EMLSAG00000005382, EMLSAG00000005382-688148 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000005382
Unique NameEMLSAG00000005382-688148
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
LsHSCARB on free living stages unknown
  1. Nauplius I
  2. Copepodid
none
no visible phenotype
26.07.2016 - 09:55
02.08.2016 - 10:00
A scavenger receptor B (CD36)-like protein is a... more
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: feeding, reduced nutrient uptake
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
LsHSCARB - a putative intestinal heme receptor female
  1. PreAdult2
Shorter egg-strings, 60% less heme, lower hatching rate
feeding, reduced nutrient uptake
21.03.2017 - 10:10
29.05.2017 - 10:10
A scavenger receptor B (CD36)-like protein is a... more
Homology
BLAST of EMLSAG00000005382 vs. GO
Match: - (symbol:SCARB2 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0004872 "receptor activity" evidence=IEA] [GO:0005765 "lysosomal membrane" evidence=IEA] [GO:0006622 "protein targeting to lysosome" evidence=IEA] [GO:0007155 "cell adhesion" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0019899 "enzyme binding" evidence=IEA] [GO:0043202 "lysosomal lumen" evidence=IEA] InterPro:IPR002159 InterPro:IPR005429 Pfam:PF01130 PRINTS:PR01609 PRINTS:PR01611 GO:GO:0016021 GO:GO:0005765 GO:GO:0004872 GO:GO:0007155 GO:GO:0043202 GO:GO:0006622 GeneTree:ENSGT00530000062927 OrthoDB:EOG79SDWX TreeFam:TF317925 PANTHER:PTHR11923 CTD:950 KO:K12384 OMA:YLNESAL EMBL:AADN03004064 RefSeq:XP_420593.1 UniGene:Gga.5283 Ensembl:ENSGALT00000018738 GeneID:422638 KEGG:gga:422638 NextBio:20825242 PRO:PR:E1BRR6 Uniprot:E1BRR6)

HSP 1 Score: 174.866 bits (442), Expect = 1.765e-46
Identity = 143/537 (26.63%), Postives = 246/537 (45.81%), Query Frame = 0
Query:    8 VILGLLSIVLIIGGISLKM-HILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMS--NPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC-YGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNT--VGIALGYVVG 538
            V +G+L++ L+I  ISL + H+   ++  Q+ +   L+ GTE F A+++PP PVY+ +  F++ N  EV++G  P++ E GPY+YRE   + ++     ++L  G  TK       T+  + +  +  P     ++ +I  + +     ++    T      E++      L +  E LF    V ++L+ G+  K           L+  + V+   ++   P+                     F FF   N T     Y   +G  +  +F  IVE+ GK  L    W    T            C+ I GTDGT F P +   K   +++F  + CR++Y+ ++S   V  G+  YR+     VF+ +  NP+N  +C    +C                   GV++VS C  GAPIF+S PHF QAD++  + ++G+ P  E H T++DI P  G  L+A K++QIN+ +RK+        +    + P+ + +E   +D   A +L +VL  A  +     V +A+G V G
Sbjct:    7 VTVGVLALTLLIASISLLVAHVFQTVVDLQVKQGTVLKNGTETFEAWEDPPPPVYMQFYFFNVTNPLEVLQGATPLVEEKGPYTYREYRPRVHV-----QFLDNG--TKVSALNPKTYVFEPEKSVGNP-----EVDLIRTINVPAVTAMEWTRATSLQFATEVL------LLLYQESLFTVRTVHELLW-GYKDK-----------LLSTIHVLHPEID---PV---------------------FGFFNKMNGTD-DGEYVFLSGEMNYLNFSRIVEWKGKESL---NWWTTKT------------CNMINGTDGTSFHPLI--SKDENIYIFSSDFCRSLYLVYDSSGSV-AGVPTYRFVPSPMVFANTTVNPDNAGFCVPPGNCPGA----------------GVLNVSICKQGAPIFLSAPHFYQADQKFVSDIEGMHPTKEYHETFVDINPLTGLVLQAAKRMQINIHVRKLPEFFETGNIRTL-IFPVMYINESVLIDEASANKLKHVLLEASVVTGIPFVIMAIGIVFG 453          
BLAST of EMLSAG00000005382 vs. GO
Match: - (symbol:Snmp2 "Sensory neuron membrane protein 2" species:7227 "Drosophila melanogaster" [GO:0005886 "plasma membrane" evidence=ISS] [GO:0016021 "integral component of membrane" evidence=ISS] [GO:0004888 "transmembrane signaling receptor activity" evidence=ISS] [GO:0007155 "cell adhesion" evidence=IEA] InterPro:IPR002159 Pfam:PF01130 PRINTS:PR01609 GO:GO:0016021 GO:GO:0005886 EMBL:AE014296 GO:GO:0007155 GO:GO:0050896 GO:GO:0007608 PANTHER:PTHR11923 EMBL:EU189152 EMBL:BT029278 EMBL:BT029647 EMBL:BT029648 EMBL:BT029668 EMBL:BT029968 EMBL:BT029669 EMBL:BT099997 RefSeq:NP_001036593.1 RefSeq:NP_001163372.1 RefSeq:NP_001261539.1 UniGene:Dm.30116 ProteinModelPortal:E1JI63 SMR:E1JI63 EnsemblMetazoa:FBtr0301205 GeneID:38868 KEGG:dme:Dmel_CG7422 CTD:38868 FlyBase:FBgn0035815 eggNOG:NOG271759 InParanoid:Q0E8H2 OMA:HEVYEVH OrthoDB:EOG74J97P PhylomeDB:E1JI63 GenomeRNAi:38868 NextBio:810764 PRO:PR:E1JI63 Bgee:E1JI63 Uniprot:E1JI63)

HSP 1 Score: 176.407 bits (446), Expect = 1.897e-46
Identity = 135/590 (22.88%), Postives = 274/590 (46.44%), Query Frame = 0
Query:    1 MILYSIRVILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRE-TMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLE----------LDIPIKAKDFENIIKIISPAQLSEG---------------------TFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPE--NFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSF-YQRYR 555
            MI +S+ ++  L   V ++GG    + + P M+  ++ +++ +++G+E F  F   P P+     +F++ N++ + +G  P++ E+GPY Y++   +K     ++   +SY +   F+FD   +           P +++D+I  +N   + +   L    + + DI     N  N  L        +   +++I       KS     + D  L LLL  +  +L+          +   ++   F+ +   I+P  +++                       F+FF  KN +     Y +  G+ D    + I + +  + L    W N ++        E   C++I GTD + +PPF   ++   +++F  ++CR++ + ++++++ +G I  YRY +G+   +   PE  N C+C +  +   +  N       CL    G +D++ C  AP+ ++ PH L A  E +  ++GL+P+++KH T++D++   GTPL+  K++Q NM L+ +  I + + +    L+P  W +EG +L+ E        L + +   N V  A   + G I + V+ ++ + YQR R
Sbjct:    1 MIHWSL-IVSALGVCVAVLGGYCGWI-LFPNMVHKKVEQSVVIQDGSEQFKRFVNLPQPLNFKVYIFNVTNSDRIQQGAIPIVEEIGPYVYKQFRQKKVKHFSRDGSKISYVQNVHFDFDAVAS----------APYTQDDRIVALN---MHMNAFLQVFEREITDIFQGFANRLNSRLNQTPGVRVLKRLMERIRGK---RKSVLQISENDPGLALLLVHLNANLKAVFNDPRSMFVSTSVREYLFDGVRFCINPQGIAKAICNQIKESGSKTIREKSDGSLAFSFFGHKNGSG-HEVYEVHTGKGDPMRVLEIQKLDDSHNL--QVWLNASSE------GETSVCNQINGTDASAYPPF--RQRGDSMYIFSADICRSVQLFYQTDIQYQG-IPGYRYSIGENFINDIGPEHDNECFCVDKLANVIKRKNG------CLYA--GALDLTTCLDAPVILTLPHMLGASNEYRKMIRGLKPDAKKHQTFVDVQSLTGTPLQGGKRVQFNMFLKSINRIGITENLPTV-LMPAIWVEEGIQLNGEMVAFFKKKLINTLKTLNIVHWAT--LCGGIGVAVACLIYYIYQRGR 549          
BLAST of EMLSAG00000005382 vs. GO
Match: - (symbol:scarb1 "scavenger receptor class B, member 1" species:7955 "Danio rerio" [GO:0007155 "cell adhesion" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR002159 InterPro:IPR005428 Pfam:PF01130 PRINTS:PR01609 PRINTS:PR01610 ZFIN:ZDB-GENE-031126-1 GO:GO:0016021 GO:GO:0007155 GeneTree:ENSGT00530000062927 OrthoDB:EOG79SDWX TreeFam:TF317925 PANTHER:PTHR11923 EMBL:CU463283 Ensembl:ENSDART00000129480 OMA:MFANGTD PRO:PR:E7FB50 ArrayExpress:E7FB50 Bgee:E7FB50 Uniprot:E7FB50)

