: 149.828 bits (377), Expect = 2.180e-39
Identity = 118/412 (28.64%), Postives = 188/412 (45.63%), Query Frame = 0
Query:  111 KKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANL-FNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSI----DGEIPSTDFISGITSIPKPFNIKL 517
            K L  G+G  G  W +       RRF  S  K+   G S +      E +  V  L  +       IR  N+ F+I ILN++W +VAG R++Y DP +QK    +   +    + P    I PF   I P       + + + +    L   V+    +   +  R FID +L    D ++NP   N+         +L     D F AG+ET+S TL   +L+MV +P IQ+    E+   + +       + +S+DR  LPYT+A + E++R     P+  P    + D +V  +  P    V   L+G+ R+ KY    PD FNP RFL   ++ G   I N ++ PF  G+R C GE++  +  F   +++L  F+  +        +PS D   GI    +PF++K+
Sbjct:  124 KDLGMGLGTGGERWKF------LRRFSSSAFKSLSGGASGLNQNFDLEVSEIVAXLRGKAKSPDPIIRNVNIYFDIPILNIIWWLVAGRRYKYGDPAIQKQFDYLKVLLEEPFIAPL--TIIPFALYIPPLRKIYNRIRNAMNSFRILLSKIVEERRKDNFTDEKRGFIDLFLKAQLDDKDNPYLSNE---------DLIMCCQDFFLAGAETSSKTLCTFILYMVLYPNIQENAASEIRDAIQKDT-----QIKSKDRHLLPYTDAVLMEVRRYATPFPI-TPFRCSNKDIRVNGFDXPANVPVQVNLNGVLRS-KYCWKAPDIFNPSRFL---NEKGAVEIPNAFM-PFGFGRRRCIGEDIGNISNFLIVSNLLHNFKFSASFSKNKNHLPSNDRFGGIIQGYEPFDVKI 507          
BLAST of EMLSAG00000005163 vs. L. salmonis peptides
Match: EMLSAP00000012088 (pep:novel supercontig:LSalAtl2s:LSalAtl2s865:171159:172708:-1 gene:EMLSAG00000012088 transcript:EMLSAT00000012088 description:"maker-LSalAtl2s865-snap-gene-0.12")

HSP 1 Score: 70.4774 bits (171), Expect = 4.058e-13
Identity = 111/471 (23.57%), Postives = 196/471 (41.61%), Query Frame = 0
Query:   31 TPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVA--ARIRMXMISDFDILKKIL-KTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGR-SSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRF-EYRDPELQKIVHK---VGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPN-HPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDR--IHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFEL 490
            +PP     + H  Y   A K F+    + F R+N G +  L     + I+   I  F+   + + K  D N  L                       S G +WK  R+ +      F  G+   M + + + A  FV ++  ++ + G +I+I + F    L+++     G +     +P+ + + H    + D+ ++ N+   I ++   L   +PG+    ++  K  A  E ++ A    E     N   +DF++  +   K S E+P   N     E+    ++   +  F AG  TTS+TL      +  HPEIQ+K+ +E+                SED+      YT A I E  R     P+ +     + D +V    + KG ++   +     NP++F PNP++F P+RF +   +  ++ I N Y  PF  G RSC     A ME       ++++FE+
Sbjct:   55 SPPILWYNYIHHFYFMEAFKRFK---SQTFTRYN-GSLPTLTTMNPSIIKQITIKQFNHFHRTMHKIKDKNLLLT---------------------LSDGSLWKLLRKDITPV---FTSGKLKEMMEPVSDIANQFVAYIETQSSE-GKSIKIQDKFQGLTLDIINACAYGIKTNSSEEPDHELLRHSKMLLNDSFITKNV---ITSVLILLFNSFPGMFKYVDMFGK--ANDELIKIANSIIETRESHNIEKKDFLNVLVQMRKKSHEDP---NTLLNDEI----ITAQAIIFFIAGYSTTSTTLCCLTYMLATHPEIQEKLYKEI--------------VSSEDKDFSEHSYTSAVIKETLRM--YPPVALHLRVCAKDTEVEGIPIKKGTIIEMPIYASHYNPEFF-PNPNEFKPERFFQ---ENNLEIIPNTYR-PFGNGNRSCIAYRFAMMEXQLILEKLVKKFEI 463          
BLAST of EMLSAG00000005163 vs. L. salmonis peptides
Match: EMLSAP00000005374 (pep:novel supercontig:LSalAtl2s:LSalAtl2s28:147448:149791:1 gene:EMLSAG00000005374 transcript:EMLSAT00000005374 description:"maker-LSalAtl2s28-augustus-gene-1.45")

HSP 1 Score: 68.9366 bits (167), Expect = 7.652e-13
Identity = 67/313 (21.41%), Postives = 130/313 (41.53%), Query Frame = 0
Query:  206 ELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLI-PFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKL 517
            +L K   +    IL T+  P +  +F      Y  + + Q     ++   +F++  + N   N   N+    +D Y +  K  E++                +   + D   AG +T+S T  + + ++ ++P++Q +++E +     + + ++F   R+            + +   R N   +G+     + DA    Y VPKG V+ +      R  KYF   P  FNP R+++   +       + YL+ PF  G R C G  +A M I      +L+++E++  D ++        I S  KP  ++L
Sbjct:   99 KLIKCAFQTNSNILITDNGPPLWKVFE--TKEYKALRESQNYIENISL--KFIRNKMNNLNTNPLSNNHLTLLDQYFVMDKLDEKD----------------ILTMVCDSLLAGIDTSSYTTGFMLYYLAKYPQVQARLRETIHELPLDHNLKNFSFGRA------------VLKETLRLNPVSVGIGRICQTSDAVFSGYSVPKGTVLVSQNQISCRLEKYFD-RPHVFNPKRWMDKNQN------YHPYLVLPFGFGPRMCIGRRIAEMSILHLLIELLKKYEIKLKDPKLELGCISYLIXSPXKPLQLEL 372          
BLAST of EMLSAG00000005163 vs. L. salmonis peptides
Match: EMLSAP00000009224 (pep:novel supercontig:LSalAtl2s:LSalAtl2s588:244024:246336:1 gene:EMLSAG00000009224 transcript:EMLSAT00000009224 description:"augustus_masked-LSalAtl2s588-processed-gene-2.0")

HSP 1 Score: 64.6994 bits (156), Expect = 2.461e-11
Identity = 61/232 (26.29%), Postives = 106/232 (45.69%), Query Frame = 0
Query:  277 FIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQR-RGNITPMGVPHATYSGDAKVGD--------YVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLE---VASDGGVKFIKNEYLI-PFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDG 495
             ID  L++ KD  +     +    G +   ++  +++D   AG +T  +T+ + +L + ++PE QKK+Q E++           R   SE+ I    T+  I E++  +G +      + T S  A++ D        + +P G VV  +        + F     +F P+R+LE   V   G   +  N+ L+ PF  GKR CPG+ LA  EI+     +++ F LR  D 
Sbjct:  306 MIDENLVQNKDFCDEESIIHQLVSGNVDIKDVKASVVDYITAGVDTIGNTVIFALLLLAKYPEKQKKLQAEIE-----------RVLGSENYI----TKENIQEMKYLKGCVNESFRLYPTASQIARILDEEIITSNGHSLPPGSVVLCHQRIASLQEQNFT-RAKEFIPERWLEXEAVTEFGTTNYAHNKSLVMPFGFGKRICPGKKLAEQEIYIMTAKLMKNFNLRLHDA 521          
BLAST of EMLSAG00000005163 vs. SwissProt
Match: gi|1706098|sp|P51590.1|CP2J3_RAT (RecName: Full=Cytochrome P450 2J3; AltName: Full=CYPIIJ3)

HSP 1 Score: 270.396 bits (690), Expect = 2.687e-83
Identity = 178/505 (35.25%), Postives = 270/505 (53.47%), Query Frame = 0
Query:   20 IKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGI-GVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNI--GILNVLWRIVAGTRFEYRDPELQKIVHKVGDAI-LSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            +K + P+NYPP P +RLPL G   +L     +      +   ++  G VL L  A  I   +++   ++K+I        ++ H+F       L + +   +G ++S G  WK+QRRF L TL+NFG G+ S+E  + EEA   V     E I+  G +     FNI   + N++  +  G RFEY D + Q+++  + +A+ L +++   +  IFP +    PG    Q + S    +  F+   +KNH  ++DP+ PRDFID +L   K+  + PDK   SF  E    NL  + LDLFFAG+ETTS+TL W +L M  +PE+Q+K+Q E+D  + +G     R+    DR  +PYT A I E+QR GNI P  VP    + D  +  + +PKG ++   L+ + R+PK +   PD FNP+ FLE       +F K E  +PFS+GKR+C GE LAR E+F F TS++Q+F  +    E  S  F   +T  P    +  IPR
Sbjct:   35 LKHRRPKNYPPGP-WRLPLVGCLFHLDPKQPHL--SLQQFVKKY--GNVLSLDFA-NIPSVVVTGMPLIKEIFT------QMEHNFLNRPVTLLRKHLFNKNGLIFSSGQTWKEQRRFALMTLRNFGLGKKSLEQRIQEEAYHLV-----EAIKDEGGLPFDPHFNINKAVSNIICSVTFGERFEYHDSQFQEMLRLLDEAMCLESSMMCQLYNIFPRILQYLPG--SHQTLFSNWRKLKLFISDIIKNHRRDWDPDEPRDFIDAFL---KEMAKYPDKTTTSFNEE----NLICSTLDLFFAGTETTSTTLRWALLCMALYPEVQEKMQAEIDRVIGQG-----RQPNLADRDSMPYTNAVIHEVQRIGNIIPFNVPREV-AVDTYLAGFNLPKGTMILTNLTALHRDPKEWA-TPDTFNPEHFLENG-----QFKKRESFLPFSMGKRACLGEQLARSELFIFITSLIQKFTFKPPVNEKLSLQFRMSVTISPVSHRLCAIPR 501          
BLAST of EMLSAG00000005163 vs. SwissProt
Match: gi|21264413|sp|P51589.2|CP2J2_HUMAN (RecName: Full=Cytochrome P450 2J2; AltName: Full=Arachidonic acid epoxygenase; AltName: Full=CYPIIJ2)

HSP 1 Score: 263.077 bits (671), Expect = 1.701e-80
Identity = 179/520 (34.42%), Postives = 270/520 (51.92%), Query Frame = 0
Query:    5 LVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNY--RLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQT-GGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAI-LSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            L+ TV  +LA     +K + P+NYPP P +RLP  G+   +     + +    ++F +   G +  L++   I   +I+   ++K+ L   D N+  R          KK       +G + S G  WK+QRRF L+ L+NFG G+ S+E+ + EEA      + EEN Q    + +I N     + N++  I  G RFEY+D   Q+++  + +   L  +    +  +FP++    PG    Q + S    +  F+   +  H  +++P   RDFID YL ++     NP     SF  E    NL  + LDLFFAG+ETTS+TL W +L+M  +PEIQ+KVQ E+D  + +G   S     +  R  +PYT A I E+QR GNI P+ VP    + D  +  Y +PKG ++   L+ + R+P  +   PD FNPD FLE       +F K E  +PFSIGKR+C GE LAR E+F FFTS++Q+F  R  + E  S  F  GIT  P    +  +P+
Sbjct:   22 LLGTVAFLLAADF--LKRRRPKNYPPGP-WRLPFLGNFFLVDFEQSHLEV---QLFVK-KYGNLFSLELG-DISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHIFKK-------NGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINN----AVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFLPG--PHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDAYLKEMSKHTGNP---TSSFHEE----NLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPS-----TAARESMPYTNAVIHEVQRMGNIIPLNVPREV-TVDTTLAGYHLPKGTMILTNLTALHRDPTEWA-TPDTFNPDHFLENG-----QFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCAVPQ 501          
BLAST of EMLSAG00000005163 vs. SwissProt
Match: gi|1706096|sp|P52786.2|CP2J1_RABIT (RecName: Full=Cytochrome P450 2J1; AltName: Full=CYPIIJ1; AltName: Full=Cytochrome P-450IB)

HSP 1 Score: 263.077 bits (671), Expect = 1.710e-80
Identity = 177/508 (34.84%), Postives = 270/508 (53.15%), Query Frame = 0
Query:   18 YEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNY--RLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQT-GGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAI--LSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            Y +K + P+NYPP P +RLP  G+   L     + Q    +   ++  G + CL +A +  + +++   ++K++L   D N+  R          KK       +G + S G +WK+QRRF L TL+NFG G+ S+E+ + EEA      + +E  Q    + +I N     + N++  I  G RFEY D + Q+++ K+ D +  L  ++   +  IFP++    PG    Q + S    +  F+   ++NH+ +++P   RDFID YL   K+  + P     SF  E    NL  + LDLF AG+ETTS  + WG+LFM  +PEIQ+KV  E+D  + +     +++     R  LPYT A I E+QR GNI P+ VP    + D  +  Y +PKG VV   L+ + ++P+ +   PD FNP+ FLE       +F K E  IPFSIGKR+C GE LA+ E+F FFTS++Q+F  +    E  + +F  GIT  P    I  IPR
Sbjct:   33 YFLKTRRPKNYPPGP-WRLPFLGNLFTLDMEKSHLQ--LQQFVKKY--GNLFCLDLAGK-SIVIVTGLPLIKEVLVHMDQNFINRPVPPIRERSFKK-------NGLIMSSGQLWKEQRRFALMTLRNFGLGKKSLEERIQEEARHLTEAMEKEGGQPFDAHFKINN----AVSNIICSITFGERFEYHDGQFQELL-KLFDEVMYLEASMLCQLYNIFPWIMKFLPGAH--QTLFSNWKKLELFVSRMLENHKKDWNPAETRDFIDAYL---KEMSKYPGSATSSFNEE----NLICSTLDLFLAGTETTSD-MRWGLLFMALYPEIQEKVHAEIDSVIGQ-----WQQPSMASRESLPYTNAVIHEVQRMGNILPLNVPREV-TVDTTLAGYHLPKGTVVLTNLTALHKDPEEWA-TPDTFNPEHFLENG-----QFKKKEAFIPFSIGKRACLGEQLAKSELFIFFTSLMQKFTFKPPSDEKLTLNFRMGITLSPVKHRICAIPR 500          
BLAST of EMLSAG00000005163 vs. SwissProt
Match: gi|117225|sp|P10632.2|CP2C8_HUMAN (RecName: Full=Cytochrome P450 2C8; AltName: Full=CYPIIC8; AltName: Full=Cytochrome P450 IIC2; AltName: Full=Cytochrome P450 MP-12; AltName: Full=Cytochrome P450 MP-20; AltName: Full=Cytochrome P450 form 1; AltName: Full=S-mephenytoin 4-hydroxylase)