HSP 1 Score: 174.096 bits (440), Expect = 5.079e-46
Identity = 128/505 (25.35%), Postives = 234/505 (46.34%), Query Frame = 0
Query:   15 IVLIIGGISLK-----MHILPAMIKSQIYENLDLREGTE-GFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFS----MSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC-YGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELD 508
            + L++GG++L      + + P +I  QI +N+++    +  +  +K+ P P ++S   FHI N +E+++GE P++++ GPY YRE   K+N+    +  +SY +Y ++ F+E+ +              ++D +TI N ++L  +  ++ +P  V+ +        NE         F+T+ V ++++ G+DSK   + D L+ +L  +L                          P+    G FA F   N       +TI  GR D      +  +NG   +    W                 C+ I GT G  +PPF+  +   P   +  + CR++ + ++  + V  GI  YRY   K +F+        E FC C++                       G+++VS+C +G+P F+SQPHF  AD ++   V GL P+ ++H  ++DI P  G P+    ++Q+N+ L+KV+GI     +A+  ++PM W +E   +D
Sbjct:   10 VFLVLGGMALLFGTVLVFVGPIIIDDQIVKNVEINPKNDLSYTMWKDIPVPFFMSVYFFHIVNPDEILKGERPMVIQRGPYVYRENRWKDNITFHENHTVSYKEYRQYFFEESMSVG-----------DESDVVTIPNMLVLGASVMMENMPFPVRLLLSTTFKTFNEGP-------FLTKPVGELMW-GYDSK---LVDFLNKYLPGML--------------------------PSSGKFGLFADFNNSNT----GLFTIFTGRDDIRKVHMVDSWNGLKNV--DYW-------------RSDQCNMINGTAGQMWPPFMTKETTMPF--YSPDACRSMELVYQRPL-VSSGIPVYRYVSPKTLFANGADFPPNEGFCPCRQ----------------------SGLLNVSSCRHGSPTFISQPHFYNADPQLLDTVSGLSPSEDEHGLFIDIHPETGVPVNVSVRLQLNLFLKKVSGISETGNIAEV-VMPMLWFEESGYID 421          
BLAST of EMLSAG00000005382 vs. GO
Match: - (symbol:SCARB2 "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0004872 "receptor activity" evidence=IEA] [GO:0005765 "lysosomal membrane" evidence=IEA] [GO:0006622 "protein targeting to lysosome" evidence=IEA] [GO:0007155 "cell adhesion" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0019899 "enzyme binding" evidence=IEA] [GO:0043202 "lysosomal lumen" evidence=IEA] InterPro:IPR002159 InterPro:IPR005429 Pfam:PF01130 PRINTS:PR01609 PRINTS:PR01611 GO:GO:0016021 GO:GO:0005765 GO:GO:0004872 GO:GO:0007155 GO:GO:0043202 GO:GO:0006622 GeneTree:ENSGT00530000062927 OrthoDB:EOG79SDWX TreeFam:TF317925 PANTHER:PTHR11923 CTD:950 KO:K12384 EMBL:FP016186 RefSeq:NP_001231084.1 UniGene:Ssc.8609 Ensembl:ENSSSCT00000009835 GeneID:414407 KEGG:ssc:414407 OMA:DQAIEKN ArrayExpress:F1RYT3 Uniprot:F1RYT3)

HSP 1 Score: 173.326 bits (438), Expect = 7.392e-46
Identity = 155/524 (29.58%), Postives = 243/524 (46.37%), Query Frame = 0
Query:   27 HILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENL-MEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKA--EDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFS-MSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFR--LIPMFWADEGAELDSEKAEELNNVLFSAITIGNT--VGIALGYVVGPIL 541
             +    +   I +N+ LR G+E F+++K+PP PVY+ +  F++ N  E++ GE P + EVGPY+YRE   K ++    N   +S      + F+   +        +  P  K D +  +N   LT A +   LP     +  EII    EAL ++A  + LF+T  VD++L+ G+  +           ++ L+ +++                    ISP       F  F GKN T   +Y  +  G  +  +F  IVE+NGK  L    W    T            C+ I GTDG  F P +   K   L++F  + CR++Y+ F S+ E   G+ A RY V   + +  S+   FC  +                  CL    GV++VS C  GAPI MS PHF QAD++  + + G+ PN E H T++DI P  G  LRA K+ QIN+ +RK   +D   +  + R  + P+ + +E   +D E A  L +V+ + + I N   + +ALG   G I 
Sbjct:   27 RVFQKAVDQAIEKNIVLRNGSETFDSWKKPPLPVYIQFYFFNVTNPEEILSGEIPRVEEVGPYTYRELRNKADIQFGDNGTTISAVSNKAYVFERDKS--------VGDP--KTDLLRTLNIPALT-AMEWTHLP-----LLREII----EAL-LRAYRQKLFVTHTVDELLW-GYKDE-----------ILSLINILEPD------------------ISPY------FGLFYGKNGTNDGDYVFL-TGEDNYLNFSKIVEWNGKTSL---DWWTADT------------CNMINGTDGDSFHPLI--TKDEVLYVFPSDFCRSVYITF-SDFERVQGLPALRYKVPAEILANTSDNAGFCIPK----------------GNCLG--SGVLNVSVCKNGAPIIMSFPHFYQADEKFVSAIDGMHPNKEYHETFVDINPLTGIILRAAKRFQINVYVRK---LDDFIETGNIRTLVFPVMYLNESVLIDKETASRLKSVVNTTMVITNIPYIILALGVFFGLIF 453          
BLAST of EMLSAG00000005382 vs. GO
Match: - (symbol:Scarb2 "scavenger receptor class B, member 2" species:10090 "Mus musculus" [GO:0004872 "receptor activity" evidence=IEA] [GO:0005622 "intracellular" evidence=IMP] [GO:0005623 "cell" evidence=IMP] [GO:0005764 "lysosome" evidence=IEA] [GO:0005765 "lysosomal membrane" evidence=ISO;IDA] [GO:0006622 "protein targeting to lysosome" evidence=ISO;IMP] [GO:0007155 "cell adhesion" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0019899 "enzyme binding" evidence=ISO;IPI] [GO:0043202 "lysosomal lumen" evidence=IDA] [GO:0070062 "extracellular vesicular exosome" evidence=ISO] InterPro:IPR002159 InterPro:IPR005429 Pfam:PF01130 PRINTS:PR01609 PRINTS:PR01611 MGI:MGI:1196458 GO:GO:0016021 GO:GO:0005765 GO:GO:0004872 GO:GO:0007155 GO:GO:0043202 GO:GO:0006622 eggNOG:NOG257244 GeneTree:ENSGT00530000062927 HOGENOM:HOG000252951 OrthoDB:EOG79SDWX TreeFam:TF317925 PANTHER:PTHR11923 CTD:950 HOVERGEN:HBG106707 KO:K12384 OMA:LNESVHI EMBL:AB008553 EMBL:AK011123 EMBL:AK083038 EMBL:AK144235 EMBL:BC029073 PIR:JC5670 RefSeq:NP_031670.1 UniGene:Mm.297964 ProteinModelPortal:O35114 SMR:O35114 IntAct:O35114 MINT:MINT-4133971 PhosphoSite:O35114 PaxDb:O35114 PRIDE:O35114 Ensembl:ENSMUST00000031377 GeneID:12492 KEGG:mmu:12492 UCSC:uc008ydm.1 InParanoid:O35114 NextBio:281416 PRO:PR:O35114 ArrayExpress:O35114 Bgee:O35114 CleanEx:MM_SCARB2 Genevestigator:O35114 Uniprot:O35114)