HSP 1 Score: 261.922 bits (668), Expect = 3.362e-80
Identity = 156/414 (37.68%), Postives = 233/414 (56.28%), Query Frame = 0
Query:  110 TKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAI--FPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDG--EIPSTDFISGITSIPKPFNIKLIP 519
            ++++ +G+G+   + S G  WK+ RRF L+TL+NFG G+ S+ED + EEA   V  L +          I         NV+  +V   RF+Y+D     ++ +  +     N  P I     FP L   +PG  +  +V   VA    +++  VK H+A+ D N+PRDFID +L+K+       ++E D+ + E    NL  T+ DLF AG+ETTS+TL +G+L +++HPE+  KVQEE+D  +        R    +DR H+PYT+A + EIQR  ++ P GVPHA  + D K  +Y++PKG  + A L+ +  + K F PNP+ F+P  FL    D    F K++Y +PFS GKR C GE LARME+F F T+ILQ F L+S+D    + +T    GI S+P  + I  IP
Sbjct:  103 SQRITKGLGI---ISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFI---LGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILN-SPWIQVCNNFPLLIDCFPGTHN--KVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKM-------EQEKDNQKSEFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGR-----HRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAV-TTDTKFRNYLIPKGTTIMALLTSVLHDDKEF-PNPNIFDPGHFL----DKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIP 489          
BLAST of EMLSAG00000005163 vs. SwissProt
Match: gi|341940387|sp|O54750.2|CP2J6_MOUSE (RecName: Full=Cytochrome P450 2J6; AltName: Full=Arachidonic acid epoxygenase; AltName: Full=CYPIIJ6)

HSP 1 Score: 259.61 bits (662), Expect = 3.100e-79
Identity = 176/518 (33.98%), Postives = 272/518 (52.51%), Query Frame = 0
Query:    5 LVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAI-LSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPRD 521
            LV  V  +L    +  K + P+NYPP P + LP  G+   L     +       +  ++  G +  L +   I   +I+   ++K+ L   + N  +    S+   +   +    +G ++S G IWK+QRRF L TL+NFG G+ S+E+ + EEA+  V  + EE    G         N  + N++  +  G RF+Y D   Q+++  + + + L T +   +  IFP++    PG    Q+V      +  F+   + +H  +++P+ PRDFID +L   K+  + P+K   SF  E    NL  + LDLFFAG+ETTS+TL W +L+M  +PE+Q+KVQ E+D  + +      R AR  DR  +PYT A I E+QR GNI P+ VP    + D  +  + +PKG +V   L+ + R+PK +   PD FNP+ FLE       +F K E  +PFS+GKR+C GE LAR E+F FFTS++Q+F       E  S  F +G+T  P    I  +PR 
Sbjct:   22 LVAAVTFLLLADYF--KNRRPKNYPPGP-WGLPFVGNIFQLDFGQPHL--SIQPLVKKY--GNIFSLNLGD-ITSVVITGLPLIKEALTQMEQNI-MNRPLSVMQERISNK----NGLIFSSGQIWKEQRRFALMTLRNFGLGKKSLEERMQEEASHLVEAIREEE---GKPFNPHFSINNAVSNIICSVTFGERFDYHDSRFQEMLRLLDEVMYLETTMISQLYNIFPWIMKYIPG--SHQKVFRNWEKLKLFVSCMIDDHRKDWNPDEPRDFIDAFL---KEMTKYPEK-TTSFNEE----NLICSTLDLFFAGTETTSTTLRWALLYMALYPEVQEKVQAEIDRVIGQK-----RAARLADRESMPYTNAVIHEVQRMGNIIPLNVPREV-AMDTNLNGFHLPKGTMVLTNLTALHRDPKEWA-TPDVFNPEHFLENG-----QFKKRESFLPFSMGKRACLGEQLARSELFIFFTSLMQKFTFNPPINEKLSPKFRNGLTLSPVSHRICAVPRQ 501          
BLAST of EMLSAG00000005163 vs. SwissProt
Match: gi|77416854|sp|Q16696.3|CP2AD_HUMAN (RecName: Full=Cytochrome P450 2A13; AltName: Full=CYPIIA13)

HSP 1 Score: 253.447 bits (646), Expect = 6.472e-77
Identity = 167/496 (33.67%), Postives = 269/496 (54.23%), Query Frame = 0
Query:   30 PTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKIL--KTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKV-GDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDG--EIPSTDFISGITSIPKPFNIKLIPR 520
            PTP   LP  G+  YL+   +       +I +R+  G V  + +  R R+ ++   D +K+ L  + ++ + R     + D+   L++G GV    +S G   KQ RRF ++TL+ FG G+  +E+ + EEA   ++ L   +   G NI      +  + NV+  IV G RF+Y D E   ++  + G    +      +  +F  +    PG    Q+   ++  + +F+   V++++   DPN PRDFID++L+++++ E+NP+ E           NL  T L+LFFAG+ET S+TL +G L +++HPE++ KV EE+D  + +      R+ + EDR  +PYTEA I EIQR G++ PMG+ H   + D K  D+ +PKG  V   L  + R+P++F  NP  FNP  FL    D   +F K++  +PFSIGKR C GE LARME+F FFT+I+Q F  +S     +I  +    G  +IP+ + +  +PR
Sbjct:   37 PTP---LPFIGN--YLQLNTEQMYNSLMKISERY--GPVFTIHLGPR-RVVVLCGHDAVKEALVDQAEEFSGR-GEQATFDW---LFKGYGV---AFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTH---GANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPG--PQQQAFKELQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTE-------FYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKN-----RQPKFEDRAKMPYTEAVIHEIQRFGDMLPMGLAHRV-NKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFS-NPRDFNPQHFL----DKKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGFATIPRNYTMSFLPR 494          
BLAST of EMLSAG00000005163 vs. SwissProt
Match: gi|461820|sp|P33262.1|CP2CK_MACFA (RecName: Full=Cytochrome P450 2C20; AltName: Full=CYPIIC20; AltName: Full=Cytochrome P450-MK1; AltName: Full=Cytochrome P450-MKMP13)

HSP 1 Score: 252.677 bits (644), Expect = 1.090e-76
Identity = 176/535 (32.90%), Postives = 272/535 (50.84%), Query Frame = 0
Query:    1 MSVALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLR-----SAGKNFQEGFDRIFD-RFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFS----IDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHK--VGDAILSTNLKPTIAAI--FPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDG--EIPSTDFISGITSIPKPFNIKLIP 519
            M   +V+ +CL    +    +        P  P  LP+ G+ L +       +  NF + +  +F   F +  V+ L     ++  +I +                 A +FS    +  ++++  G+G+   + S G  WK+ RRF L+TL+NFG G+ S+ED + EEA   V  L +          I         NV+  +V   RF+Y+D     ++ +  V   IL++   P I     FP L   +PG  +  ++   VA    +++  VK H+A  D N+PRDFID +L+K+       ++E D+ + E    NL  T+ DLF AG+ETTS+TL +G+L +++HPE+  KVQEE+D  +        R    +DR H+PYT+A I EIQR  ++ P GVPHA  + D K  +Y++PKG ++   L+ +  + K F PNP  F+P  FL    D    F K++Y +PFS GKR C GE LARME+F F T+ILQ F L+S+     + +T    GI S+P  + I  IP
Sbjct:    1 MDPFVVLVLCLSFVLLFSLWRQSSGRRKLPPGPTPLPIIGNILQIDVKDICKSFSNFSKVYGPVFTVYFGMNPVVVLHGYETVKEALIDN-----------------AEEFSGRGILPISERITNGLGI---ISSNGKRWKETRRFSLTTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFI---LGCAPCNVICSVVFQKRFDYKDENFLTLIKRFTVNFRILTS---PWIQVCNNFPLLIDCFPGTHN--KLLKNVALTKSYIREKVKEHQATLDVNNPRDFIDCFLIKM-------EQEKDNQQSEFTIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGR-----HRSPCMQDRSHMPYTDAVIHEIQRYIDLVPTGVPHAV-TTDIKFRNYLIPKGTIIITLLTSVLHDDKEF-PNPKIFDPGHFL----DENGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVADLKNLNTTSATRGIISLPPSYQICFIP 489          
BLAST of EMLSAG00000005163 vs. SwissProt
Match: gi|117200|sp|P24454.1|CP2A8_MESAU (RecName: Full=Cytochrome P450 2A8; AltName: Full=CYPIIA8; AltName: Full=Cytochrome P450-AFB; AltName: Full=Cytochrome P450-MC1)

HSP 1 Score: 248.825 bits (634), Expect = 3.393e-75
Identity = 165/522 (31.61%), Postives = 281/522 (53.83%), Query Frame = 0
Query:    5 LVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKIL--KTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAI--LSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDG--EIPSTDFISGITSIPKPFNIKLIPR 520
            +V+  CL +  I+   + +      P  P  LP  G+ L L +  + F +   ++ +R+  G V  + +  R  + M+  +D +K+ L  + ++L+ R    F  D+    ++G GV   ++S G   KQ RRF ++TL++FGFG+  +E+  +EE +  +  L + N   G  I      +  + NV+  IV G RFEY D E   ++  +  +   +ST+        +  ++ + PG     +   ++  + +F+   V+ ++   DPN PRDFID++L+++++ ++NP       R +    NL  T L+LFFAG+ET S+T  +G L ++++P I  K+ EE+D  +        R+ + ED + +PYTEA I EIQR  ++ P+G+P +T + D K  D+++PKG  V   LS + ++PK+F  NP+ FNP  F    SD   +F K+   +PFS+GKR C GE+LA+ME+F FFT+I+Q F  +S     +I  T       +IP  F +  +PR
Sbjct:    9 VVVLTCLSVMIIMSVWRQRRLLRKMPPGPTPLPFIGNFLELDT--EKFYDCLSKMRERY--GPVFTIHLGPRPAV-MLWGYDAVKEALIDQAEELSDRGEQAF-FDW---FFKGYGV---VFSSGERAKQLRRFSIATLRDFGFGKRGIEERTIEETSFLIQALRDTN---GATIDPTFYMSRTVSNVISSIVFGNRFEYDDKEFLSLLGMIMRSFQFMSTSTGQLFEMFYSVMKHL-PGCQ--HQAYKEMQGLEDFIARKVEENQRTLDPNSPRDFIDSFLIRMQEEKKNP-------RTQFHMRNLLMTTLNLFFAGTETVSTTTRYGFLLLMKYPHIAAKMHEEIDQVIGRN-----RQPKYEDHLKMPYTEAVIYEIQRFVDVVPLGLPRST-TKDIKFRDFLIPKGTDVFPVLSSVLKDPKFFS-NPNDFNPQHF----SDDKGQFKKSNAFMPFSVGKRYCFGESLAKMELFIFFTTIMQNFCFKSPQAPQDIDVTPQYFSFAAIPPKFTMSFLPR 494          
BLAST of EMLSAG00000005163 vs. SwissProt
Match: gi|19924285|sp|Q08078.1|CP2CP_MESAU (RecName: Full=Cytochrome P450 2C25; AltName: Full=CYPIIC25; AltName: Full=Cytochrome P450 HSM1)

HSP 1 Score: 247.284 bits (630), Expect = 1.481e-74
Identity = 169/521 (32.44%), Postives = 274/521 (52.59%), Query Frame = 0
Query:    6 VITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQ---EGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGD--AILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSI--DGEIPSTDFISGITSIPKPFNIKLIP 519
            V+ +  IL+ +++   W+        PP   PL     +L+   KN       F +++     G V  L +  +  + ++  ++ +K+ L      +    DF +   +++ +G+G+   ++S G  WK+ RRF L TL+N G G+ ++ED + EEA   V  L + N   G       + +    NV+  I+   RF+Y+D +    + KV +   ILS+     +   FP L    PG     ++T  V  + +++   ++ H+ + D  +PRDFID YL+K+K +  N        + E    NL+ T+ DLF AG+ETTS+TL + +L +++HP +  KVQEE+D  +        RK   +DR H+PYT+A I E+QR  ++ P+ +PHA  + D K  DY +PKG  V   LS +  + K F PNP+ F+P  FL    D    F K++Y +PFS GKR C GE LARME+F F T+ILQ F+L+S+    +I +T  ++G  S+P  + +  IP
Sbjct:    4 VLVLVFILSSLVFLSLWRQSSERRKLPPGPTPLPIIGNFLQIDVKNISGSLTNFSKVY-----GPVFTLYLGMKPTV-VLHGYETVKEALIDHGEEFAGRGDFPM--AERINKGLGI---VFSNGNRWKEIRRFSLMTLRNLGMGKRNIEDRVQEEAQCLVEELRKTN---GSPCDPTFILSCAPCNVICSIIFQNRFDYKDQDFLTFMKKVNENVRILSSPWL-QVCNNFPSLIDYCPG--SHHKITKNVNYLKKYILEKIEEHQESLDIENPRDFIDYYLIKLKQANHNQ-------QSEFSLENLTTTVSDLFGAGTETTSTTLRYALLLLLKHPHVTAKVQEEIDQVVGR-----HRKPCMQDRSHMPYTDAMIHEVQRFIDLIPISLPHAV-TCDIKFRDYFIPKGTTVITSLSSVLHDNKEF-PNPEVFDPGHFL----DKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFKLKSMIHPKDIDTTPVVNGFASLPPSYQLCFIP 489          
BLAST of EMLSAG00000005163 vs. SwissProt
Match: gi|117216|sp|P24460.1|CP2BB_CANFA (RecName: Full=Cytochrome P450 2B11; AltName: Full=CYPIIB11; AltName: Full=Cytochrome P450 PBD-2)