HSP 1 Score: 172.94 bits (437), Expect = 9.425e-46
Identity = 144/520 (27.69%), Postives = 239/520 (45.96%), Query Frame = 0
Query:   27 HILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENL-MEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLAD--KLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFR--LIPMFWADEGAELDSEKAEELNNVLFSAITIGNT--VGIALGYVVG 538
             +    +   I +N+ L+ GT+ FN++++PP PVY+ +  F++ N  E+++GE P+L EVGPY+YRE   K N+   +N   +S      + F+   +        +  P    D I  IN  LLT+ D  +L  L + ++ +           L    + LF+   V ++L+ G+  +           ++ L+ + +                    +SP       F  F  +N T     Y    G  +  +F  IVE+NGK  L    W    T            C+ I GTDG  F P +   K   L++F  +LCR++++ F S   VEG + A+RY V   + + ++ EN  +C    +C                   GV+++S C  GAPI MS PHF QAD++  + +KG+ PN E+H +++DI P  G  LR  K+ QIN  +RK   +D   +  D R  + P+ + +E   +D E A +L +V+ + + + N   + +ALG   G
Sbjct:   27 RVFQKAVDQTIEKNMVLQNGTKVFNSWEKPPLPVYIQFYFFNVTNPEEILQGEIPLLEEVGPYTYRELRNKANIQFGENGTTISAVTNKAYVFERNQS--------VGDP--NVDLIRTINIPLLTVVDLAQLTLLRELIEAM-----------LKAYQQKLFVIHTVHELLW-GYKDE-----------ILSLVHIFKPD------------------VSP------NFGLFYERNGTN-DGEYVFLTGEDNYLNFSKIVEWNGKTSL---DWWTTDT------------CNMINGTDGDSFHPLI--SKDEVLYLFPSDLCRSVHITFSSFENVEG-LPAFRYKVPAEILANTS-ENAGFCIPEGNCMDS----------------GVLNISICKNGAPIIMSFPHFYQADEKFVSAIKGMHPNKEEHESFVDINPLTGIILRGAKRFQINTYVRK---LDDFVETGDIRTMVFPVMYLNESVLIDKETANQLKSVINTTLVVTNIPYIIMALGVFFG 450          
BLAST of EMLSAG00000005382 vs. GO
Match: - (symbol:Scarb2 "Lysosome membrane protein 2" species:10116 "Rattus norvegicus" [GO:0004872 "receptor activity" evidence=IEA] [GO:0005765 "lysosomal membrane" evidence=ISS] [GO:0006622 "protein targeting to lysosome" evidence=IEA] [GO:0007155 "cell adhesion" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0019899 "enzyme binding" evidence=IEA] [GO:0043202 "lysosomal lumen" evidence=IEA] InterPro:IPR002159 InterPro:IPR005429 Pfam:PF01130 PRINTS:PR01609 PRINTS:PR01611 RGD:621882 GO:GO:0016021 GO:GO:0005765 GO:GO:0004872 GO:GO:0007155 GO:GO:0043202 GO:GO:0006622 eggNOG:NOG257244 GeneTree:ENSGT00530000062927 HOGENOM:HOG000252951 OrthoDB:EOG79SDWX TreeFam:TF317925 PANTHER:PTHR11923 CTD:950 HOVERGEN:HBG106707 KO:K12384 EMBL:M68965 EMBL:D10587 EMBL:BC061853 PIR:JH0241 RefSeq:NP_446453.1 UniGene:Rn.3957 IntAct:P27615 STRING:10116.ENSRNOP00000003052 PaxDb:P27615 PRIDE:P27615 Ensembl:ENSRNOT00000003052 GeneID:117106 KEGG:rno:117106 UCSC:RGD:621882 InParanoid:P27615 OMA:NTIGIMN NextBio:620004 PRO:PR:P27615 Genevestigator:P27615 Uniprot:P27615)

HSP 1 Score: 170.629 bits (431), Expect = 5.291e-45
Identity = 145/521 (27.83%), Postives = 237/521 (45.49%), Query Frame = 0
Query:   27 HILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENL-MEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFR--LIPMFWADEGAELDSEKAEELNNVLFSAITIGNT--VGIALGYVVGPIL 541
             +    +   I +N+ L+ GT+ F+++++PP PVY+ +  F++ N  E+++GE P+L EVGPY+YRE   K N+   +N   +S      + F+   +        +  P    D I  IN  LLT+ +         +    EII      L    + LF+T  V ++L+ G+  +           ++ L+ + +                    +SP       F  F  +N T     Y    G  +  +F  IVE+NGK  L    W    T            C+ I GTDG  F P +   K   L++F  + CR++Y+ F S   VEG + A+RY V   + + S+ EN  +C    +C                   GV++VS C  GAPI MS PHF QAD++  + +KG+ PN E+H +++DI P  G  LR  K+ QIN  ++K   +D   +  + R  + P+ + +E   +D E A +L +V+ + + + N   + +ALG   G I 
Sbjct:   27 RVFQKAVDQTIEKNMVLQNGTKVFDSWEKPPLPVYIQFYFFNVTNPEEILQGEIPLLEEVGPYTYRELRNKANVQFGENGTTISAVTNKAYIFERNQS--------VGDPTV--DLIRTINIPLLTVVEMAQ------QPFLREIIE---AMLKAYQQTLFVTHTVHELLW-GYKDE-----------VLSLVHIFRPD------------------VSP------NFGLFYERNGTN-DGEYVFLTGEDNYLNFTKIVEWNGKTSL---DWWTTDT------------CNMINGTDGDSFHPLI--SKDETLYIFPSDFCRSVYITFSSFENVEG-LPAFRYKVPAEILANSS-ENAGFCIPEGNCMDA----------------GVLNVSICKNGAPIIMSFPHFYQADEKFVSAIKGMRPNKEEHESFVDINPLTGIILRGAKRFQINTYVKK---LDDFVETGNIRTMVFPVMYLNESVLIDKETASQLKSVINTTLIVTNIPYIIMALGVFFGLIF 453          
BLAST of EMLSAG00000005382 vs. GO
Match: - (symbol:Scarb2 "scavenger receptor class B, member 2" species:10116 "Rattus norvegicus" [GO:0004872 "receptor activity" evidence=IEA] [GO:0005622 "intracellular" evidence=ISO] [GO:0005623 "cell" evidence=ISO] [GO:0005765 "lysosomal membrane" evidence=ISO;ISS;TAS] [GO:0006622 "protein targeting to lysosome" evidence=IEA;ISO] [GO:0007155 "cell adhesion" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0019899 "enzyme binding" evidence=IEA;ISO] [GO:0043202 "lysosomal lumen" evidence=IEA;ISO] [GO:0070062 "extracellular vesicular exosome" evidence=ISO] InterPro:IPR002159 InterPro:IPR005429 Pfam:PF01130 PRINTS:PR01609 PRINTS:PR01611 RGD:621882 GO:GO:0016021 GO:GO:0005765 GO:GO:0004872 GO:GO:0007155 GO:GO:0043202 GO:GO:0006622 eggNOG:NOG257244 GeneTree:ENSGT00530000062927 HOGENOM:HOG000252951 OrthoDB:EOG79SDWX TreeFam:TF317925 PANTHER:PTHR11923 CTD:950 HOVERGEN:HBG106707 KO:K12384 EMBL:M68965 EMBL:D10587 EMBL:BC061853 PIR:JH0241 RefSeq:NP_446453.1 UniGene:Rn.3957 IntAct:P27615 STRING:10116.ENSRNOP00000003052 PaxDb:P27615 PRIDE:P27615 Ensembl:ENSRNOT00000003052 GeneID:117106 KEGG:rno:117106 UCSC:RGD:621882 InParanoid:P27615 OMA:NTIGIMN NextBio:620004 PRO:PR:P27615 Genevestigator:P27615 Uniprot:P27615)

HSP 1 Score: 170.629 bits (431), Expect = 5.291e-45
Identity = 145/521 (27.83%), Postives = 237/521 (45.49%), Query Frame = 0
Query:   27 HILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENL-MEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFR--LIPMFWADEGAELDSEKAEELNNVLFSAITIGNT--VGIALGYVVGPIL 541
             +    +   I +N+ L+ GT+ F+++++PP PVY+ +  F++ N  E+++GE P+L EVGPY+YRE   K N+   +N   +S      + F+   +        +  P    D I  IN  LLT+ +         +    EII      L    + LF+T  V ++L+ G+  +           ++ L+ + +                    +SP       F  F  +N T     Y    G  +  +F  IVE+NGK  L    W    T            C+ I GTDG  F P +   K   L++F  + CR++Y+ F S   VEG + A+RY V   + + S+ EN  +C    +C                   GV++VS C  GAPI MS PHF QAD++  + +KG+ PN E+H +++DI P  G  LR  K+ QIN  ++K   +D   +  + R  + P+ + +E   +D E A +L +V+ + + + N   + +ALG   G I 
Sbjct:   27 RVFQKAVDQTIEKNMVLQNGTKVFDSWEKPPLPVYIQFYFFNVTNPEEILQGEIPLLEEVGPYTYRELRNKANVQFGENGTTISAVTNKAYIFERNQS--------VGDPTV--DLIRTINIPLLTVVEMAQ------QPFLREIIE---AMLKAYQQTLFVTHTVHELLW-GYKDE-----------VLSLVHIFRPD------------------VSP------NFGLFYERNGTN-DGEYVFLTGEDNYLNFTKIVEWNGKTSL---DWWTTDT------------CNMINGTDGDSFHPLI--SKDETLYIFPSDFCRSVYITFSSFENVEG-LPAFRYKVPAEILANSS-ENAGFCIPEGNCMDA----------------GVLNVSICKNGAPIIMSFPHFYQADEKFVSAIKGMRPNKEEHESFVDINPLTGIILRGAKRFQINTYVKK---LDDFVETGNIRTMVFPVMYLNESVLIDKETASQLKSVINTTLIVTNIPYIIMALGVFFGLIF 453          
BLAST of EMLSAG00000005382 vs. GO
Match: - (symbol:SCARB2 "Lysosome membrane protein 2" species:9606 "Homo sapiens" [GO:0004872 "receptor activity" evidence=IEA] [GO:0005515 "protein binding" evidence=IPI] [GO:0005765 "lysosomal membrane" evidence=ISS;IDA] [GO:0006622 "protein targeting to lysosome" evidence=IMP] [GO:0007155 "cell adhesion" evidence=IEA] [GO:0016020 "membrane" evidence=TAS] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0019899 "enzyme binding" evidence=IPI] [GO:0043202 "lysosomal lumen" evidence=ISS] [GO:0070062 "extracellular vesicular exosome" evidence=IDA] InterPro:IPR002159 InterPro:IPR005429 Pfam:PF01130 PRINTS:PR01609 PRINTS:PR01611 GO:GO:0016021 GO:GO:0070062 GO:GO:0005765 GO:GO:0004872 GO:GO:0007155 EMBL:CH471057 GO:GO:0043202 GO:GO:0006622 eggNOG:NOG257244 HOGENOM:HOG000252951 OrthoDB:EOG79SDWX TreeFam:TF317925 PANTHER:PTHR11923 Orphanet:308 Orphanet:77259 EMBL:D12676 EMBL:BT006939 EMBL:AK296519 EMBL:AK313016 EMBL:AC034139 EMBL:AC110795 EMBL:BC021892 PIR:A56525 RefSeq:NP_001191184.1 RefSeq:NP_005497.1 UniGene:Hs.349656 PDB:4F7B PDBsum:4F7B ProteinModelPortal:Q14108 SMR:Q14108 BioGrid:107388 IntAct:Q14108 MINT:MINT-4054592 STRING:9606.ENSP00000264896 PhosphoSite:Q14108 DMDM:2498525 PaxDb:Q14108 PeptideAtlas:Q14108 PRIDE:Q14108 DNASU:950 Ensembl:ENST00000264896 Ensembl:ENST00000452464 GeneID:950 KEGG:hsa:950 UCSC:uc003hju.2 CTD:950 GeneCards:GC04M077079 HGNC:HGNC:1665 HPA:CAB015415 HPA:HPA018014 MIM:254900 MIM:602257 neXtProt:NX_Q14108 Orphanet:163696 PharmGKB:PA35038 HOVERGEN:HBG106707 InParanoid:Q14108 KO:K12384 OMA:LNESVHI PhylomeDB:Q14108 ChiTaRS:SCARB2 GeneWiki:SCARB2 GenomeRNAi:950 NextBio:3952 PRO:PR:Q14108 ArrayExpress:Q14108 Bgee:Q14108 CleanEx:HS_SCARB2 Genevestigator:Q14108 Uniprot:Q14108)

HSP 1 Score: 169.859 bits (429), Expect = 1.157e-44
Identity = 152/524 (29.01%), Postives = 238/524 (45.42%), Query Frame = 0
Query:   27 HILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENL-MEQNSRYLSY--GKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFS-MSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFR--LIPMFWADEGAELDSEKAEELNNVLFSAITIGNT--VGIALGYVVGPIL 541
             +    +   I + + LR GTE F+++++PP PVY  +  F++ N  E++RGE P + EVGPY+YRE   K N+    N   +S    K   FE D++          +  P  K D I  +N  +LT+      +  +      EII      L    + LF+T  VD++L+ G+  +           ++ L+ V +                    ISP       F  F  KN T   +Y  +  G     +F  IVE+NGK  L    W      IT +       C+ I GTDG  F P +   K   L++F  + CR++Y+ F S+ E   G+ A+RY V   + +  S+   FC  +                  CL    GV++VS C  GAPI MS PHF QAD+   + ++G+ PN E H T++DI P  G  L+A K+ QIN+ ++K   +D   +  D R  + P+ + +E   +D E A  L +++ + + I N   + +ALG   G + 
Sbjct:   27 RVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQS----------VGDP--KIDLIRTLNIPVLTV------IEWSQVHFLREIIE---AMLKAYQQKLFVTHTVDELLW-GYKDE-----------ILSLIHVFRPD------------------ISPY------FGLFYEKNGTNDGDYVFL-TGEDSYLNFTKIVEWNGKTSL--DWW------ITDK-------CNMINGTDGDSFHPLI--TKDEVLYVFPSDFCRSVYITF-SDYESVQGLPAFRYKVPAEILANTSDNAGFCIPE----------------GNCLGS--GVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKK---LDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTLIITNIPYIIMALGVFFGLVF 453          
BLAST of EMLSAG00000005382 vs. GO
Match: - (symbol:SCARB2 "Uncharacterized protein" species:9913 "Bos taurus" [GO:0004872 "receptor activity" evidence=IEA] [GO:0005765 "lysosomal membrane" evidence=IEA] [GO:0006622 "protein targeting to lysosome" evidence=IEA] [GO:0007155 "cell adhesion" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0019899 "enzyme binding" evidence=IEA] [GO:0043202 "lysosomal lumen" evidence=IEA] InterPro:IPR002159 InterPro:IPR005429 Pfam:PF01130 PRINTS:PR01609 PRINTS:PR01611 GO:GO:0016021 GO:GO:0005765 GO:GO:0004872 GO:GO:0007155 GO:GO:0043202 GO:GO:0006622 eggNOG:NOG257244 GeneTree:ENSGT00530000062927 HOGENOM:HOG000252951 OrthoDB:EOG79SDWX TreeFam:TF317925 PANTHER:PTHR11923 CTD:950 HOVERGEN:HBG106707 KO:K12384 EMBL:DAAA02018135 EMBL:DAAA02018136 EMBL:BC149935 RefSeq:NP_001095623.1 UniGene:Bt.11224 STRING:9913.ENSBTAP00000014549 Ensembl:ENSBTAT00000014549 GeneID:533177 KEGG:bta:533177 InParanoid:A6QQP4 OMA:YLNESAL NextBio:20875943 Uniprot:A6QQP4)

HSP 1 Score: 169.474 bits (428), Expect = 1.325e-44
Identity = 156/527 (29.60%), Postives = 245/527 (46.49%), Query Frame = 0
Query:   24 LKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENL-MEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKA--EDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFS-MSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFR--LIPMFWADEGAELDSEKAEELNNVLFSAITIGNT--VGIALGYVVGPIL 541
            L   +    +   I +N+ LR G+E F+++K+PP PVY  +  F++ N  E++ GE P L EVGPY+YRE   K+++    N   +S      + F+   +        +  P  K D +  +N   LT A +   LP  ++DI         EAL +KA  + LF+T  VD++L+ G+  +   I   ++TF                     D       +SP       F  F GKN T   +Y  +  G  +  +F  IVE+NGK            TS+    + E   C+ I GTDG  F P +   +   L++F  + CR++Y+ F S+ E   G+ A RY V   + +  S+   FC  +                  CL    GV++VS C  GAPI MS PHF QAD++  + + G+ PN E H T++DI P  G  LRA K+ QIN+ +RK   +D   +  + +  + P+ + +E   +D E A  L +V+ + + + N   + +ALG   G I 
Sbjct:   24 LVARVFQKAVDQTIEKNIVLRNGSETFDSWKKPPLPVYTQFYFFNVTNPEEILNGETPRLEEVGPYTYRELRNKDDIQFGDNGTTISAVSNKAYVFERDKS--------VGDP--KIDLLRTLNIPALT-AMEWTQLP-LLRDII--------EAL-LKAYRQKLFVTHTVDELLW-GYKDE---ILSLINTF-------------------KHD-------VSPY------FGLFYGKNGTNDGDYVFL-TGEDNYLNFSKIVEWNGK------------TSLDWWTADE---CNMINGTDGDTFHPLI--TRDEVLYVFPSDFCRSVYITF-SDFESVQGLPALRYKVPAEILANTSDNAGFCIPK----------------GNCLGS--GVLNVSVCKNGAPIIMSFPHFYQADEKFVSAIGGMHPNKEYHETFVDINPLTGIILRAAKRFQINVYVRK---LDDFVETGNIQTLVFPVMYINESVLIDKETASRLKSVINTTLIVTNIPYIIMALGVFFGLIF 453          
BLAST of EMLSAG00000005382 vs. GO
Match: - (symbol:wu:fi18e02 "wu:fi18e02" species:7955 "Danio rerio" [GO:0004872 "receptor activity" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] [GO:0005764 "lysosome" evidence=IEA] [GO:0007155 "cell adhesion" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR002159 InterPro:IPR005429 Pfam:PF01130 PRINTS:PR01609 PRINTS:PR01611 ZFIN:ZDB-GENE-030131-5789 GO:GO:0016021 GO:GO:0004872 GO:GO:0007155 GO:GO:0005764 GeneTree:ENSGT00530000062927 OrthoDB:EOG79SDWX TreeFam:TF317925 PANTHER:PTHR11923 EMBL:CABZ01057156 EMBL:CABZ01057157 EMBL:CABZ01057158 EMBL:CABZ01057159 Ensembl:ENSDART00000130648 OMA:QTFADIN Uniprot:F1QSM7)