HSP 1 Score: 247.284 bits (630), Expect = 1.730e-74
Identity = 175/506 (34.58%), Postives = 267/506 (52.77%), Query Frame = 0
Query:   24 YPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFS----IDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLF-NIGILNVLWRIVAGTRFEYRDPELQKIVH--KVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRS--IDGEIPSTDFISGITSIPKPFNIKLIPR 520
            +P+ Y   PP   PL     +L+   K   + F R+ +++  G V  + +  R R  M+   D +++ L  +      A  FS    I   + ++QG GV   +++ G  WK  RRF L+T+++FG G+ S+E+ + EEA   V    EE  +T G ++    F +    N++  IV G RF Y+DPE  ++++   V  A++S+           FL+  +PG    ++V + +  +  F+   V+ H    DP+ PRDFID YL+++       DKE      E    NL  T L LFFAG+ETTS+TL +G L M+++P I +++ +E+D  +        R    +DR  +PYT+A I EIQR G++ P+GVPH   + D     Y++PKG  V   L     +P YF   PD FNPD FL+  ++G +K  KNE  IPFSIGKR C GE +ARME+F FFT+ILQ F + S     +I  T    G+  +P  + I  + R
Sbjct:   23 HPKAYGHLPPGPRPLPILGNFLQMDRKGLLKSFLRLQEKY--GDVFTVYLGPR-RTVMLCGIDAIREALVDN------AEAFSGRGKIAVVEPVFQGYGV---VFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLV----EELRKTEGVLQDPTFFFHSMTANIICSIVFGKRFGYKDPEFLRLMNLFYVSFALISSFSSQMFELFHSFLK-YFPGTH--RQVYNNLQEIKAFIARMVEKHRETLDPSAPRDFIDAYLIRM-------DKEKAEPSSEFHHRNLIDTALSLFFAGTETTSTTLRYGFLLMLKYPHIAERIYKEIDQVI-----GPHRLPSLDDRAKMPYTDAVIHEIQRFGDLLPIGVPHMV-TKDICFRGYIIPKGTEVFPILHSALNDPHYF-EKPDVFNPDHFLD--ANGALK--KNEAFIPFSIGKRICLGEGIARMELFLFFTTILQNFSVASPMAPEDIDLTPQEIGVGKLPPVYQISFLSR 491          
BLAST of EMLSAG00000005163 vs. Select Arthropod Genomes
Match: EFX83960.1 (hypothetical protein DAPPUDRAFT_47261 [Daphnia pulex])

HSP 1 Score: 218.779 bits (556), Expect = 1.653e-64
Identity = 137/449 (30.51%), Postives = 242/449 (53.90%), Query Frame = 0
Query:   79 MXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGN----IRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKV-AAVYEFLQTAVKNH-EANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGE-IPSTDFISGITSIPKPFNIKLIPR 520
            M  +   + +++ L+ +DLN R +   +I  ++   + +G+   ++  G +W++QRRF L  L++ GFG++S+ED +M+E     + ++E +     N    +   ++F++ ++N+LW I+ G RF+  DP+ +K++  +   + S N+      I  FL  ++P +     + +++   + +F++  +  H       +  RD++D YL    D  E   K N S      K  L  ++ DLF AGS T+SS + + VL+M+ +P IQ+K+++ELD       G+S        R  L YTEA + E+ R  ++ P+ VPH     + ++  + +PKG ++   L   F++P  +G +P+ F P+R L    D   K IKN+   PF +GKR C GE LAR  +F F  S+++ FE +S+  E +P+ +  SGI S PKPF   +IPR
Sbjct:   22 MISVVGTEAVREALQNNDLNGRPSG--AILLSRTFGERLGL---IFVDGDVWQEQRRFTLRHLRDLGFGKTSIEDQMMDE---IADLISEISTTAKSNPDHVVDFKSIFSVSVINILWAIIGGKRFQRDDPKFKKLLDNIDQFLGSGNVAQANLPIPAFLVRLFPSLPGRLGIKTQLFVPIQKFIEETIDEHLTTRSKGDVARDYMDVYL----DEMEEQLKTNGS-TSTFSKKQLISSIQDLFAAGSHTSSSGIGFVVLYMIHYPTIQQKIRDELDDIC----GDSLPSLAHRSR--LSYTEAVLMEVTRTASVVPLAVPHRAMK-NTQLQGFTIPKGSILAISLHSAFKDPTAWG-DPENFRPERHL----DQNGKVIKNDAFTPFGLGKRICLGEPLARNTVFLFVASLVKTFEFQSVPNEALPTLEPNSGILSSPKPFKAVVIPR 445          
BLAST of EMLSAG00000005163 vs. Select Arthropod Genomes
Match: EFX83937.1 (hypothetical protein DAPPUDRAFT_194538 [Daphnia pulex])

HSP 1 Score: 219.55 bits (558), Expect = 2.655e-64
Identity = 151/525 (28.76%), Postives = 268/525 (51.05%), Query Frame = 0
Query:    1 MSVALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYT--KKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEAT-LFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKV-AAVYEFLQTAVKNHEANFDP-NHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPST-DFISGITSIPKPFNIKLIP 519
            M++ L++   L++A  L ++  + P N+PP P   +PL G + +L    + F     ++ +++  G V    +   +    +     +K+ L  +DLN R +    I  T  KKL       G L   G  W++QRRF L  L++ GFG++S+ED +M E + L ++            +    +F + + N+LW I+ G R++  DP  ++++  V   +   N+   +  +  FL  ++P +     V  ++   + +F++ ++  H +     +  RDFID YL      E     ENDS      K  L  ++ DLF AGS+T+S T+ + VL+M+ +P IQ+K++EE++       G+S        R  LP+T+A I E+ R  ++ P+G+PH        +G + +PKG +V+  ++ + ++   +G +P+ F P+R L+  +DG  K  +NE   PF IGKR C GE+LAR  +F F  ++ + FE +S+  + P T +   G  S P+PF   ++P
Sbjct:    1 MAIGLILVYVLLIA-FLVKLSLR-PSNFPPGPR-GVPLLGFAPFL-PKNEPFFRAMQKMAEKY--GPVTGFYLGPFLPFISVDGHKAVKEALHNNDLNGRPSGTLVISRTFGKKL-------GLLIVDGDFWQEQRRFTLRHLRDLGFGKTSIEDQMMGEISDLILDITGAAKSDPDHIVDFKAIFTVSVFNILWAIIGGKRYQRDDPAFKQLLANVDLFLRGGNIAQVVIPVPAFLVRLFPSLPSRLGVKDELFVPIQQFIEKSIDEHVSTRSKGDAARDFIDVYL-----DEMEKQLENDS---TFTKKQLIASVQDLFTAGSDTSSGTIGFMVLYMINYPTIQQKIREEIENVC----GDSLPSL--AHRASLPFTDAFITEVMRMSSVAPLGIPHLAMKETQLLG-FTIPKGSIVSVNINSMLQDTVMWG-DPENFRPERHLD--ADG--KLFRNEAFTPFGIGKRICLGESLARNTVFLFTAALAKTFEFKSLPNKPPPTLEPTIGFVSGPQPFKAVVVP 492          
BLAST of EMLSAG00000005163 vs. Select Arthropod Genomes
Match: AHN54491.1 (Cyp303a1, isoform B [Drosophila melanogaster])

HSP 1 Score: 218.779 bits (556), Expect = 5.386e-64
Identity = 159/530 (30.00%), Postives = 265/530 (50.00%), Query Frame = 0
Query:    1 MSVALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLY---LRSAGKNFQEGFDRIFDR--FNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGN---IRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANF-DPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPRD 521
            M   ++   C  L  IL+    K P+ +PP P +  P+ G +L    LR     F +  D +F R   N  G   L++  + ++ +    D + +++  +D++ R    F   Y  + +      G L + G +W +QRRF+L  LKNFGF RS M D++  EAT  +  L ++ +++GG    I + +L ++ +LN LW +++G R+E   PE+ +++    +   + ++   + + FP LR I P             ++Y F+   ++ H   + + + PRD +D+YL          D+ ND  +G     +L    LD+F AGSETT+ +L +  + +V  PEIQ++  +E+     E  G       S DR  LPY EA   E  R   +   G+PH     D ++  Y +PK  +V A   G+  NP  F P+P+ FNPDR+L    DG +K    E   PF  G+  C G+ L R  +F F T++LQ F++ +I G++P    + G T+  KP++I L+ R+
Sbjct:    1 MFYTVIWIFCATLLAILFGGVRK-PKRFPPGPAW-YPIVGSALQVSQLRCRLGMFCKVID-VFARQYVNPYGFYGLKIG-KDKVVIAYTNDAISEMMTNEDIDGRPDGIF---YRLRTFNS--RLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYL-------RAQDEGNDE-KGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIK----EVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVC-DTRLSGYEIPKDTMVIACFRGMLINPVDF-PDPESFNPDRYL---FDGHLKL--PEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGATAAVKPYDIMLVARE 502          
BLAST of EMLSAG00000005163 vs. Select Arthropod Genomes
Match: AAF53514.1 (Cyp303a1, isoform A [Drosophila melanogaster])

HSP 1 Score: 218.779 bits (556), Expect = 5.386e-64
Identity = 159/530 (30.00%), Postives = 265/530 (50.00%), Query Frame = 0
Query:    1 MSVALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLY---LRSAGKNFQEGFDRIFDR--FNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGN---IRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANF-DPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPRD 521
            M   ++   C  L  IL+    K P+ +PP P +  P+ G +L    LR     F +  D +F R   N  G   L++  + ++ +    D + +++  +D++ R    F   Y  + +      G L + G +W +QRRF+L  LKNFGF RS M D++  EAT  +  L ++ +++GG    I + +L ++ +LN LW +++G R+E   PE+ +++    +   + ++   + + FP LR I P             ++Y F+   ++ H   + + + PRD +D+YL          D+ ND  +G     +L    LD+F AGSETT+ +L +  + +V  PEIQ++  +E+     E  G       S DR  LPY EA   E  R   +   G+PH     D ++  Y +PK  +V A   G+  NP  F P+P+ FNPDR+L    DG +K    E   PF  G+  C G+ L R  +F F T++LQ F++ +I G++P    + G T+  KP++I L+ R+
Sbjct:    1 MFYTVIWIFCATLLAILFGGVRK-PKRFPPGPAW-YPIVGSALQVSQLRCRLGMFCKVID-VFARQYVNPYGFYGLKIG-KDKVVIAYTNDAISEMMTNEDIDGRPDGIF---YRLRTFNS--RLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYL-------RAQDEGNDE-KGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIK----EVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVC-DTRLSGYEIPKDTMVIACFRGMLINPVDF-PDPESFNPDRYL---FDGHLKL--PEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGATAAVKPYDIMLVARE 502          
BLAST of EMLSAG00000005163 vs. Select Arthropod Genomes
Match: EFX62802.1 (hypothetical protein DAPPUDRAFT_309471 [Daphnia pulex])

HSP 1 Score: 216.083 bits (549), Expect = 5.286e-63
Identity = 152/521 (29.17%), Postives = 265/521 (50.86%), Query Frame = 0
Query:    6 VITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRF--NVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDF--SIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNI-RIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKV-AAVYEFLQTAVKNHEANFDP-NHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPST-DFISGITSIPKPFNIKLI 518
            +I +C++L   L ++  + P N+PP P   +PL G + +L    KN  E F R+  +     G V    +   +    +     +K+ L  +DLN R +     S  + +KL       G +   G  W++QRRF L  L++ GFG++S+ED +++E +  ++ + E       ++     +F + + N LW I+ G RF+  DP  ++++  V   +   N+   +  +  FL  ++P +     +  ++   + +F++ ++  H A     +  RDFID YL      E     ENDS      K  L  ++ DLF AGS+T+S T+ + VL M+ +P IQ+K++EEL+       G+S        R  LP+T+A I E+ R  ++ P+G+PH        +G + +PKG +V+ +L+ + ++ + +G +P  F P+R L    D   K IK+E  +PF IGKR C GE+LAR  +F F  ++ + FE +S+  + P T +   G  S P+PF   ++
Sbjct:    1 MIFICVLLIVFLVKLSLR-PSNFPPGPR-GVPLLGFAPFLP---KN--EPFFRVIQKMAEKYGPVTGFYLGPFLPFISVDGKKAVKEALHNNDLNGRPSGTLLKSRTFGEKL-------GLVLVDGDFWQEQRRFTLRHLRDLGFGKTSIEDQMVDEISDLISDITEAAKSDPDHVVDFKAIFTVSVFNSLWTIIGGKRFQRDDPAFKQLLANVDLFLRGGNIAQVVIPVPAFLVRLFPSLPSRLGLKDELFVPIQQFIEESIDEHVATRSKGDAARDFIDVYL-----DEMEKQLENDS---TFTKKQLIASIQDLFTAGSDTSSGTIGFAVLSMINYPSIQQKMREELENVC----GDSLPSL--AHRASLPFTDAFITEVMRMSSVAPLGIPHLAMKETQLLG-FTIPKGSIVSVHLNSMLQDTETWG-DPANFRPERHL----DFNGKLIKSEVFVPFGIGKRICLGESLARNTVFLFTAALAKTFEFKSLPNKPPPTLEPTIGFVSGPQPFKAVVV 487          
BLAST of EMLSAG00000005163 vs. Select Arthropod Genomes
Match: EFX84030.1 (hypothetical protein DAPPUDRAFT_47245 [Daphnia pulex])

HSP 1 Score: 211.46 bits (537), Expect = 3.317e-61
Identity = 147/506 (29.05%), Postives = 248/506 (49.01%), Query Frame = 0
Query:   25 PENYPPTPPFRLPLFGHSLYLRSAGKNFQE-GFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKV--------AAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSI-DGEIPSTDFISGITSIPKPFNIKLIPR 520
            P N+PP P   LPL G+  +L      +      ++ D +  G V    +        +  +  +++ L  +DL  R ++  +    +   Q +GV   + + G  W++QRRF L  L++ GFGR+S E ++ EE       +    +   G++ +  LFN+ ++N+LW +V G RF   D  L  ++  V + + S +       +  F    +P +      T K+          + +F++  ++ H  +   +HPRDFID YL ++   +      + SF        L   ++D F AG+ETTS ++ + +L+++ +P+IQ+++Q ELD       G+S  +     R  LPYTEA + E QR  NITP+ V H     D ++G Y +P+G +V   L  +  + + F  +P+ F P+R L   S  G K IK ++L+PFS GKR+C GE LAR   F F  S+L+ FE   + D  +P+    +G+T     F   + PR
Sbjct:   22 PSNFPPGP-RGLPLVGYIPFLSKLDPEYPHLALKKLSDHY--GPVAGFYLGPSQPFISVCGYRAVREALYNEDLAGRPSN--AARRERTFGQRLGV---IHNDGPEWQEQRRFALRHLRDLGFGRTSSEGLIREEIEDLTQEIRAHQL-AHGSVDLKGLFNLSLINILWALVGGERFRRDDTRLAHLLDIVDNFVRSADFTRANIPVPDFCLRYFPSL------TRKLLGLRNDLFTPLQDFIRERIREHAKDRSEDHPRDFIDVYLQEMSKRQST----DSSFHEN----QLIGVIIDFFIAGAETTSGSIGFALLYLLHNPDIQRQIQTELDQVC----GDSLPQL--AHRPSLPYTEAALMEAQRLSNITPLAVAHKALR-DTQLGGYSIPRGSIVTVNLFTVHHDDESFWQDPEIFRPERHL---SPDGRKLIKTDHLLPFSAGKRACLGEPLARNTYFLFTASLLKVFEFHPLPDRPLPTLKPKNGLTLSYDGFEAMVTPR 494          
BLAST of EMLSAG00000005163 vs. Select Arthropod Genomes
Match: EFX83696.1 (hypothetical protein DAPPUDRAFT_301663 [Daphnia pulex])