HSP 1 Score: 167.933 bits (424), Expect = 5.315e-44
Identity = 142/548 (25.91%), Postives = 255/548 (46.53%), Query Frame = 0
Query:   11 GLLSIVLIIGGISLKM-HILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRE--TMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMS--NPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSFYQR 553
            G L ++L+I GI+L++  +L  ++ + + + + L  GTE F+ ++ PP PVY+ +  F++ N  EV+ G+ P ++++GPY+YRE   M +   M+  +R  +    T + F+   +             S++D +  +N   +T+ +K          I   +I++  +A G+    +F T  V  +L+ G++          D  L        + L + +P                   +  F  F  KN T+  +Y  +  G+ D + F +I E+NG+  L    W           SSE   C+ I GTDG  F P +    +  L++F  +LC   +  +E +V V+G +  +R+     VFS    NP+N  +C     C                   G+++ S C   PI MS PHF QAD++    + G++P  E+H T+ DI P  G  L+  K++Q+N+ L++ +      K+    + P+ + +E A +D E A++L+ V+ +A  + N   I +   VG +L I+ I+L   Q+
Sbjct:   10 GALCVLLLICGIALELTRVLQKLVNNTVKQQIVLENGTEAFSVWQNPPPPVYMQFYFFNLTNPAEVMSGDKPSVVQIGPYTYREYRPMEEVKFMDNGTRVAAINPKT-YVFEPNMSRG-----------SQDDLVRTVNIPAVTVMEKYK------DSILARLISDLMKAKGVG---VFETFRVGDLLW-GYE----------DPLL--------KELHMLVP-------------------DDHFGLFYKKNGTEYDSYVLL-TGKPDYQDFASIDEWNGQRSL---NW----------WSSE--ECNMINGTDGASFHPIITKADR--LYIFSSDLCSHTHCIYECDVSVQG-VPGFRFVPPADVFSSPDINPDNAGFCVPPGHCLGS----------------GLLNASVC--TPIIMSSPHFYQADQKFVDDIWGMKPIKEEHQTFADINPLTGIVLQGAKRVQVNVYLQQHSSFSQTGKIQTL-VFPVMYINESAFIDEESAKKLHAVVLNANVVINIPFIVIS--VGILLGIIFIVLMCRQQ 458          
BLAST of EMLSAG00000005382 vs. C. finmarchicus
Match: gi|592863402|gb|GAXK01094160.1| (TSA: Calanus finmarchicus comp48559_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 301.212 bits (770), Expect = 2.823e-92
Identity = 202/599 (33.72%), Postives = 314/599 (52.42%), Query Frame = 0
Query:   25 KMHILPAMIKSQIYENLDLRE-GTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEP-PVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVK---DICFEIINNGNEALGIKA----------------------------EDLFITEEVDKILYTGFDSK--SAAIFDKLDTFLM-------------LLLEVIQESL------ELDIPIKAKDF-ENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQXXXXXXXXXXXXXWMFVGELCRTIYXXXXXXXXXXGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQT-DNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSE---KAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILS-------FYQRYREK 557
            K  I PA++ + I  +L+L E  TE ++A+KEPP   ++ ++ F++ N  EV  G   P + EVGP+SYRE   K N++      +S+G Y  +EFDE  +    C       C  + +IT+INPV++ ++  L+ +  T     DI F   +N   ++ + A                            +D+F+T   D +++ G DS    A  F   DT ++             +LL V+Q  +      +LD  +    F  N+++I     L +GTF FFKG NATK  +++ I +G++D E++  ++EF+G  +LP++ W N   + +   S   G CH I GTDG  + P +        W+F  +LCR+I++ FE EV+++G I  Y++     VFSMSNP N+CYC     CA    +ND WD+S C  C DG++ +  C GAP+ MS PH+L  D  +   + G+EP+ EKH TYL++EP  G PL+AHK+IQI++ +      D LKK A   + P+ W DEGA++D E   KA+ L    F A+ IG+ V I  G V     L++S+IL        FY  +++K
Sbjct:    3 KWGIFPAVVDAMIKSSLELTEDNTETWDAWKEPPITPFMKFTFFNVSNPKEVKAGTAKPNVTEVGPFSYREVREKTNILSIQDE-ISFGSYIHYEFDEEES----CST-----CKIDTEITVINPVMVIVSSLLEDIHNTEWPDIDIPFTKPDNTTSSIKLDALVEAVLIFIHAPLNAFIKCEADIFADYCDDMFLTGTPDNMIFQGTDSGVLKALWFWITDTTVLPDVFPFPGGSLPTVLLHVLQALIPNDTFIDLDSVVDMIHFILNLVEIPPLIDLEQGTFGFFKGTNATK--SWWKINSGKYDLENYNKVLEFDGMTRLPDSWWDNFGPTPSANKSGVPGICHDIIGTDGMAYSPSVDKDADV--WLFNDQLCRSIWLSFEKEVDIKG-IKTYQFSPDPSVFSMSNPNNYCYCPNVEKCAVAVPENDTWDMSGCDMCIDGLLSLQGCQGAPVIMSTPHYLDGDPMLAEAIDGIEPDREKHVTYLNLEPMTGMPLQAHKRIQISVPVFPSTYFDCLKK-AKQVVFPLVWVDEGADIDDENIKKAKGLLVTPFLAVDIGSGVMIGAGGV-----LLISVILHSIFGKK*FYADFQKK 1736          
BLAST of EMLSAG00000005382 vs. C. finmarchicus
Match: gi|592863401|gb|GAXK01094161.1| (TSA: Calanus finmarchicus comp48559_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 291.197 bits (744), Expect = 1.365e-88
Identity = 199/597 (33.33%), Postives = 311/597 (52.09%), Query Frame = 0
Query:   25 KMHILPAMIKSQIYENLDLRE-GTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEP-PVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLL---TLADKLDGLPKTVKDICF-----------------EIINNGNEALGIK-----------------AEDLFITEEVDKILYTGFDSK--SAAIFDKLDT---------FLMLLLEVIQESLELDIPIKAKDFENIIK--IISP-AQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQXXXXXXXXXXXXXWMFVGELCRTIYXXXXXXXXXXGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQT-DNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSE---KAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILS-------FYQRYREK 557
            K  I PA++ + I  +L+L E  TE ++A+KEPP   ++ ++ F++ N  EV  G   P + EVGP+SYRE   K N++      +S+G Y  +EFDE  +    C +     C  + +IT+INPV++   +L + + G+     +I                   ++INN  +AL                     +D+F+    D +++ G DS    +  F   DT            LLL +  ++ ++ +    K  E++I    I P   L +G F FFKG NATK  +++ I +G++D E++  ++EF+G  +LP++ W N   + +   S   G CH I GTDG  + P +        W+F  +LCR+I++ FE EV+++G I  Y++     VFSMSNP N+CYC     CA    +ND WD+S C  C DG++ +  C GAP+ MS PH+L  D  +   + G+EP+ EKH TYL++EP  G PL+AHK+IQI++ +      D LKK A   + P+ W DEGA++D E   KA+ L    F A+ IG+ V I  G V     L++S+IL        FY  +++K
Sbjct:    3 KWGIFPAVVDAMIKSSLELTEDNTETWDAWKEPPITPFMKFTFFNVSNPKEVKAGTAKPNVTEVGPFSYREVREKTNILSIQDE-ISFGSYIHYEFDEEES----CPD-----CKIDTEITVINPVMVIVSSLMEDIHGIEWPHINITIPPIPALNFDGLELGPLEDLINNNLDALARDLNNLILCDNEVLVEMGLCDDMFLKGTPDNMVFQGTDSGILKSVWFYLTDTQYGIGLPYKLYALLLVLFPDNPDITLESAGKMIEDLIAQLPIPPLIDLEQGKFGFFKGTNATK--SWWKINSGKYDLENYNKVLEFDGMTRLPDSWWDNFGPTPSANKSGVPGICHDIIGTDGMAYSPSVDKDADV--WLFNDQLCRSIWLSFEKEVDIKG-IKTYQFSPDPSVFSMSNPNNYCYCPNVEKCAVAVPENDTWDMSGCDMCIDGLLSLQGCQGAPVIMSTPHYLDGDPMLAEAIDGIEPDREKHVTYLNLEPMTGMPLQAHKRIQISVPVFPSTYFDCLKK-AKQVVFPLVWVDEGADIDDENIKKAKGLLVTPFLAVDIGSGVMIGAGGV-----LLISVILHSIFGKK*FYADFQKK 1730          
BLAST of EMLSAG00000005382 vs. C. finmarchicus
Match: gi|592863399|gb|GAXK01094163.1| (TSA: Calanus finmarchicus comp48559_c0_seq4 transcribed RNA sequence)

HSP 1 Score: 230.72 bits (587), Expect = 1.313e-68
Identity = 139/363 (38.29%), Postives = 208/363 (57.30%), Query Frame = 0
Query:  210 LDTFLMLLLEVIQES---LELDIPIKAKDFENIIKIISP-AQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQXXXXXXXXXXXXXWMFVGELCRTIYXXXXXXXXXXGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQT-DNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSE---KAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILS-------FYQRYREK 557
            L T LM +L+ +  +   +++D  +   DF   +  I P   L EG F FFKG NATK  +++ I +G++D E++  ++EF+G  +LP++ W N   + +   S   G CH I GTDG  + P +        W+F  +LCR+I++ FE EV+++G I  Y++     VFSMSNP N+CYC     CA    +ND WD+S C  C DG++ +  C GAP+ MS PH+L  D  +   + G+EP+ EKH TYL++EP  G PL+AHK+IQI++ +      D LKK A   + P+ W DEGA++D E   KA+ L    F A+ IG+ V I  G V     L++S+IL        FY  +++K
Sbjct:    3 LPTVLMNVLQTLAPNDPFIDIDSVVAMIDFILDLAEIPPLIDLEEGKFGFFKGTNATK--SWWKINSGKYDLENYNKVLEFDGMTRLPDSWWDNFGPTPSANKSGVPGICHDIIGTDGMAYSPSVDKDADV--WLFNDQLCRSIWLSFEKEVDIKG-IKTYQFSPDPSVFSMSNPNNYCYCPNVEKCAVAVPENDTWDMSGCDMCIDGLLSLQGCQGAPVIMSTPHYLDGDPMLAEAIDGIEPDREKHVTYLNLEPMTGMPLQAHKRIQISVPVFPSTYFDCLKK-AKQVVFPLVWVDEGADIDDENIKKAKGLLVTPFLAVDIGSGVMIGAGGV-----LLISVILHSIFGKK*FYADFQKK 1058          
BLAST of EMLSAG00000005382 vs. C. finmarchicus
Match: gi|592863400|gb|GAXK01094162.1| (TSA: Calanus finmarchicus comp48559_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 230.72 bits (587), Expect = 1.442e-68
Identity = 139/363 (38.29%), Postives = 208/363 (57.30%), Query Frame = 0
Query:  210 LDTFLMLLLEVIQES---LELDIPIKAKDFENIIKIISP-AQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQXXXXXXXXXXXXXWMFVGELCRTIYXXXXXXXXXXGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQT-DNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSE---KAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILS-------FYQRYREK 557
            L T LM +L+ +  +   +++D  +   DF   +  I P   L EG F FFKG NATK  +++ I +G++D E++  ++EF+G  +LP++ W N   + +   S   G CH I GTDG  + P +        W+F  +LCR+I++ FE EV+++G I  Y++     VFSMSNP N+CYC     CA    +ND WD+S C  C DG++ +  C GAP+ MS PH+L  D  +   + G+EP+ EKH TYL++EP  G PL+AHK+IQI++ +      D LKK A   + P+ W DEGA++D E   KA+ L    F A+ IG+ V I  G V     L++S+IL        FY  +++K
Sbjct:    3 LPTVLMNVLQTLAPNDPFIDIDSVVAMIDFILDLAEIPPLIDLEEGKFGFFKGTNATK--SWWKINSGKYDLENYNKVLEFDGMTRLPDSWWDNFGPTPSANKSGVPGICHDIIGTDGMAYSPSVDKDADV--WLFNDQLCRSIWLSFEKEVDIKG-IKTYQFSPDPSVFSMSNPNNYCYCPNVEKCAVAVPENDTWDMSGCDMCIDGLLSLQGCQGAPVIMSTPHYLDGDPMLAEAIDGIEPDREKHVTYLNLEPMTGMPLQAHKRIQISVPVFPSTYFDCLKK-AKQVVFPLVWVDEGADIDDENIKKAKGLLVTPFLAVDIGSGVMIGAGGV-----LLISVILHSIFGKK*FYADFQKK 1058          
BLAST of EMLSAG00000005382 vs. C. finmarchicus
Match: gi|592884670|gb|GAXK01073705.1| (TSA: Calanus finmarchicus comp2078499_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 187.193 bits (474), Expect = 1.707e-51
Identity = 139/490 (28.37%), Postives = 226/490 (46.12%), Query Frame = 0
Query:   25 KMHILPAMIKSQIYENLDLREGTEGFN--AFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNS-RYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQXXXXXXXXXXXXXWMFVGELCRTIYXXXXXXXXXXGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCA-KQTDNDEWDLSQCL-KCKDGVMDVSACYGA-PIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELD 508
            K  + P + ++Q+ +NL L  GT  +   A ++   P +  ++ F+  N  E   G+ P+L EVGP++YR    K N+   +  R LSYG   +F FD+  +    C++     C  + ++T++N  LL + D +      +  +   ++N   +  G   +D+FI+  V+ +L+ GF + S          LM L +        + P                QL  G        N     N++ +  G+ DK  +  I  FNG+ +LP+  W +   + +   S   G CH IYGTD +Q    L   +    W F  ELCR+ +    +      GI A RY +   V      EN CYC     C     +ND W++ +C  KC  G +++S C G   I +S+PHFL  +  +Q+ + GL P+  KH +Y+ + P  G  L  H KIQIN+ L + + + LL+KV    L P+ W D   ++D
Sbjct:   63 KWAVFPPLYQAQVDKNLKLEPGTMAYKKWAGEDLSVPGFKKFTFFNFTNPEETKAGKKPILKEVGPFTYRRQETKTNIHSPDGGRSLSYGLNREFVFDKEES----CRD-----CFADTEVTVVNFALLIVMDMIKQSNNPLAGLLPTLLNAAIQR-GKYKDDIFISVPVEDLLFHGFSTGS----------LMFLHD--------NFP----------------QLGVGNTTSL---NENGTINWFNMNTGKVDKSKYTQIELFNGEPELPDNYWKSCGPTPSANQSGFYGKCHDIYGTDASQQKGNLHASQI---WTFNDELCRS-FPMEFTGNLKVMGIPAARYEISDSVMDNQLEENLCYCPYIEECVIADPENDSWNVKECEEKCPKGTLNLSGCKGGQAIIVSKPHFLHGNPSLQSAISGLSPDQSKHQSYVHLNPVTGVSLSGHFKIQINVPLEQNSQLALLRKVHSL-LFPVVWFDLCGDVD 1376          
BLAST of EMLSAG00000005382 vs. C. finmarchicus
Match: gi|592798960|gb|GAXK01155608.1| (TSA: Calanus finmarchicus comp104175_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 151.754 bits (382), Expect = 7.988e-39
Identity = 123/452 (27.21%), Postives = 219/452 (48.45%), Query Frame = 0
Query:   58 APVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAED-LFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYT--IENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQXXXXXXXXXXXXXWMFVGELCRTIYXXXXXXXXXXGGITAYRYGVGKRVFSMSNPENFCYCQEFF-SCAKQTDN-DEWDLSQC--LKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWAD 502
            A   +S + F++ N +E+I GE P++ + GPY YRE   K N  EQ    L++G+Y +++FD     ++ C+      CS++D++ I+N  L+ +  +       +  +   ++     AL  + +D LF    V  +L++G    +  I +    FLM    + Q  L                   P Q+ E  FA F GKNAT   ++YT  I    +  +++    +   ++      WP   TS  G++S  G SC+ + GTDG+Q+   +    +   W F  ++CR+ Y  F+ + +     +   +        ++   NFC+C     SC   +D+ D  DL+ C    CKDG++DV ACY +P+ +S P+F  A+ ++  +   + P+ E+  + + ++ + GT  +A  K+QINM + K   I +L+KVAD  + P+ W +
Sbjct:  130 AEYTMSINFFNVDNPDEIIAGELPLISQRGPYVYREERMKIN-EEQEGDMLNFGEYKEYKFDS----EMSCEG-----CSEDDEMRILNLPLIGVVQECLNQGSIIGSVLCGLVE---AALNGEFQDELFFKHSVGDLLFSGV---ATGIVE----FLMTNA-LTQNRL-------------------PPQIQENGFALFNGKNATSDNSWYTLDISTASYGIQAWGPTEDDKHEDLGFTKWWPEPDTS--GEVS--GSSCNLLTGTDGSQYQAGISEDTEL--WHFSPDICRSTYFTFDHQDQ--ADPSNLVFSTPANGLHVNRTRNFCFCPSLEPSCYLPSDDPDVLDLTNCDLQDCKDGMLDVHACYQSPVILSNPNFYLAEHQLDNFQGTILPDKERDESRITVDRDTGTVTKAENKLQINMPIVKHPKITILQKVADI-VFPVIWVN 1338          
BLAST of EMLSAG00000005382 vs. C. finmarchicus
Match: gi|592768285|gb|GAXK01186283.1| (TSA: Calanus finmarchicus comp44521_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 132.109 bits (331), Expect = 2.229e-31
Identity = 132/500 (26.40%), Postives = 216/500 (43.20%), Query Frame = 0
Query:   32 MIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRG-EPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIIN-PVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQN--YYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQXXXXXXXXXXXXXWMFVGELCRTIYXXXXXXXXXXGGITAYRYGVGKRVF--SMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC-YGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAIT 524
            +++S I + L L   ++ F+ +++PP   +L    F++ N +EV  G + P L+EVGPY+YR+   K+N+   ++  +SY     F F ++ +    C + +       D +T +N P +       +    T   +   +       LG K    ++T+ V  +L+ G+D     +F    TFL                   KD         P       F  F  KN++K  +   Y++  G  +  +  NI  FNG  +L    W                 C+R++G+DG  F P++        W F  +LCR +          + G+   R+   K VF    S PEN C+            N E          DGV DV+ C +  PI +S PHFL A+++    V+GL+P+ +KH  + DI+   GT L A  +IQINM ++K+     L  + D  +IP+ W +EG +   +   +L NVL  A T
Sbjct: 1135 LVRSLILKKLVLSNTSDTFHIWEDPPINPHLKVYFFNMTNPDEVFNGIDKPRLVEVGPYTYRQQWLKQNITWHDNGTISYKTRKIFTFVQSESCP-TCNDVL-------DNVTTLNVPAISAYYQSRNAPFYTTWSLSGLVW-----GLGYKP---WVTQTVHDLLW-GYDE---PLFSVAQTFL-------------------KD---------PPPFDR--FGLFLLKNSSKESDLGMYSMYTGEGNPYTLSNIQSFNGNQQL--KFW-------------NSSDCNRVHGSDGASFNPYIKKGDTL--WFFNDQLCRAL-PMVYDRSITQEGLPGLRFIPRKDVFMSEKSYPENSCFAGP---------NRE--------TGDGVFDVTVCQFDTPIVLSWPHFLNAEEKYSKAVEGLKPDPQKHGFWFDIQDVTGTTLSAKARIQINMNVKKLKNFSHLSSIND-TVIPILWFEEGID---QLGTDLINVLKQAAT 2367          
BLAST of EMLSAG00000005382 vs. C. finmarchicus
Match: gi|592768286|gb|GAXK01186282.1| (TSA: Calanus finmarchicus comp44521_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 132.109 bits (331), Expect = 2.409e-31
Identity = 132/500 (26.40%), Postives = 216/500 (43.20%), Query Frame = 0
Query:   32 MIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRG-EPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIIN-PVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQN--YYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQXXXXXXXXXXXXXWMFVGELCRTIYXXXXXXXXXXGGITAYRYGVGKRVF--SMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC-YGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAIT 524
            +++S I + L L   ++ F+ +++PP   +L    F++ N +EV  G + P L+EVGPY+YR+   K+N+   ++  +SY     F F ++ +    C + +       D +T +N P +       +    T   +   +       LG K    ++T+ V  +L+ G+D     +F    TFL                   KD         P       F  F  KN++K  +   Y++  G  +  +  NI  FNG  +L    W                 C+R++G+DG  F P++        W F  +LCR +          + G+   R+   K VF    S PEN C+            N E          DGV DV+ C +  PI +S PHFL A+++    V+GL+P+ +KH  + DI+   GT L A  +IQINM ++K+     L  + D  +IP+ W +EG +   +   +L NVL  A T
Sbjct: 1135 LVRSLILKKLVLSNTSDTFHIWEDPPINPHLKVYFFNMTNPDEVFNGIDKPRLVEVGPYTYRQQWLKQNITWHDNGTISYKTRKIFTFVQSESCP-TCNDVL-------DNVTTLNVPAISAYYQSRNAPFYTTWSLSGLVW-----GLGYKP---WVTQTVHDLLW-GYDE---PLFSVAQTFL-------------------KD---------PPPFDR--FGLFLLKNSSKESDLGMYSMYTGEGNPYTLSNIQSFNGNQQL--KFW-------------NSSDCNRVHGSDGASFNPYIKKGDTL--WFFNDQLCRAL-PMVYDRSITQEGLPGLRFIPRKDVFMSEKSYPENSCFAGP---------NRE--------TGDGVFDVTVCQFDTPIVLSWPHFLNAEEKYSKAVEGLKPDPQKHGFWFDIQDVTGTTLSAKARIQINMNVKKLKNFSHLSSIND-TVIPILWFEEGID---QLGTDLINVLKQAAT 2367          
BLAST of EMLSAG00000005382 vs. C. finmarchicus
Match: gi|592782573|gb|GAXK01171995.1| (TSA: Calanus finmarchicus comp62738_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 126.331 bits (316), Expect = 6.947e-30
Identity = 131/474 (27.64%), Postives = 193/474 (40.72%), Query Frame = 0
Query:   41 LDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLA----DKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQN-YYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQXXXXXXXXXXXXXWMFVGELCRTIYXXXXXXXXXXGGITAYRYGVGKRVFS--MSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC-YGAPIFMSQPHFLQADKE-VQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGA 505
            L L   +  F  ++E PAP+  S  LF++ N  EV  G  P L EVGPY + E   K  L    +  ++Y +   + F    +             S +D +TI+N V  TL       + G+ +   D+            GIK E LF+T+ V +I++ G+      +FD L+  + LL                      I+ + P       FAFF G+N T   +  + +  G  D      +  +N               S TG      G C ++ G  G  +PP L         MF  +LCRT+     +   +  GI +Y Y   K  F+    NP N CY                   Q +    GV + S C +GAP+F+SQPHF  AD   +    KG+ PNS  H TY  IEP  G P     + Q+N+++ KV+GI +LK V      P+ W +  A
Sbjct:  215 LVLSPVSGSFPMWQELPAPMLASMYLFNVLNPVEVSAGAKPELEEVGPYVFTEQHDKVRLNWNENGTVTYRQVRTWHFVPELSKG-----------SLDDNVTIVNSVAATLGYMIEQNVAGIWRPAVDVFLR---------GIK-EKLFVTKTVREIIFDGYHD---PLFDNLEEIMELL--------------------PFIRKMVPEGSVMDKFAFFYGRNGTDYTDGVFNMFTGAGDSTKMGQVHSWN--------------YSTTGFFP---GQCGQVRGGAGEFYPPGLEKTYIE---MFSNDLCRTL-RFNFNTELMVKGINSYEYTADKSFFANGTENPLNACYE-----------------PQNVFLPSGVYNTSICRFGAPVFVSQPHFYLADPYYLDMIAKGMSPNSTLHNTYFRIEPRAGVPTDVTARFQLNVLVDKVSGISMLKDVTK-TYFPVMWFENKA 1387          
BLAST of EMLSAG00000005382 vs. C. finmarchicus
Match: gi|592861190|gb|GAXK01096372.1| (TSA: Calanus finmarchicus comp54192_c3_seq1 transcribed RNA sequence)