HSP 1 Score: 210.69 bits (535), Expect = 5.048e-61
Identity = 152/509 (29.86%), Postives = 256/509 (50.29%), Query Frame = 0
Query:   23 KYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFN-VGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEE-ATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKI------VHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHE-ANFDPNHPRDFIDTYLLKIKDSE-ENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGE-IPSTDFISGITSIPKPFNIKLIPR 520
            K P N+PP P   LPL G+  +L S    +     R   + + V G +         M  +   + +K+++  ++LN R  H  SI   +   + +G+   ++  G  W++QRRF +  L++ GFG++S+ED +M E   L  +  N+        + +  +F + ++N+LW I+AG RF   DP+ Q++      V + GD +      P  A I    R +   I    E+T  +    +F+Q+ + +H+ +N   +  RDFID YL ++K  + ENP     +F        L  T+ DLF AG+E+TS ++ + ++ ++R+ E+Q+K+Q ELD    E             R  LPYTEA + E QR   I P  VPH     + K+  Y +PKG +V   L  +  + +Y+   P+ F P+R L   ++ G K IK+++  PF IGKR C G++LA+   F F  +++++F    +  E +P+ D I+G T     F   ++PR
Sbjct:   20 KRPHNFPPGPR-GLPLVGYLPFLSSWDPQYPH---RALQKMSKVYGPVTGFYLGTSTMISVCSHEAVKEVMLNENLNGR-PHS-SITLARNFGENLGI---MFIMGQFWQEQRRFTMRHLRDLGFGKTSIEDQMMGEVGDLIKDIENKSQSDKDRVVDLKGIFQVSVVNILWAIIAGERFRRDDPKFQELLTANEQVFRAGDPVRGN--IPVPAFILKHSRLVREFIGVKSEMTEPIK---KFIQSTIDDHQLSNRSVDEARDFIDFYLNEMKKQKAENP---YTTFTNN----QLVATITDLFGAGAESTSGSIGFAMIHLIRNQEVQRKMQAELDQVCGE------YVPTLNHRSSLPYTEAVLMEAQRCSTIAPFVVPHFAVK-ETKLQGYTIPKGSIVMLNLDAVLMDDEYWK-EPEVFRPERHL---NEDGTKVIKSDHFYPFGIGKRMCLGDSLAKNTYFLFTAALIKKFRFEPVQNEPLPTLDPINGFTVGYSGFKAVVVPR 496          
BLAST of EMLSAG00000005163 vs. Select Arthropod Genomes
Match: gb|KFM72918.1| (Cytochrome P450 18a1, partial [Stegodyphus mimosarum])

HSP 1 Score: 208.764 bits (530), Expect = 2.614e-60
Identity = 151/517 (29.21%), Postives = 260/517 (50.29%), Query Frame = 0
Query:    1 MSVALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKK-LYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPE---LQKIVHKVGDAILSTNLKPTIAAIFPFLRTI--YPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPK 511
            M   ++I + +++  +   I WK     P   P  LPL G+  ++        +   +I+     G V  +Q+ +   + ++ DF  +K+   +D    R A D   + +++ +  G  +D         WK+QRRF L  L++ GFG++ ME+ + +E    +  L          ++IA      + N +  +V G R +  DP+   L K+V++VG   L+  L   I   FP++R    +  + +  +++  ++ +  +    ++ HE   DP + RDF+D YL++IK   ++PD    SFR    K  L+      F AGSET   ++ W +L  V  PE+Q K+Q+E+D  +        R     D + +P+TEA I E+ R   I P+ +  +T   D ++  Y +PK   V A +  +  + K +G +   F P+RFL   S+ G K +K EY IPFSIGKR+CPG++LA +E+F + T+ILQ+F++    G++P  + + GIT  PK
Sbjct:    1 METTILIFISVLIVLVSLFISWKKRGQNPLPGPMGLPLVGYIPFMTKKPYIKLQELAKIY-----GPVYRMQLGSH-NVVVLCDFQSIKEAFASDAFMGRPA-DLPFELSEETIRTGAFLD-------LPWKEQRRFSLHMLRDLGFGKTRMEEHIKDE---ILELLQRIEDCHESPVKIAEFLTPSMSNNIASLVFGKRLKPDDPKRKRLDKLVNEVGR--LAGTLSWQI--FFPWIRAFMSFFNLGNKGKLSRALSELNRYCWEEMEEHEKTLDPTNLRDFMDGYLMEIKKRVDDPDT---SFR----KAVLADLSRAFFGAGSETVRVSVEWALLLCVAFPEVQMKIQQEIDDVIGRE-----RFPTRADNLQMPFTEAVILEMNRWKTIVPLNLMRSTLK-DTELNGYFIPKHSRVLAIIYAVHHDKKLWGNDTGVFRPERFL---SEDGKKVVKPEYYIPFSIGKRACPGKSLAEVEVFLYITAILQKFDVFMPPGKVPDLEGLLGITLQPK 480          
BLAST of EMLSAG00000005163 vs. Select Arthropod Genomes
Match: EFX83941.1 (hypothetical protein DAPPUDRAFT_209641 [Daphnia pulex])

HSP 1 Score: 206.838 bits (525), Expect = 6.993e-60
Identity = 129/407 (31.70%), Postives = 214/407 (52.58%), Query Frame = 0
Query:  121 GXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGN----IRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKV-AAVYEFLQTAVKNH-EANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGE-IPSTDFISGITSIPKPFNIKLIPR 520
            G  +  G +W++QRRF L  L++ GFG++S+ED +M E T   + ++E N     N    +   ++F++ ++N+LW IV G RF+  DP+ +K++  +   + S ++      +   L  ++P +     + +++   + +F++  +  H       +  RD+ID YL    D  E   K N+S      K  L  ++ DLF AG  T+SS++ + VL+M+ +P IQ+K+++ELD       G+S        R+ LPYTEA + E+ R   I P GVPH     + ++  + +PKG ++   L     N      +P+ F P+R L    D   K IKNE LIPF +G+R C GE LAR  +F F  S+++ F  +S+  E +P+ +  + I   PKPF    IPR
Sbjct:   69 GLTFVEGDVWQEQRRFTLRHLRDLGFGKTSIEDQMMGEIT---DLISEINATAKSNRDHVVDFKSIFSVSVINILWAIVGGKRFQRDDPKFKKLLDNIDQFLQSGDVLQANLPVPAILVRLFPSLPGRLGINTQLFVPIQKFIEETIDEHISTRLKGDAARDYIDVYL----DEMERQLKTNES--TTFSKKQLISSIQDLFGAGFHTSSSSIGFAVLYMIHYPTIQQKMRDELDDIC----GDSLPSL--AHRLQLPYTEAVLMEVMRIATIAPAGVPHCAMK-ETQLQGFTIPKGSILAINLDSA-SNDATAWKDPENFRPERHL----DKNGKVIKNENLIPFGLGRRVCLGEPLARNTMFLFVASLVKTFAFKSVPKEPLPTLEPNAAILLSPKPFFATAIPR 454          
BLAST of EMLSAG00000005163 vs. Select Arthropod Genomes
Match: EFX83753.1 (hypothetical protein DAPPUDRAFT_301662 [Daphnia pulex])

HSP 1 Score: 207.608 bits (527), Expect = 1.345e-59
Identity = 158/524 (30.15%), Postives = 262/524 (50.00%), Query Frame = 0
Query:    6 VITVCLILAXILYEIKWKY--PENYPPTPPFRLPLFGHSLYLRS--AGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIG-VDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFP-FLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPN-HPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGE-IPSTDFISGITSIPKPFNIKLIPRD 521
            +IT  LI   +L    W +  P  +PP P   LPL G  L +     G +F  G   ++ R+   G +C        +  IS ++  K+    ++LN R  +  +   +K    G+  VDG   +       Q+RF L  L++ GFGR +ME ++ +E  + +  +  +    G      N FNI ++N LW ++A  RFE  DP L+ +V ++ D +  +     +A   P  L  ++P +         +  V++F++ A+  H+ N  P+  PRDFID YL   K+ E+N D   DSF  E     L   + DLF AG +TT +++ + +L+++ HP++Q+K+QEELD       G S     ++    LPYTEA + E  R  +I P  +PH     D ++    +PKG +V   L  +  +  Y+  +P++F P+R L   S  G   IK++ ++PF  GKR C GE+LAR  ++ F TS+++ F+ ++I  E +P+ D   G   +  PF   +  R+
Sbjct:   25 MITSILIGGCVLCVAVWIFSRPNKFPPGPK-GLPLLGCLLSVSQWHPGCSFM-GLLELYYRY---GPVCGFYIGPQPVISISGYEACKEAFMNENLNGRPDNGPARMKSKGKRMGVMLVDGDFLTI------QKRFTLHHLRDIGFGRQNMESLVSKEVAVLLADMKRQFHDEGNIFEFKNYFNISLVNALWVMLASARFERDDPRLKSLV-ELFDVVFRSGDIVRVAFPCPAILMKLFPAVFAKLGRMDLLKEVWKFIEEAIDEHKQN--PSVEPRDFIDVYL---KEVEKNND---DSFSEE----QLISLIFDLFIAGGDTTGNSIGFVLLYLIHHPDVQRKMQEELDSVC----GSSM-PTLAQQISSLPYTEAVLLEASRLSSIVPFSIPHYALK-DTQLQGNTIPKGSIVQINLYSVHLDENYWN-DPEKFQPERHL---SADGTTVIKSDRILPFGAGKRICLGESLARNTLYLFVTSLVKSFQFQAIPNEPLPTLDPRMGFVQVYAPFKAVIKSRN 514          
BLAST of EMLSAG00000005163 vs. nr
Match: gi|675803055|gb|AIL94135.1| (cytochrome P450 CYP3031A1 [Tigriopus japonicus])

HSP 1 Score: 383.259 bits (983), Expect = 1.153e-124
Identity = 208/520 (40.00%), Postives = 317/520 (60.96%), Query Frame = 0
Query:    7 ITVCLILAXIL---YEIKWKYPENYPPTPPFRLPLFGHSLY-LRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQG-IGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEI-PSTDFISGITSIPKPFNIKLIPR 520
            + V +I   +L   +  K + P++YPP+PP RLP+ GH++Y       +  E  D +++RF+  G++   +    +M +I ++++L +  K ++ NYR A+    D  + L    +   G +     IW QQRRF LSTLK+FGFG++SME ++ EE   F+ +L+E++    G I +AN+FNI +LN+LW+IVAG RF+Y D  L ++V  + +AILS  +KP++A IFPFLRTIYP ID        +  V  FL   V   ++ FD ++ RD ID+YLL+   +E     E  SF    G   L +TL+DLFFAGSETTSSTL+WG+L+++R+P++Q K+Q+ELD  +  G     R     DR  LP+ +A I EIQR G++ P G+ HA      K+G YV+P GH++    S I ++PKY+  +  +F P+R L    DG  + + ++ LIPFS+GKR CPGE+LA+ ++F F  S+LQRF  +    +  PST  + G+T +P PF +++I R
Sbjct:    1 MIVLIIFGSVLVLYWYYKTRLPDDYPPSPPIRLPIIGHAVYSFFGTSASGAEAIDELYERFSKDGIMAFHMGP-FKMVIIGNYELLHQCYKLEETNYRHANKAIEDLARFLRNSDMSNAGIIEGSDKIWTQQRRFALSTLKDFGFGKASMEILINEEVVQFMEYLDEQS--QSGPIAVANMFNIAVLNILWQIVAGQRFDYHDKALNELVTMMNEAILSAGIKPSLALIFPFLRTIYPDIDPVVMNKQIMLKVKNFLADLV---QSTFDQSNIRDLIDSYLLETLKTE----NEESSFHETNGTEILLQTLIDLFFAGSETTSSTLTWGILYLIRNPDVQFKLQQELDDVVGIG-----RMPSLLDRPKLPFLDATILEIQRLGDVVPNGLVHANPHSPVKIGKYVIPPGHMIQGDFSEIMQDPKYWK-DAQEFKPERHL----DGQKRVVVDKRLIPFSVGKRRCPGESLAKAQLFLFLASLLQRFHFQPERADFYPSTRSVVGVTRVPLPFKVRIIKR 500          
BLAST of EMLSAG00000005163 vs. nr
Match: gi|820982928|gb|AKH03502.1| (cytochrome P450 3036B1 [Paracyclopina nana])

HSP 1 Score: 291.582 bits (745), Expect = 4.061e-89
Identity = 178/523 (34.03%), Postives = 284/523 (54.30%), Query Frame = 0
Query:    4 ALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYR-LAHDFSIDYTKKLYQGIGVD--GXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPN------HPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGI--TSIPKPFNI 515
            A V+  C ++    ++   + P    P  P  LPL G+        KN   G D+  D++  G V+ + +    RM +I D+ +LK++ K +   +R +  ++   Y +    G G D  G L+S G  W +QRRF L  L++FG G+SSME+++ EE       L++   Q    +++   +N+ ++N LW ++ G+R    DP+L ++V K+ D ++  +    +  +FP+ R I P +    +    +  +  F+   +K H+ NF+ N      +P DFID +L KI++S      E+ SF G+LG  NL   LLDL FAG ETTS+ L W  L+M+++P+IQ+KVQ E  +F + G     R    +D+ +LP+TEA I E+ R   I P+G+PH   + D KVG+  +P+G  +   L  I RNP  F P P+ F P+RFL    D   K+ K E  IPFSIGKR C G++LA  E+F FF S++QR+  +S+  ++   D    +  T  P+PF++
Sbjct:    3 AFVVVFCALVLIYWWKNFARIPGPNFPNGPLGLPLIGYVPVFTE--KNILVGLDKAHDQY--GEVMSVNLGPSPRMVIIGDYQVLKEVFKEESSTFRPVEMNWGNAYFRS---GNGYDSRGLLFSQGQEWTEQRRFALRRLRDFGMGKSSMEELIQEEIRQLCQKLDK---QLNQPLKVDLTYNLSVVNALWTVITGSRLSLDDPKLIELVVKI-DELMEMSGNVNLVQMFPWTRHIIPELSGWNKSKEIMYGLINFVAKDIKEHQDNFEANKEMLQENPNDFIDAFLAKIQES-----PESSSFHGQLGINNLKAGLLDLLFAGIETTSTALCWSTLYMIKYPDIQRKVQNE--IFKYVGKS---RPVNLDDKPNLPFTEAVIQEVLRITCIGPLGIPHCAQT-DIKVGNLWIPQGTSIMPNLHRITRNPAAF-PEPNNFKPERFL----DSQGKYCKIESNIPFSIGKRDCLGKSLALAELFLFFASLMQRYSFKSVHDDLSRVDLEPKVNFTQAPQPFDV 498          
BLAST of EMLSAG00000005163 vs. nr
Match: gi|820982950|gb|AKH03513.1| (cytochrome P450 3075B2 [Paracyclopina nana])

HSP 1 Score: 289.271 bits (739), Expect = 3.866e-88
Identity = 182/496 (36.69%), Postives = 267/496 (53.83%), Query Frame = 0
Query:   25 PENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHD-------FSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIF------PFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGE-IPSTDFISGI 506
            P+ +PP PP RLPL G   +  +  KN ++           G +  L +  R  M ++SDFD++K + K  + + R  +         S D +++        G L S G  W++QRRF +  LK+ GFG+SSMEDM+ EE       L ++    G  + +    N+ I+N LW ++ G  F   DPELQ IV K  D++L   +K T  +I          +   PG    +++ + +    + +  A+ +H+  +DP+HPRDF+D YL +I  S   PD    SF G  G+ +L  T+LDLF AG+ETTSS+L W +LF++ HPE+Q +VQ E+D  +  G+  S      EDR  LPYT A + E  R   I P  +PHA  + D ++  YV+PK  V+ A L  +  +P Y+ PNPD+FNP+RF + A+     F +NE LIPFSIGKR C G++LA  E F FFT +LQRF      G  +P     SG+
Sbjct:   26 PDKFPPGPP-RLPLIGSLPFFPAQVKNGKQKMSTWMQE-TFGPISGLYLGKR-PMVILSDFDLIKDLYKKHEASGRPKNKPFHENRFGSPDGSQR--------GLLQSSGQEWQEQRRFTMKQLKDLGFGKSSMEDMINEEVAKLAQLLEKD---VGKEMSMNLKLNLSIVNALWYLLTGEHFALEDPELQAIVAKF-DSLLRLEIKNTPFSILMEGWMPKLAKFTSPGFKHMKDLFTDIK---DLVGKALVDHKKTYDPDHPRDFMDMYLAEIDKSSNAPD---SSFHGTRGEESLVSTMLDLFLAGTETTSSSLLWSILFLLHHPEVQARVQREIDEVVGVGNQVSL-----EDRALLPYTNAVLMESMRMATIVPSALPHAA-TEDIQLNGYVIPKDSVILANLLHVHYDPTYW-PNPDEFNPNRFYDEATR---TFKQNERLIPFSIGKRYCLGQSLAEKEYFLFFTGLLQRFTFEPAPGSPLPKIGRDSGV 490          
BLAST of EMLSAG00000005163 vs. nr
Match: gi|1061482263|gb|ODM99561.1| (Methyl farnesoate epoxidase [Orchesella cincta])

HSP 1 Score: 288.5 bits (737), Expect = 6.802e-88
Identity = 180/522 (34.48%), Postives = 293/522 (56.13%), Query Frame = 0
Query:    3 VALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGN-IRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKN--EYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGE-IPSTDFISGITSIPKPFNIKLIPR 520
            ++ ++ + +    I Y +K K P N+PP P    P+ G SL+L   GKN  + F ++ D +   G L       +   +I+ ++  K++   DD N+R +  FS+ Y      G    G  +S G +W++ RRF L  L++FGFG++SME ++ EEA   +  +N+E  +T  + I I + F + ++N+LW I+ GTR+ + D E +K+++ + ++  S +    +   +PFLR       + Q + S   A+ E L+ +++ H+ N DP+ PRD ID YL  I+DS+++PD     F+ +L +L       DLF AG+E+TS+++++ +L MVR+P+ Q+KVQ+ELD  + +    SF     ED+ +LPYT A I E  R   + P+ VPH     D K+  Y VPKG  V      I  + KY+G +P+ F P+RFL+ + +    FIK   +++  F  GKR C GE LARM  +    ++LQRF+   + G+  P+TD I G T  P+PF+ K+ PR
Sbjct:    2 ISALVLIIVTAFLIYYILKPKLPPNFPPGPA-NFPIVGGSLFLSKIGKNTHDAFHKLGDLY---GPLTGLYLGNLPAIVINGYEQAKELFARDDFNHRPS-IFSVSYP----WGGRALGVFFSNGRLWQENRRFALRHLRDFGFGKTSMEGLIHEEAEECIETMNKELKKTKDSVITIHDKFGVSVINILWAIMGGTRYRHDDEEFKKMLNVIQESFRSGSPSGNLVNAYPFLRHFPYFKQNFQALVSGAEAIIEMLEKSIEEHKKNRDPSAPRDLIDVYLQAIEDSKDDPD--TVFFKDQLVQL-----CEDLFAAGAESTSNSIAFCILHMVRNPDCQEKVQKELDAVVGKNRFPSF-----EDKANLPYTFAVISEAFRISPVAPISVPHMNIE-DTKLLGYNVPKGTSVMVNFPSINLDKKYWG-DPEVFRPERFLDESGN----FIKAKLDHVHGFGAGKRQCLGEPLARMSNYLLVAAVLQRFKFEIVPGQPKPTTDPIDGFTIAPQPFSAKVTPR 496          
BLAST of EMLSAG00000005163 vs. nr
Match: gi|998708400|ref|XP_015491936.1| (PREDICTED: cytochrome P450 2J2-like [Parus major] >gi|998708402|ref|XP_015491937.1| PREDICTED: cytochrome P450 2J2-like [Parus major] >gi|1099205589|ref|XP_018863234.1| PREDICTED: cytochrome P450 2J2-like [Parus major])

HSP 1 Score: 286.574 bits (732), Expect = 3.034e-87
Identity = 183/503 (36.38%), Postives = 281/503 (55.86%), Query Frame = 0
Query:   20 IKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVN-FLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGD-AILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            +K + P+++PPTP FRLP  GH +YL    K+      R+  ++  G +  +Q+ + ++  M++   ++K++L      +    D  ID  ++++  IG+   + S G +WK QRRF L+TL+NFG G+ S+E+ + EE    V+ F +E+       ++I N    GI NV+  ++ G RFEY D + Q+++  + D A L   +   +   FP +    PG    Q +      + EF+Q  +  H+  ++P+  RD+ID+YLL+I     + D ++D+FR E    +L    LDL FAG+ETTSSTL W +LFM  HPEIQ +VQ E+D  + +      R    EDR +L YT A I E+QR+GN+ P  VP    S D  +  Y +PKG ++   L+ +  +   +   PD FNP+ FL+   DG  KF KNEY +PFS GKRSC GE LAR E+F FFTS+LQ+F  ++      S   + GI   P+P+ I  +PR
Sbjct:   28 MKNRNPKDFPPTP-FRLPFLGH-IYLIDF-KDPLVAVQRLSKKY--GDIFGMQMGS-MKFVMVNGMRLVKEVLVNQGDKFMERPDIPID--EEVFNKIGL---ISSSGHLWKAQRRFTLTTLRNFGLGKRSLEERIQEECQYLVDAFRDEQGNPFNPQLKITN----GISNVICSLIFGNRFEYHDEDFQRLLKLMNDMAALHGAITSQLYNNFPSIMKYLPGAH--QTIFKNWRLLKEFMQKQIDKHKEEWNPSESRDYIDSYLLEI-----SKDHDSDTFREE----HLMSCALDLMFAGTETTSSTLRWALLFMATHPEIQAQVQAEIDAVIGQA-----RPPALEDRNNLHYTNAVIHEVQRKGNVVPFNVPRMA-SKDTYLDGYYIPKGTILMTNLTSLMFDKNEWK-TPDTFNPEHFLK---DG--KFWKNEYFLPFSTGKRSCLGELLARAELFLFFTSLLQKFTFQAPPDTTLSLQPMIGIAMSPQPYKICAVPR 492          
BLAST of EMLSAG00000005163 vs. nr
Match: gi|73956380|ref|XP_852725.1| (PREDICTED: cytochrome P450 2J2 [Canis lupus familiaris])

HSP 1 Score: 284.263 bits (726), Expect = 2.853e-86
Identity = 182/508 (35.83%), Postives = 283/508 (55.71%), Query Frame = 0
Query:   20 IKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRF--NVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQT-GGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGD-AILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGD--GESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPRD 521
            +K + P+NYPP P   LP  G+  +L     +F++   ++  RF    G V  +Q+   + + +++   ++K++L   D N    +       +++++     G + S G IWK+QRRF L+TLKNFG GR S+E+ + EEA   +  + EEN Q    + +I N     + N++  I  G RFEY+D + Q+++  + +   L T+++  +  +FP++    PG    Q++ +    +  F+    +NH  +++P  PRDFID YL   K+ E+N      SF  E    NL  + LDLFFAG+ETTS+TL WG+L++  +PEIQ+KVQ E+D  + +    G + R++       +PYT A I E+QR GNI P+ VP    +GD  +  Y +PKG V+   L+ + R+P  +   PD FNP+ FLE       +F K E  +PFSIGKR C GE LAR E+F FFTS++QRF  R  D E  S +F +G+T  P    ++ IPR 
Sbjct:   35 LKRRRPKNYPPGP-VPLPFVGNFFHL-----DFEQSHLKL-QRFVKKYGNVFSVQMGD-MPLVVVTGLPLIKEVLV--DQNQVFVNRPITPIRERVFKN---SGLIMSSGQIWKEQRRFTLATLKNFGLGRKSIEERIQEEAHHLIQAIEEENGQPFNPHFKINN----AVSNIICSITFGKRFEYQDEQFQELLRLLDEVTCLETSMRCQLYNVFPWIIKFLPG--PHQKLFNDWEKLKLFIAHMTENHRRDWNPAEPRDFIDAYL---KEMEKNRGNATSSFHEE----NLIYSTLDLFFAGTETTSTTLRWGLLYLALNPEIQEKVQAEIDRVIGQSQLPGLAVRES-------MPYTNAFIHEVQRMGNIVPLNVPREV-TGDTTLAGYYLPKGTVIVTNLTALHRDPAEWA-TPDTFNPEHFLENG-----QFKKREAFLPFSIGKRVCIGEQLARSELFIFFTSLVQRFTFRPPDNEKLSLEFRTGLTISPVSHRLRAIPRS 502          
BLAST of EMLSAG00000005163 vs. nr
Match: gi|543353161|ref|XP_005521267.1| (PREDICTED: cytochrome P450 2J2-like [Pseudopodoces humilis] >gi|929430058|ref|XP_014106266.1| PREDICTED: cytochrome P450 2J2-like [Pseudopodoces humilis])

HSP 1 Score: 283.493 bits (724), Expect = 4.241e-86
Identity = 182/503 (36.18%), Postives = 279/503 (55.47%), Query Frame = 0
Query:   20 IKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVN-FLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGD-AILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            +K + P+++PPTP FRLP  GH +YL    K+      R+  R+  G +  +Q+ + ++  M++   ++K++L      +    D  ID  ++++  +G+   + S G +WK QRRF L+TL+NFG G+ S+E+ + EE    V+ F +E+        +I N    GI NV+  ++ G RFEY D + Q+++  + D  +L   +   +   FP +    PG      +      + EF+Q  +  H+  ++P+  RD+ID+YLL+I     + D ++D+FR E    +L    LDL FAG+ETTSSTL W +LFM  HPEIQ +VQ E+D  + +      R    EDR +L YT A I E+QR+GN+ P  VP    S D  +  Y +PKG V+   L+ +  +   +   PD FNP+ FL+   DG  KF KNEY +PFS GKRSC GE LAR E+F FFTS+LQ+F  ++      S   + GI   P+P+ I  +PR
Sbjct:   28 MKNRNPKDFPPTP-FRLPFLGH-IYLIDF-KDPLVAVQRLSKRY--GDIFGMQMGS-MKFVMVNGMRLVKEVLVNQGDKFMERPDIPID--EEVFSKMGL---ISSSGHLWKAQRRFTLTTLRNFGLGKRSLEERIQEECRYLVDVFRDEQGNPFNPQFKITN----GISNVICSLIFGNRFEYHDEDFQRLLKLMNDMVVLHGAITSQLYNNFPSIMKYLPGAH--HTIFKNWRLLKEFMQKQIDKHKEEWNPSESRDYIDSYLLEI-----SKDHDSDTFREE----HLVSCALDLMFAGTETTSSTLRWALLFMATHPEIQAQVQAEIDAVIGQA-----RLPALEDRNNLHYTNAVIHEVQRKGNVVPFNVPRMA-SKDTYLDGYYIPKGTVLMTNLTSLLFDKNEWK-TPDTFNPEHFLK---DG--KFWKNEYFLPFSTGKRSCLGELLARAELFLFFTSLLQKFTFQAPPDTTLSLQPMIGIAMSPQPYKICAVPR 492          
BLAST of EMLSAG00000005163 vs. nr
Match: gi|683908523|ref|XP_009087020.1| (PREDICTED: cytochrome P450 2J2 [Serinus canaria])

HSP 1 Score: 283.493 bits (724), Expect = 4.978e-86
Identity = 178/505 (35.25%), Postives = 279/505 (55.25%), Query Frame = 0
Query:   20 IKWKYPENYPPTPPFRLPLFGH--SLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVN-FLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGD-AILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            +K + P+N+PPTP FRLP  GH   LY +      Q    R+  R+  G +  +Q+ + ++  ++S   ++K++L      +    D  ID  ++++  IG+   + S G +WK QRRF L+TL+NFG G+ S+E+ + EE    V+ F +E+       +++ N     + NV+  ++ G RFEY D + Q+++  + +  +L   +   +   FP +    PG    Q +      + +F++  +  H+ +++P+  RD+ID+YLL+I       D ++D+F+ E     L    LDL FAG+ETTSSTL W +LFM  HPEIQ +VQ E+D  + +      R    EDR +L YT A I E+QR+GN+ P  VP    S D  V  Y +PKG ++   L+ +  +   +   PD FNP+ FL+   DG  KF KNEY +PFS GKR+C GE LAR E+F FFTS+LQ+F  ++  G   S   + GI   P+P+ I  +PR
Sbjct:   28 MKNRNPKNFPPTP-FRLPFVGHIYLLYFKDPAVAVQ----RLIKRY--GNIFSIQMGS-MKFVIVSGMQLVKEVLVNQGDKFLDRPDIPID--EEIFSKIGL---ISSNGHLWKAQRRFTLTTLRNFGLGKRSLEERIQEECRNLVDVFRDEQGNPFNPQLKVTN----AVANVICSLIFGNRFEYHDEDFQRLLKLMNEITVLHGAVTSQLYNNFPSIMKYLPGAH--QTIFKYWKLLKKFMREQINKHKEDWNPSESRDYIDSYLLEISK-----DHDSDTFQEEY----LMACSLDLMFAGTETTSSTLRWALLFMAAHPEIQAQVQAEIDAVIGQA-----RPPALEDRNNLHYTNAVIHEVQRKGNVIPFNVPRMA-SEDTYVDGYYIPKGTIIMTNLTSLLFDKNEWK-TPDTFNPEHFLK---DG--KFWKNEYFLPFSTGKRACLGELLARSELFLFFTSLLQKFTFQAPPGTTLSLQPMMGIAMAPQPYKICAVPR 492          
BLAST of EMLSAG00000005163 vs. nr
Match: gi|1101635226|ref|XP_018981179.1| (PREDICTED: cytochrome P450 2J2-like isoform X2 [Cyprinus carpio])