HSP 1 Score: 119.398 bits (298), Expect = 1.868e-27
Identity = 137/545 (25.14%), Postives = 226/545 (41.47%), Query Frame = 0
Query:   30 PAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSR--YLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDK----ITIINPVLL-----------TLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVI--------------QESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQXXXXXXXXXXXXXWMFVGELCRTIYXXXXXXXXXXGGITAYRY-----GVGKRV---FSMSNPENFCYC--QEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC-------YGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIG 526
            P M++ +I + + L  G++   ++  PP    L+   FH+ N   V++GE PVL EVGP+ Y+    K+++ +Q++R  +L Y      E  ET T++ +    ++   S  D     ITI N  LL           T A K+  + KT     F  IN     L     D      + +    G       IF           +                +++ +  + ++  DF ++ +  +     +  +  F+ +N T L+    I +G  D      + EF+              +S T      G  C ++ G D +  PP     +     MF+  +CR I + +E + E  G +T+YR+      +G       +  NP+N C+C  +E FSC K                 GV ++  C        GAPI +S PHF +AD+     V+GL+P  E H  Y+D+ P  G PL    + Q+N ++RK   ID++    D  ++P  WA +G    SE +EE+     SAI  G
Sbjct:  227 PGMLEKKILQTMALAPGSDRLQSWLVPPVQAALTGYGFHVTNPEAVMQGEKPVLEEVGPFVYKAVTVKDSV-DQDTRKDHLEYN-----EDGETLTYRPRKFYFLDREQSAGDPDTTFITIPNVPLLTGFKKIRDAGWTKATKVGVIKKTGLGTPF--INVSFTGLLWGYHDELPCLSLARPAECGLAEGEVDIFAGDGGDDDEWGDGGDDWKRKKRETGRYKRDAEDESVDLRDADFASMFRPKAEIVDCKCQWGLFRDRNVT-LRKPLKIHHGMADLSKKGLVEEFD--------------SSPTMNWWKPGSECDKLGGQDSSTLPPGWERTQSMD--MFISLMCRRIKLVYEKDTEHLG-LTSYRFIPPPNAMGSHTDPDPAKHNPDNSCFCLKEEGFSCFKS----------------GVFNMEPCKRTPELPLGAPIALSYPHFYEADQSFLDAVEGLKPVKEDHQFYVDVLPEFGFPLAIRPRFQLNAIIRKDEDIDVMSNFVDELVLPFLWAQDGF---SEPSEEMA----SAIKFG 1714          
BLAST of EMLSAG00000005382 vs. L. salmonis peptides
Match: EMLSAP00000005382 (pep:novel supercontig:LSalAtl2s:LSalAtl2s28:642972:644719:-1 gene:EMLSAG00000005382 transcript:EMLSAT00000005382 description:"maker-LSalAtl2s28-augustus-gene-6.15")

HSP 1 Score: 1149.81 bits (2973), Expect = 0.000e+0
Identity = 559/559 (100.00%), Postives = 559/559 (100.00%), Query Frame = 0
Query:    1 MILYSIRVILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSFYQRYREKRA 559
            MILYSIRVILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSFYQRYREKRA
Sbjct:    1 MILYSIRVILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSFYQRYREKRA 559          
BLAST of EMLSAG00000005382 vs. L. salmonis peptides
Match: EMLSAP00000006620 (pep:novel supercontig:LSalAtl2s:LSalAtl2s364:511929:513356:-1 gene:EMLSAG00000006620 transcript:EMLSAT00000006620 description:"maker-LSalAtl2s364-augustus-gene-5.23")