HSP 1 Score: 283.108 bits (723), Expect = 6.810e-86
Identity = 184/521 (35.32%), Postives = 283/521 (54.32%), Query Frame = 0
Query:    4 ALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKIL--KTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEE-NIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAI-LSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            +++I  C+ L    Y  + K P+N+PP P + LP+ G   ++ ++  + Q  F    +++  G +  L++    R+ ++  + ++K++   + D+L  R             Y  IG  G + + G  WKQQRRF LSTL+NFG G+ S+E  +  E      FLNE  + + G       L N  + NV+  +V G RFEY D + Q ++  + +A+ L       +  +FP+L  + PG    ++V      V +F++  V  H  ++DP++PRD+ID +L +++  E   D     F  E    NL    LDLF AG+ETTS+TL WG+L+M+++PEIQ KVQEE+D  +      S       DR ++PYT A I EIQR GNI P+ +  AT   D ++G Y +PKG +V  YL+ +  +   +   P  FNP  FL+V      KF + +  +PFS+GKR CPGE LARME+F FF+S+LQRF   S  G  PS +F  G T  P+P+ +  +PR
Sbjct:   14 SILIFSCVFLLLSDY-FRNKAPKNFPPGP-WSLPIIGDIHHIDNSRIHLQ--FSEFAEKY--GKIFSLRILGP-RIVVLDGYKLVKEVYLQQGDNLADR-------PLLPLFYDIIGDKGLIAASGYKWKQQRRFALSTLRNFGLGKKSLEPSISLECC----FLNEAISNEQGRPFDPHLLLNNAVSNVICVLVFGNRFEYSDNDFQNLLKNISEAVYLEGGFCAQLYNMFPWLLRLVPG--PHKKVIILWQKVIDFVREKVNAHRVDYDPSNPRDYIDCFLAEMEKLE---DDTASGFDVE----NLCICTLDLFVAGTETTSTTLYWGLLYMIKYPEIQAKVQEEIDCVVGGSQQPSL-----SDRDNMPYTNAVIHEIQRIGNIVPLNLARATVE-DTQIGKYSIPKGTIVTGYLTSVLFDESEW-ETPYSFNPGHFLDVEG----KFRRRDAFLPFSLGKRVCPGEQLARMELFLFFSSLLQRFTFSSPAGVEPSLNFKLGATHCPQPYALCAVPR 496          
BLAST of EMLSAG00000005163 vs. nr
Match: gi|1101635224|ref|XP_018981178.1| (PREDICTED: cytochrome P450 2J2-like isoform X1 [Cyprinus carpio])

HSP 1 Score: 281.952 bits (720), Expect = 9.815e-86
Identity = 180/502 (35.86%), Postives = 274/502 (54.58%), Query Frame = 0
Query:   23 KYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKIL--KTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEE-NIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAI-LSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPR 520
            K P+N+PP P + LP+ G   ++ ++  + Q  F    +++  G +  L++    R+ ++  + ++K++   + D+L  R             Y  IG  G + + G  WKQQRRF LSTL+NFG G+ S+E  +  E      FLNE  + + G       L N  + NV+  +V G RFEY D + Q ++  + +A+ L       +  +FP+L  + PG    ++V      V +F++  V  H  ++DP++PRD+ID +L +++  E   D     F  E    NL    LDLF AG+ETTS+TL WG+L+M+++PEIQ KVQEE+D  +      S       DR ++PYT A I EIQR GNI P+ +  AT   D ++G Y +PKG +V  YL+ +  +   +   P  FNP  FL+V      KF + +  +PFS+GKR CPGE LARME+F FF+S+LQRF   S  G  PS +F  G T  P+P+ +  +PR
Sbjct:   11 KAPKNFPPGP-WSLPIIGDIHHIDNSRIHLQ--FSEFAEKY--GKIFSLRILGP-RIVVLDGYKLVKEVYLQQGDNLADR-------PLLPLFYDIIGDKGLIAASGYKWKQQRRFALSTLRNFGLGKKSLEPSISLECC----FLNEAISNEQGRPFDPHLLLNNAVSNVICVLVFGNRFEYSDNDFQNLLKNISEAVYLEGGFCAQLYNMFPWLLRLVPG--PHKKVIILWQKVIDFVREKVNAHRVDYDPSNPRDYIDCFLAEMEKLE---DDTASGFDVE----NLCICTLDLFVAGTETTSTTLYWGLLYMIKYPEIQAKVQEEIDCVVGGSQQPSL-----SDRDNMPYTNAVIHEIQRIGNIVPLNLARATVE-DTQIGKYSIPKGTIVTGYLTSVLFDESEW-ETPYSFNPGHFLDVEG----KFRRRDAFLPFSLGKRVCPGEQLARMELFLFFSSLLQRFTFSSPAGVEPSLNFKLGATHCPQPYALCAVPR 475          
BLAST of EMLSAG00000005163 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold133_size323035-processed-gene-1.7 (protein:Tk02241 transcript:snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1 annotation:"cytochrome p450 partial")

HSP 1 Score: 335.495 bits (859), Expect = 1.374e-107
Identity = 208/520 (40.00%), Postives = 307/520 (59.04%), Query Frame = 0
Query:    3 VALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGI-GVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSID-GEIPSTDFISGITSIPKPFNIKLIPR 520
            +ALV+ V LILA   + +K + P NYPPTPP RLPLFGHS YL     +  E  D +F +++  GV+   + +  ++ +I  FD+LK+  K +D N+R A+  ++     L +   G +G +   G IW +QRRFMLST K+FGFG+S ME M+ +E   F++++ + N    G I+  N+FN  +LN+LW+++AG RF+Y D +L+ I   V +AIL+  +KP+IA IFP+LR I+P ID   +    +  V +FL + V+ H   FDP H RDFID YLL+++ + +     + SF    G   + +TL+DLFFAG         + VL+++ +PE+Q K+ EE+   +        R     DR  LPY +A I EIQR G+  P G+ HA      ++G Y VP+GH      S I ++P+Y+ P P++F P+R +   +D G K + ++ +IPFSIGKR CPGE LA+  IF     +LQRFE+  ID    P  + I GIT IPKPF+  L  R
Sbjct:   38 IALVVVV-LILA---WYVKNRLPANYPPTPPTRLPLFGHSHYLLFTRNSGIEAIDELFHKYSKDGVMAFHLGS-FKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSN--QSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAILAAGIKPSIAFIFPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTD----VDSSFSKTNGDEMILQTLIDLFFAGQPAQ----PFHVLYLIINPEVQTKIHEEIKTVIGLE-----RTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYW-PKPEEFKPERHI---NDEG-KVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNPPPNEGICGITRIPKPFSFNLKRR 532          
BLAST of EMLSAG00000005163 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1406_size42870-snap-gene-0.12 (protein:Tk07895 transcript:maker-scaffold1406_size42870-snap-gene-0.12-mRNA-1 annotation:"cytochrome p450 monooxygenase")

HSP 1 Score: 258.455 bits (659), Expect = 2.500e-80
Identity = 168/501 (33.53%), Postives = 256/501 (51.10%), Query Frame = 0
Query:   21 KWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYR---LAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPN--HPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFE-LRSIDGEIPSTDFISGITSIPKPFNI 515
            K+  P N+PP PP  LP+ G   +  +    F  G+      +   G +   +   I + ++ DF+++K +   D++  R     H + + + K+        G +++ G  WK  R+F L TLK+ G G+  ME  L  EA    + +       G  + + ++FN+G+LN+LW++V   R++  DP L   V  +       N +     + P LR I P             ++  F  + +++ + + + N   P DF+  YL   K+ +E+P  EN  F  E     L+ T+ DLF AGS+T+++TL+W +L+MV HP+ QKKVQ+ELD  L        R+   EDR  L YTEA + EIQR+ NI P  VPH     D  +  Y +PK  VV   L  +  +P+Y+  NP  FNP+RF+E     GV F K+E LIPF IGKRSC GE+LAR E+   F  +LQRF  ++S D   P   F+ G     KPF++
Sbjct:   24 KYARPRNFPPGPP-SLPIVGSFPFYPNVPSPFSIGWKYFVHNY---GKIVGVMMGHIPVVVVYDFELIKDVFNRDEIAGRPQLFTHSYRMKWKKQ--------GIIFNDGPSWKSHRKFTLRTLKDLGLGKQKMEHTLQFEANQICDKIAS---WQGRPLDVKHVFNVGVLNILWKLVGNVRYDLDDPSLLACVRSIDGGTQGDNTRQI--ELLPILRHIPPFTKKWDSFKGFADSLLNFATSMIEDCKRDLEENIDQPEDFVTAYL---KEQQESP--ENKDFNDEA----LAVTITDLFAAGSDTSANTLTWAILYMVLHPKCQKKVQDELDEIL------VGREPAIEDRSRLVYTEATLAEIQRKANIVPGAVPHKALR-DTVIDGYSIPKDTVVCCPLYYVMSDPEYWQ-NPQVFNPERFIE----NGV-FRKDERLIPFGIGKRSCLGESLARNELLIIFARMLQRFHFVKSPDHPDPEDKFVPGFLIAAKPFHV 485          
BLAST of EMLSAG00000005163 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold604_size126151-snap-gene-0.26 (protein:Tk08218 transcript:maker-scaffold604_size126151-snap-gene-0.26-mRNA-1 annotation:"cytochrome p450 2c19-like isoform x2")

HSP 1 Score: 228.409 bits (581), Expect = 1.102e-67
Identity = 173/531 (32.58%), Postives = 268/531 (50.47%), Query Frame = 0
Query:    6 VITVCLILAXILYEIKWKYPENY-----PPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFN--VGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGI-----GVDGXLWSYGXIWKQQRRFMLSTLKNFGFGR-SSMEDMLMEEATLFVNFLNEENIQTG-GNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSI--DGEIPSTDFISGITSIPKPFNIKLIPR 520
             + + LIL   ++++   +P +Y     PP   +  PL GH LYL      F+     +F + +   GG+  +         +I D D + + +K D +  R   +     ++ L +G       + G  +S G IW++QR+F    L N GFG+ SS+E+++  E+   +  L  ++       +   N F    LNV+W  V+G      D  L  +  K      S     T+    P L  +   +     +TS+   V E +   + +H+ +FDP H RDFID YLLKI++++ NP+    SF  E G++N+  ++ DLF AG +TT++TLSW +++M+R P+IQ KVQEE+D  +  GD     K R+      PY EA + EIQR   I P  +P AT   D  +G Y +PK   V   +  +  NP  F P P QF P+RFL   S  G KF K + ++ F +GKR CPGEN+ARME++ FF SI+Q F + S+    EIP    + G+   P+P   ++  R
Sbjct:  108 AVLMVLILCLQIFKMFRGFPSSYKGNKLPPGLRWSFPLIGH-LYL------FKGDPIGVFMKLSQTFGGMFLINFGPST-AAIILDPDFIDQAIKEDAIPSRPLKEME---SQALIRGKRNPDGSLPGIAFSDGVIWREQRKFAFQQLVNLGFGQNSSIEEVIRSESEDMIRMLKVKSEDGAISYVFTPNDFIRHALNVVWHFVSGNESPISDELL--LAAKDFMKSQSPGFLSTLQLYSPTLLRLTAALGQRNMLTSR-RKVDEMINQQIADHKESFDPLHVRDFIDAYLLKIRETK-NPE---SSFYQESGEVNMRNSMFDLFIAGLDTTATTLSWAMVYMMRWPQIQTKVQEEIDRVI--GDVVPSLKHRA----LTPYVEATLLEIQRMACIVPW-LPRATVE-DVVIGPYAIPKNTHVLCIIKNVTHNPSIF-PQPQQFKPERFL---SADGTKFEKGDRVVTFGMGKRKCPGENMARMELYMFFVSIMQNFTIESVCDPEEIPLRGNL-GLVDEPQPCEARIRTR 607          
BLAST of EMLSAG00000005163 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold1422_size42147-processed-gene-0.1 (protein:Tk11335 transcript:snap_masked-scaffold1422_size42147-processed-gene-0.1-mRNA-1 annotation:"cytochrome p450 2aa2")

HSP 1 Score: 221.861 bits (564), Expect = 1.055e-66
Identity = 156/476 (32.77%), Postives = 237/476 (49.79%), Query Frame = 0
Query:   60 FDRFNVGGVLCLQVA----------ARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIG--VDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPN-HPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPST--DFISGITSIPKPFNIKLIPR 520
             D+  VG +L  Q+            R+R  +I+DF   K +   D  + R      + +  K  +G    + G + + G  W++QRRF L  L++FGFGR S++ ++ EEA L +  L EE+  T G+I I   FN  ++NVLW++VA TRF   DP  QK    +           T ++ FPFL    P     Q++    A +    +  V  HE + DP+  PRDF+D Y+ +I  S+ +P+  N        +  L     D F AGSET+S+TL+W VL+M  +PE+Q +   E+       D         +D   L YT A + E+QR     P  + H T S D  +  +V+PK  ++ A       + +   PNP+ F PDRF  + ++G  K +K E  +PF IG R C GE+LA+ EIF FF  +LQ  ++ S     P    +  +GIT+IP PF++ + PR
Sbjct:   12 MDKTGVGALLDEQLRKYGKIARVDLGRLRFFVINDFGTAKDLFNRDITSNR-----PVSWLHKYLKGFNGKICGIIHASGATWREQRRFALKNLRDFGFGRKSLDHVIHEEAQLLIKSLLEEH-WTHGDILIGTTFNAPVVNVLWQVVASTRF---DPNAQKTKDMMEKLTERFKAGLTWSSAFPFLNRYLPLSKFNQDLLDFKAMI----RKEVIAHEQDHDPDLPPRDFMDVYISEIS-SQTHPESSN------FHREQLVTICTDFFQAGSETSSTTLAWCVLYMALNPEVQSRCSSEIQ------DTIGATNPTLDDINRLVYTRATVMEVQRISVTAPGSLLHIT-SEDIHMEGFVIPKKSIMIANQKSFLMD-ECVWPNPEAFMPDRF--IGANG--KIVKPEQFVPFGIGPRICMGESLAKSEIFIFFVMLLQHLQISSSKTYGPPNPKNLTTGITTIPDPFHVHIEPR 455          
BLAST of EMLSAG00000005163 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold243_size241480-processed-gene-0.6 (protein:Tk02952 transcript:snap_masked-scaffold243_size241480-processed-gene-0.6-mRNA-1 annotation:"cytochrome p450 cyp15a1-like partial")

HSP 1 Score: 225.328 bits (573), Expect = 1.777e-65
Identity = 156/495 (31.52%), Postives = 245/495 (49.49%), Query Frame = 0
Query:    5 LVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEG----FDRIFDRF-NVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFL-RTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNH-PRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRS 492
            L I    IL  IL  I  +  ++ PP P   +P+ G   ++    K F+ G      ++F+      G +       +   +ISD D++K+  K D++  R       ++      G G  G + S G  W++QRRF +  LK+FGFGRSSMEDM+  E    VN L   +++TG  + +    NI I+N LW I+ G R E  D  L  IV  +   +    +   ++ +FP L +  +P         +   ++   +  A+++H   F+P+  P DFI+ YL +I+ + +       SF  + G  +L   L+DLF  GSETTS TL W  L ++ HP++Q ++ +ELD  +             +D   LPY  A + E  R  ++ P GVPH   +   KVG Y++PKG  V A +     NPK +  +P++FNP RFL+   DG  +   +    PFS+GKR C G+ LA  E + F   ILQ+F++ +
Sbjct:  251 LTIFATSILVVILLYIFGEQEKDVPPGPS-SVPILGSIPFV---PKRFRHGGRLHIPKLFNYLAQTYGPISRVYLGPLPTIVISDLDLVKEAFKKDEITSRPPMRPFHEFRYGTEDG-GQRGVILSSGKEWQEQRRFSMRQLKDFGFGRSSMEDMIQVEVQKLVNSL---HMETGQPLDLNFKMNISIVNALWVILVGERLELDDARLLDIVKTLDKLLRGAQVSGLLSVLFPTLYKYFHPRF---ALAKNTFESMRSLMTQAIEDHRQRFNPDEAPNDFIECYLQEIQSTSD----PQSSFYQDQGLKSLDCVLIDLFMGGSETTSITLVWTFLCLLHHPDVQDRIHQELDSIIGPDSVPQL-----QDLPTLPYLRAVMTETLRVSSVVPNGVPHYV-TVSTKVGGYLLPKGSAVMANIISPHLNPKVYE-DPEEFNPQRFLD--PDGKFQMPNSSQFAPFSLGKRFCLGQTLAEQEYYLFLAGILQKFKIHN 721          
BLAST of EMLSAG00000005163 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1571_size35388-snap-gene-0.6 (protein:Tk07363 transcript:maker-scaffold1571_size35388-snap-gene-0.6-mRNA-1 annotation:"probable cytochrome p450 303a1")

HSP 1 Score: 226.483 bits (576), Expect = 6.483e-65
Identity = 150/442 (33.94%), Postives = 225/442 (50.90%), Query Frame = 0
Query:   82 ISDFDILKKILKTDDLNYR---LAHDFSIDYTKKLYQGIGV-DGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYP---GIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTD-FISGITSIPKPFNI 515
            + D++++K+I   D+   R    AH         +Y+ +G   G L++ G  WK  RRF L  L++ GFG+ SMED L  EA       ++     G  + + ++FN+ +LN+LW++VA  R++  DP L K V  +  ++    +   +  + P+LR I P   G    ++ + ++    + L       E         DFI  Y      S +    EN           L  T++D+F AGS+TT++TLSW VL+MV HPE Q+KVQ E+D  L        ++   +D+  LPYTEA I EIQR+  I P G+PH T   D  +G Y +PKG  V   L     +P Y+   P+ F PDRF++   DG  KF K+E L  F IGKR C GE LAR E+F  F  I+QR ++ +     P  D +I+G    P+ F++
Sbjct:  358 VYDYNLIKEIFNKDEFCGRPGTFAH---------MYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEAN---QICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGEKI--MLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSGDPDFNEN----------ALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMG------KEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLK-DTTIGSYQIPKGTFVIGPLYFFMHDPDYWN-EPESFKPDRFIK---DG--KFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHV 762          

HSP 2 Score: 143.665 bits (361), Expect = 1.584e-36
Identity = 96/336 (28.57%), Postives = 162/336 (48.21%), Query Frame = 0
Query:   21 KWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYR---LAHDFSIDYTKKLYQGIGV-DGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYP---GIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELD 349
            K+  P N+PP PP+ +P FG   +L   G      +  + +R+   G +   +       ++ D++++K+I   D+   R    AH         +Y+ +G   G L++ G  WK  RRF L  L++ GFG+ SMED L  EA       ++     G  + + ++FN+ +LN+LW++VA  R++  DP L K V  +  ++   N+  ++  + P+LR I P   G    +  + ++    + L       +         DFI  Y      S +    EN           L  T++D+F AGS+TT++TL+W VL+M+ HPE  +KVQ E+D
Sbjct:   19 KYSKPRNFPPGPPW-VPFFGSMPFLPKIGSPLSLSWKEMTERY---GKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAH---------MYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEAN---QICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNI--SVITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQSGDPEFNEN----------ALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREID 326          
BLAST of EMLSAG00000005163 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold605_size125465-snap-gene-0.31 (protein:Tk06867 transcript:maker-scaffold605_size125465-snap-gene-0.31-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_314153")

HSP 1 Score: 210.305 bits (534), Expect = 2.148e-61
Identity = 137/456 (30.04%), Postives = 229/456 (50.22%), Query Frame = 0
Query:   75 ARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLST---LKNFGFGRSSMEDMLM-EEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTDFISGITSIPKPFNIKLIPRDVKIIV 526
             ++ M ++SD  ++KK L + D  +R       D    L +G G+   + S   +WK QRRF+L     ++++G G   +E+ +  E   L  N   E+    G  I      N  + NV+  ++   RF+  DP+  + +    +     N   T A  FP L+ +    +   ++++    +  F +  ++ H+   D   PRD ID+YL+++ D+  N     D F G   +  L + +LDLF AG ET  +T+ WG+++M+ +PE+  K+Q EL+  L      S R    +D  +LPYT A ICEI RR    P+   H+    D +   Y++PK   V   +  +  NP  +  NP++F P+RFL   ++ G   IK+E  IPFS+G+R C G+ LA  E+F FF S+L    +    GE+PS    +G+T  P  F++  IP++++ + 
Sbjct:  100 GQVNMVVLSDVRLIKKALGSRDFIHRPKTPLFQD----LLKGFGI---INSEKALWKSQRRFLLHQKLGMRHWGAGMEHIEERIQFESINLIENLFIEQKDSLG--IDPEPFLNSAVANVVCSVIMSIRFDANDPKFIRFMDLFDEGFKLFNETGT-AMFFPPLQYLPGAKNIFNKLSANRQEMLAFSKYIIQEHKNTLDEEAPRDLIDSYLIRMADTVNN---NEDLFHGYNPEEQLEQIILDLFSAGVETIKTTIRWGIVYMLHYPEVMAKIQSELEQVLG-----SERMPTIQDMPNLPYTRATICEILRRSTPVPLATTHSC-ERDVEFEGYLIPKNTQVIPLIHAVHMNPDNWE-NPEEFRPERFL---TEDGSDVIKSENFIPFSVGQRMCLGDKLAEKELFIFFASLLHVTNIVPSSGELPSLRGEAGVTIKPHKFSVNFIPKNIEALT 532          
BLAST of EMLSAG00000005163 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1387_size43827-snap-gene-0.5 (protein:Tk06622 transcript:maker-scaffold1387_size43827-snap-gene-0.5-mRNA-1 annotation:"cytochrome p450")

HSP 1 Score: 207.608 bits (527), Expect = 6.926e-61
Identity = 149/518 (28.76%), Postives = 250/518 (48.26%), Query Frame = 0
Query:    3 VALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVG-GVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGIGVD---GXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEE-NIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRS--IDGEIPSTDFISGITSIPKPF 513
            + L I +CL     L+  KWK     PP P +  P  G    L  A  N  E   R   R + G G +      +    +++  + +K+    D+   R          K LY+    D   G ++  G +WK+QR+FM+ TL+ FG G+ +MED + +E    + FL E+ N      + + + FN+  LNV+WR+V G RF+Y D  L +++  +    +   + P IA I  +L+ I P     + +   +    EFL   V+  +A+   +  R +ID++L       E  +  +D          L  ++ D F  GS T S TL++ +LFMV++PE+Q++ ++E+   L   D     +    DR  LP+ EA + E+QR  ++ P+  P      D  +GD+++ +G  V   L  + RN +++G +PD F PDRF+   + G V+   +E+L PF  GKR C GE +A+  +  F  + L +F+     +  E  + D + G+T  PK +
Sbjct:    5 LGLFIVICLYTYVPLF--KWK---KRPPGP-WVFPFMGSIPALGKADANALEFPYRAMHRLSQGYGPIMSMGLGQDMWVILTGLEEIKQFSMMDETVAR-------PNLKSLYEIYSFDRPLGVIFPDGPLWKEQRKFMMRTLREFGLGKQTMEDHIQDEIKCSIQFLREQCNENANHEVAMQDFFNLPCLNVIWRLVCGRRFDYGDKRLAELIEHMETFTMEQAIGP-IAGI-SYLKYIPPFSQIYKRIHKHMGIFKEFLSNFVQEEKASLSTDFDRGYIDSFLRAQARGREAGEYFSDQ--------QLVISVQDFFTGGSGTMSKTLAYAILFMVKYPEVQERARKEIQDALGSRD-----EVTLGDRAELPFIEAIVMEVQRLSSVLPIAPPRVPLK-DVMIGDHMITQGTQVQINLYSLHRNQEHWG-DPDSFRPDRFINPKT-GAVE--PDEWLQPFGYGKRKCLGETVAKHTVLLFLANFLLKFKFSGSKLGDESATLDPVGGLTIGPKKY 489          
BLAST of EMLSAG00000005163 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold58_size443543-snap-gene-0.8 (protein:Tk00687 transcript:maker-scaffold58_size443543-snap-gene-0.8-mRNA-1 annotation:"hypothetical protein BRAFLDRAFT_61918")

HSP 1 Score: 209.534 bits (532), Expect = 2.278e-59
Identity = 149/485 (30.72%), Postives = 251/485 (51.75%), Query Frame = 0
Query:   43 LYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYR---LAHDFSIDYTKKLYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNH-----PRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDG-EIPSTDFISGITSIPKPFNIKLI 518
            L +R    N ++   R   R   G V+ L + + + + ++SDFD +    K      R   L    +  +    + G    G ++S G  W +QRRF L TL++FGF + +MED+++EE    +  L  +      ++ +  + ++G++N LW I+ G +  + D  + KIV    D I + ++   +  + P+LR  +P I +  + + +       LQ   +      D N+      +DFID YL KIK++ +       SF G+ G+LNL ++L D+F AG+ + SS L +  L+++++P+IQ KVQ+EL   + +           +DR ++PYT+A + E+ R   +    VPHAT + D  V  + +PK  VV A L  +  N  Y+  +P+ F P+RFL    D   KF ++E  IPF +GKR C G++LA  ++F FF +ILQ FEL++  G E  S + I G       +++KL+
Sbjct:   93 LAVRLLAGNLKDAMQRW--RKEYGEVVGLHLGSELTV-VLSDFDEISNAFKDKRFTGRPKALTETMTAFFAS--HPGEKGGGIVFSEGEQWSEQRRFALKTLRDFGFSKKAMEDVILEEVFKMIQVLRADE----DSMSLNQVLSVGVVNSLWTILTGQKLSHGDQTVMKIVTGTDDFINNESMSGPLM-MMPWLR-FFPYIKEKFQASKEAPLSMRKLQ---EEQSGELDNNNGVRKESKDFIDVYLDKIKETRD----RKSSFFGDQGRLNLQRSLTDIFGAGTSSGSSMLLFAFLYVIKYPKIQTKVQDELSRIIGKN------TVSLDDRSNMPYTDAVLHEVMRHSCLV-YAVPHAT-TEDVSVQGFDLPKDTVVYANLWQVMHNTDYW-QDPEIFRPERFL----DRDSKFRRDERCIPFMLGKRFCIGQSLALQQLFLFFVTILQHFELQAPGGAEAVSIEPIVGFVHQCPKYSVKLV 546          
BLAST of EMLSAG00000005163 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold364_size194629-snap-gene-0.16 (protein:Tk12398 transcript:maker-scaffold364_size194629-snap-gene-0.16-mRNA-1 annotation:"cytochrome p450 2j2")

HSP 1 Score: 207.223 bits (526), Expect = 5.370e-59
Identity = 139/414 (33.57%), Postives = 207/414 (50.00%), Query Frame = 0
Query:  113 LYQGIGVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLL----DLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGE-IPSTDFISGITSIPKPFNIKLIPRD 521
            L  GIG+ G  W      K+QRRF    L++ G G+  M+  +++E    +  + ++   T    ++   F++  LNV+W +VAG R+EY DP   K    +   +  +   P  A   P L+ I P     Q +   +      +++ ++N    FDP H R +ID +L++ K +               GK    K L+    DLF AGSET S TLS   L+MV HPE+Q K+QEELD  +    G S R    +DR +LPYT+A + E++R     P+  P  T   D  +  Y +P G  V   +  + R  KYF  NP++F P+RFL    +     +  E  IPF  GKR C GENLA +  F FF ++LQ F  R++D +  PST    G+T  P+PF++ +  RD
Sbjct:  353 LGMGIGIGGERW------KEQRRFSARALRDLGAGKKGMDAKILQEVVHTIEDIKDKVRGTQKLKKVDQYFDLPDLNVIWALVAGIRYEYDDPVAHKQFDYLRSFLQESTAGPLTAT--PMLKYIPPFSGIYQNIRKCMDEFRVLIKSVIRNQAETFDPEHIRGYIDKFLVEQKANR--------------GKFFTDKDLIINCQDLFIAGSETASKTLSNCFLWMVLHPEVQDKIQEELDTVI----GNS-RHVIMDDRPNLPYTDAALMEVRRISTPFPI-TPPRTAPRDITIQGYNIPAGTPVQMNIYSVLRGEKYFD-NPNEFKPERFLNAKKE----IVVPEGFIPFGYGKRRCLGENLATVSNFMFFANLLQVFTFRALDPKHPPSTLPCGGLTYGPQPFDVSVSVRD 733          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000005163 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-3.662e-8735.83symbol:CYP2J2 "Uncharacterized protein" species:96... [more]
-9.112e-8535.39symbol:LOC100524940 "Uncharacterized protein" spec... [more]
-1.070e-8434.93symbol:cyp2p8 "cytochrome P450, family 2, subfamil... [more]
-3.443e-8435.39symbol:LOC100524940 "Uncharacterized protein" spec... [more]
-1.338e-8335.32symbol:CYP2J34 "Uncharacterized protein" species:9... [more]
-7.304e-8235.25symbol:Cyp2j3 "Cytochrome P450 2J3" species:10116 ... [more]
-7.304e-8235.25symbol:Cyp2j3 "cytochrome P450, family 2, subfamil... [more]
-8.288e-8235.46symbol:LOC521656 "Uncharacterized protein" species... [more]
-7.641e-8135.63symbol:cyp2p9 "cytochrome P450, family 2, subfamil... [more]
-2.055e-8035.35symbol:cyp2p10 "cytochrome P450, family 2, subfami... [more]

Pages

back to top
BLAST of EMLSAG00000005163 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592903285|gb|GAXK01055090.1|1.821e-9736.67TSA: Calanus finmarchicus comp84427_c0_seq2 transc... [more]
gi|592903286|gb|GAXK01055089.1|3.822e-9736.67TSA: Calanus finmarchicus comp84427_c0_seq1 transc... [more]
gi|592812829|gb|GAXK01141739.1|3.151e-8933.27TSA: Calanus finmarchicus comp190848_c0_seq1 trans... [more]
gi|592804503|gb|GAXK01150065.1|1.080e-8134.49TSA: Calanus finmarchicus comp1970789_c0_seq2 tran... [more]
gi|592804504|gb|GAXK01150064.1|2.865e-8134.27TSA: Calanus finmarchicus comp1970789_c0_seq1 tran... [more]
gi|592806346|gb|GAXK01148222.1|4.998e-7031.78TSA: Calanus finmarchicus comp1026677_c0_seq1 tran... [more]
gi|592939284|gb|GAXK01019269.1|5.406e-7032.91TSA: Calanus finmarchicus comp81223_c0_seq4 transc... [more]
gi|592939285|gb|GAXK01019268.1|5.406e-7032.91TSA: Calanus finmarchicus comp81223_c0_seq3 transc... [more]
gi|592939286|gb|GAXK01019267.1|4.392e-6933.19TSA: Calanus finmarchicus comp81223_c0_seq2 transc... [more]
gi|592750666|gb|GAXK01203747.1|2.857e-6732.01TSA: Calanus finmarchicus comp385039_c0_seq3 trans... [more]

Pages

back to top
BLAST of EMLSAG00000005163 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 12
Match NameE-valueIdentityDescription
EMLSAP000000051630.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s272:55556... [more]
EMLSAP000000023599.576e-6831.49pep:novel supercontig:LSalAtl2s:LSalAtl2s144:36912... [more]
EMLSAP000000077581.411e-6432.94pep:novel supercontig:LSalAtl2s:LSalAtl2s453:37641... [more]
EMLSAP000000068221.077e-5834.62pep:novel supercontig:LSalAtl2s:LSalAtl2s383:99037... [more]
EMLSAP000000046883.939e-5729.74pep:novel supercontig:LSalAtl2s:LSalAtl2s245:53586... [more]
EMLSAP000000073282.259e-5328.31pep:novel supercontig:LSalAtl2s:LSalAtl2s412:19530... [more]
EMLSAP000000057212.180e-3928.64pep:novel supercontig:LSalAtl2s:LSalAtl2s309:68270... [more]
EMLSAP000000120884.058e-1323.57pep:novel supercontig:LSalAtl2s:LSalAtl2s865:17115... [more]
EMLSAP000000053747.652e-1321.41pep:novel supercontig:LSalAtl2s:LSalAtl2s28:147448... [more]
EMLSAP000000092242.461e-1126.29pep:novel supercontig:LSalAtl2s:LSalAtl2s588:24402... [more]

Pages

back to top
BLAST of EMLSAG00000005163 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|1706098|sp|P51590.1|CP2J3_RAT2.687e-8335.25RecName: Full=Cytochrome P450 2J3; AltName: Full=C... [more]
gi|21264413|sp|P51589.2|CP2J2_HUMAN1.701e-8034.42RecName: Full=Cytochrome P450 2J2; AltName: Full=A... [more]
gi|1706096|sp|P52786.2|CP2J1_RABIT1.710e-8034.84RecName: Full=Cytochrome P450 2J1; AltName: Full=C... [more]
gi|117225|sp|P10632.2|CP2C8_HUMAN3.362e-8037.68RecName: Full=Cytochrome P450 2C8; AltName: Full=C... [more]
gi|341940387|sp|O54750.2|CP2J6_MOUSE3.100e-7933.98RecName: Full=Cytochrome P450 2J6; AltName: Full=A... [more]
gi|77416854|sp|Q16696.3|CP2AD_HUMAN6.472e-7733.67RecName: Full=Cytochrome P450 2A13; AltName: Full=... [more]
gi|461820|sp|P33262.1|CP2CK_MACFA1.090e-7632.90RecName: Full=Cytochrome P450 2C20; AltName: Full=... [more]
gi|117200|sp|P24454.1|CP2A8_MESAU3.393e-7531.61RecName: Full=Cytochrome P450 2A8; AltName: Full=C... [more]
gi|19924285|sp|Q08078.1|CP2CP_MESAU1.481e-7432.44RecName: Full=Cytochrome P450 2C25; AltName: Full=... [more]
gi|117216|sp|P24460.1|CP2BB_CANFA1.730e-7434.58RecName: Full=Cytochrome P450 2B11; AltName: Full=... [more]

Pages

back to top
BLAST of EMLSAG00000005163 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EFX83960.11.653e-6430.51hypothetical protein DAPPUDRAFT_47261 [Daphnia pul... [more]
EFX83937.12.655e-6428.76hypothetical protein DAPPUDRAFT_194538 [Daphnia pu... [more]
AHN54491.15.386e-6430.00Cyp303a1, isoform B [Drosophila melanogaster][more]
AAF53514.15.386e-6430.00Cyp303a1, isoform A [Drosophila melanogaster][more]
EFX62802.15.286e-6329.17hypothetical protein DAPPUDRAFT_309471 [Daphnia pu... [more]
EFX84030.13.317e-6129.05hypothetical protein DAPPUDRAFT_47245 [Daphnia pul... [more]
EFX83696.15.048e-6129.86hypothetical protein DAPPUDRAFT_301663 [Daphnia pu... [more]
gb|KFM72918.1|2.614e-6029.21Cytochrome P450 18a1, partial [Stegodyphus mimosar... [more]
EFX83941.16.993e-6031.70hypothetical protein DAPPUDRAFT_209641 [Daphnia pu... [more]
EFX83753.11.345e-5930.15hypothetical protein DAPPUDRAFT_301662 [Daphnia pu... [more]

Pages

back to top
BLAST of EMLSAG00000005163 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|675803055|gb|AIL94135.1|1.153e-12440.00cytochrome P450 CYP3031A1 [Tigriopus japonicus][more]
gi|820982928|gb|AKH03502.1|4.061e-8934.03cytochrome P450 3036B1 [Paracyclopina nana][more]
gi|820982950|gb|AKH03513.1|3.866e-8836.69cytochrome P450 3075B2 [Paracyclopina nana][more]
gi|1061482263|gb|ODM99561.1|6.802e-8834.48Methyl farnesoate epoxidase [Orchesella cincta][more]
gi|998708400|ref|XP_015491936.1|3.034e-8736.38PREDICTED: cytochrome P450 2J2-like [Parus major] ... [more]
gi|73956380|ref|XP_852725.1|2.853e-8635.83PREDICTED: cytochrome P450 2J2 [Canis lupus famili... [more]
gi|543353161|ref|XP_005521267.1|4.241e-8636.18PREDICTED: cytochrome P450 2J2-like [Pseudopodoces... [more]
gi|683908523|ref|XP_009087020.1|4.978e-8635.25PREDICTED: cytochrome P450 2J2 [Serinus canaria][more]
gi|1101635226|ref|XP_018981179.1|6.810e-8635.32PREDICTED: cytochrome P450 2J2-like isoform X2 [Cy... [more]
gi|1101635224|ref|XP_018981178.1|9.815e-8635.86PREDICTED: cytochrome P450 2J2-like isoform X1 [Cy... [more]

Pages

back to top
BLAST of EMLSAG00000005163 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 25
Match NameE-valueIdentityDescription
snap_masked-scaffold133_size323035-processed-gene-1.71.374e-10740.00protein:Tk02241 transcript:snap_masked-scaffold133... [more]
maker-scaffold1406_size42870-snap-gene-0.122.500e-8033.53protein:Tk07895 transcript:maker-scaffold1406_size... [more]
maker-scaffold604_size126151-snap-gene-0.261.102e-6732.58protein:Tk08218 transcript:maker-scaffold604_size1... [more]
snap_masked-scaffold1422_size42147-processed-gene-0.11.055e-6632.77protein:Tk11335 transcript:snap_masked-scaffold142... [more]
snap_masked-scaffold243_size241480-processed-gene-0.61.777e-6531.52protein:Tk02952 transcript:snap_masked-scaffold243... [more]
maker-scaffold1571_size35388-snap-gene-0.66.483e-6533.94protein:Tk07363 transcript:maker-scaffold1571_size... [more]
maker-scaffold605_size125465-snap-gene-0.312.148e-6130.04protein:Tk06867 transcript:maker-scaffold605_size1... [more]
maker-scaffold1387_size43827-snap-gene-0.56.926e-6128.76protein:Tk06622 transcript:maker-scaffold1387_size... [more]
maker-scaffold58_size443543-snap-gene-0.82.278e-5930.72protein:Tk00687 transcript:maker-scaffold58_size44... [more]
maker-scaffold364_size194629-snap-gene-0.165.370e-5933.57protein:Tk12398 transcript:maker-scaffold364_size1... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s272supercontigLSalAtl2s272:555567..557147 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionaugustus_masked-LSalAtl2s272-processed-gene-5.4
Biotypeprotein_coding
EvidenceIEA
NoteCytochrome P450 2J3
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000005163 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000005163EMLSAT00000005163-701010Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s272:555567..557147-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000005163-687929 ID=EMLSAG00000005163-687929|Name=EMLSAG00000005163|organism=Lepeophtheirus salmonis|type=gene|length=1581bp|location=Sequence derived from alignment at LSalAtl2s272:555567..557147- (Lepeophtheirus salmonis)
ATGTCTGTGGCTCTTGTGATCACTGTATGTCTCATATTGGCTGKCATTCT CTACGAAATTAAATGGAAATACCCCGAAAACTAYCCCCCCACTCCACCCT TTCGTCTTCCACTCTTTGGTCATTCTCTTTATCTTCGAAGTGCAGGGAAA AACTTTCAAGAAGGGTTCGACCGCATCTTTGATCGATTTAATGTGGGTGG AGTACTCTGTCTACAAGTGGCAGCTCGGATTCGTATGGKAATGATATCGG ACTTTGACATACTTAAAAAGATTCTTAAGACTGATGATTTAAACTATCGT CTCGCACATGACTTTTCCATTGACTACACTAAGAAGCTATATCAAGGAAT TGGTGTGGATGGAGKACTTTGGAGCTACGGGKCTATTTGGAAGCAACAAA GACGATTTATGCTTTCTACTCTCAAGAACTTTGGATTTGGAAGGTCTTCC ATGGAGGACATGCTCATGGAAGAGGCTACTCTCTTCGTAAATTTTCTAAA TGAAGAGAATATCCAGACAGGAGGGAACATACGTATTGCCAATTTGTTCA ATATTGGAATTCTAAACGTTCTTTGGAGGATAGTGGCAGGTACACGTTTC GAGTACAGGGATCCAGAACTACAAAAAATAGTGCATAAAGTGGGAGATGC TATTCTATCTACAAATTTGAAACCTACAATTGCAGCAATCTTTCCTTTTC TGAGGACTATTTATCCTGGAATCGATGATMCCCAGGAGGTAACATCCAAA GTAGCTGCCGTCTACGAATTTCTTCAAACAGCTGTCAAGAATCATGAGGC CAACTTTGATCCAAATCATCCAAGAGACTTTATCGACACATATCTCCTCA AAATAAAAGACTCTGAAGAGAATCCAGACAAAGAAAATGACAGCTTTCGA GGGGAGTTGGGGAAATTGAATCTTAGTAAGACACTCCTGGATCTTTTCTT TGCAGGATCTGAAACAACATCAAGTACACTATCTTGGGGCGTCCTCTTCA TGGTTCGACATCCAGAAATTCAAAAAAAGGTACAGGAAGAGCTGGATCTT TTTCTTCATGAGGGAGATGGAGAGAGTTTTCGAAAGGCAAGGAGTGAGGA TCGTATTCATTTGCCTTACACTGAGGCGGKTATTTGTGAGATACAGCGAC GTGGGAATATCACACCCATGGGGGTTCCACATGCAACCTACAGTGGAGAC GCAAAAGTAGGGGACTACGTCGTGCCCAAAGGACATGTTGTGAACGCATA TCTTTCCGGTATTTTTCGGAATCCTAAGTATTTTGGACCTAATCCAGATC AGTTCAATCCGGATAGATTCCTAGAAGTGGCATCCGATGGAGGAGTGAAG TTTATCAAGAATGAGTATCTCATACCCTTCTCTATTGGAAAGCGATCCTG TCCTGGAGAAAATTTGGCTCGAATGGAGATTTTCTCTTTCTTTACAAGTA TTCTACAGAGATTTGAATTACGCAGTATAGATGGGGAAATMCCCTCCACA GATTTTATCTCTGGGATTACATCCATACCCAAGCCTTTCAATATCAAATT AATACCACGGGACGTGAAAATTATAGTTTGA
back to top
Add to Basket