HSP 1 Score: 139.043 bits (349), Expect = 3.468e-36
Identity = 101/313 (32.27%), Postives = 155/313 (49.52%), Query Frame = 0
Query:  253 FAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFS--MSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC-YGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTV---GIALGYVVGPILLIVSIILSFYQRYREKRA 559
            F    GKN +     + I +G  +  +   I+ F GK+KL    W              G  C+ I GTDGT FPP     K   L++F  +LC+++ + FE E+ +   I  YRY     VFS    NP N C+C     C  Q               DG+M++S C Y +PI +S PHF QA+  +   V+GL P+ EKH  Y+DI+P LG+  RA  + QIN+ +  + G+    K+    + P+ W DEG  LD  K EE+ N+L  A+ +   +   G      +G +L+I+S+++ F++R+  + A
Sbjct:  116 FGILIGKNGST-SGKFKIHSGVDNLSNLGEIMSFRGKDKL--DVW-------------SGDQCNAIRGTDGTIFPPGFAKNKT--LYVFSPDLCQSLPLVFEKEI-ITNDIPGYRYIPPSNVFSGPAKNPRNKCFCDXKNKCMAQ---------------DGLMNISPCQYNSPIIISWPHFYQANPNLLNEVEGLNPDPEKHQFYIDIQPKLGSGXRAAXRSQINIAVTPMEGVGDSSKLRK-GVFPLIWVDEG--LDEIKNEEVLNLLNMAVNLPTGIKKFGAPTTIFIGVLLIIISLLMLFHRRHNNRVA 391          
BLAST of EMLSAG00000005382 vs. L. salmonis peptides
Match: EMLSAP00000009073 (pep:novel supercontig:LSalAtl2s:LSalAtl2s56:118096:129666:1 gene:EMLSAG00000009073 transcript:EMLSAT00000009073 description:"augustus_masked-LSalAtl2s56-processed-gene-1.0")

HSP 1 Score: 140.969 bits (354), Expect = 6.206e-36
Identity = 92/303 (30.36%), Postives = 144/303 (47.52%), Query Frame = 0
Query:  253 FAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSN--PENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC-YGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEG-AELDSEKAEELNNVLFSAITIGNTV-GIALGYVVGPILLIVSIILSF 550
            F FF  KN +   + YT+  G  +      I  FNGK+ L    W N               C+ + G+DG+ F P++   K   LW F  +LCR++ + ++ EV +   +  YR+     V+   +  PEN CYC               D + C    DG+  VSAC + API +S PHFL A+   Q+ V+GL P  + H  + DI+P  GT + A  +IQIN+ ++ +     L+KV D  ++P+ W DEG  EL SE  E +   + +     N +  I LG+     ++ +  ++ F
Sbjct:  227 FGFFSAKNDSNDLSTYTMYTGENNPYDLSKISSFNGKSHL--NFWKN-------------DECNLVRGSDGSTFNPYI--SKSDTLWFFNDQLCRSLPLVYDQEV-MSRSLPGYRFKPRYDVYKSPSTVPENDCYCT--------------DQTLCDMIGDGMFAVSACQFDAPIILSWPHFLGANSSYQSSVEGLSPQLDSHGFWFDIQPTTGTTMSARARIQINLAVKNIPAFSQLEKVKDI-IMPILWFDEGIEELGSELTEVIGQAVLTPPIYKNYIFCIFLGFCASTFVIFLVALIRF 496          
BLAST of EMLSAG00000005382 vs. L. salmonis peptides
Match: EMLSAP00000003224 (pep:novel supercontig:LSalAtl2s:LSalAtl2s177:512114:513783:-1 gene:EMLSAG00000003224 transcript:EMLSAT00000003224 description:"maker-LSalAtl2s177-augustus-gene-4.36")

HSP 1 Score: 124.02 bits (310), Expect = 1.292e-30
Identity = 143/562 (25.44%), Postives = 236/562 (41.99%), Query Frame = 0
Query:    8 VILGLLSIVLIIGGISLKMHILPAMIKSQIYEN-----LDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRG-EPPVLLEVGPYSYRETMRKENLMEQN-SRYLSYGKYTKFEFDETNTHKLKCKNRI-NTPCSKNDK-ITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFA-FFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEV-EVEGGITAYRYGVGKRVF---SMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC-YGAPIFMSQPHFLQADKEVQAYVK--GLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEEL---NNVLFSAITIG-NTVGIALGYVV-GPILLIVSII 547
            +I  ++S++ +I GI L      + +K  I+ N     + L+E +     +K+ P P+ L   L+++ N  EV  G E P L E+GP+ +RE   K  +   + +  +SY +   + FD +++  L     I N P +   K    +NP+L   A                        L IK E LF+T+E   I++ G+        D L T                   +A  F        P    +  FA F+K  N+      + I  G    + F  + ++N KN              TG   S  G      G D    PPF  NK++  L ++  +LCR + VE ++   + +  ++ + Y +   +F   S  NP N CY         +  N             GV + S+C +GAPIF+S PHF +AD    +  K   ++PN  KH +YL IEP  G  +  H K Q N+ LR V  I++   + +    P+ W D   ++  E + ++   +N+ F  I  G + + + LG ++ G I L  +I+
Sbjct:    7 IIFFVISVLFLILGIIL------SYLKDDIFRNVFRRFMMLQENSPSIAFWKDIPFPLELKAFLWNVSNPEEVKNGLEAPKLTEIGPFVFREYRNKSGIHWNHLNGTVSYRQTRHWVFDASSSLPLDTLVTILNVPAAAVSKNFFHMNPILRPAASLF--------------------LLAIK-EKLFVTQEAGDIIFNGYK-------DPLLT-------------------EASKFH-------PMPGVQDKFAIFYKRNNSADFDGVFNIYTGELGLDKFGTVAKWNYKNS-------------TGLFPSPCGDLRG--GVD--YLPPFEDNKEE--LEIYSTDLCRPLRVELKNRASKTDSHVSVHEYHLNSTIFYGNSSLNPSNKCY---------EGGN---------SLPSGVFNASSCHFGAPIFISNPHFFEADPFYSSQFKDGSMQPNVSKHESYLKIEPITGLLMEVHIKSQFNVYLRHVPMIEMFSNINN-TYFPIAWFDYSMKVGPEMSLKIWIXSNLPFIFIVAGLSILSLGLGNIILGAIFLRAAIV 470          
BLAST of EMLSAG00000005382 vs. L. salmonis peptides
Match: EMLSAP00000003924 (pep:novel supercontig:LSalAtl2s:LSalAtl2s211:1315307:1318911:1 gene:EMLSAG00000003924 transcript:EMLSAT00000003924 description:"snap_masked-LSalAtl2s211-processed-gene-13.12")

HSP 1 Score: 105.531 bits (262), Expect = 4.269e-24
Identity = 86/343 (25.07%), Postives = 148/343 (43.15%), Query Frame = 0
Query:  222 QESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRY-----GVGKRVFS---MSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC---YGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFR--LIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSFY 551
            Q   E+  P    +++ ++K  +     +  +  F+ +N T L+      +G  D      ++ ++GK +L    W             +G +C ++ G D +  PP L   +   L +F+  +CR I + +E +     GI  YR+      +G  + S   + NP+N CYC          DN E     C K   GV  +  C     AP+ +S PHF QAD      V+GL P  EKH  Y+D+ P  G PL    + Q+N+V   +  +D+  +V D +  ++P  WA +G +  SE   E       A      +   + +++G + ++ S+    Y
Sbjct:  277 QNMKEVQEPNVESEWDKLVKPKAEFMDCKCNWGLFRDRNVT-LRKPIEFMSGISDLSDKGKVLAYDGKTEL--GWW------------KKGSTCDKVRGQDSSTLPPSL--ARDMNLEIFIALMCRPIDLTYEKDTS-HAGIPTYRFIPPINALGSHLDSNKTLQNPDNECYCL-------SGDNYE-----CFK--SGVYSMEPCKRDTNAPLALSYPHFYQADPSFLEGVEGLNPQKEKHEFYMDVVPEFGFPLAIRPRFQLNVV---IGDVDIYDEVRDVKKTVLPFLWAQDGFDEPSEPMAEAIKFGLDAPQKLPMLISVVCFLIGALFILSSVTYFLY 584          
BLAST of EMLSAG00000005382 vs. SwissProt
Match: gi|374253753|sp|Q7Q6R1.5|SNMP2_ANOGA (RecName: Full=Sensory neuron membrane protein 2)

HSP 1 Score: 182.185 bits (461), Expect = 3.355e-49
Identity = 147/575 (25.57%), Postives = 265/575 (46.09%), Query Frame = 0
Query:    8 VILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRY-LSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPK-TVKDICFEIINNGNEALGIKAEDLFI--TEEVDKILYTGFDSKSAA----------IFDKLDTFLMLLLEVIQESLELDIPI--------KA--KDFENI-IKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPE--NFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSFYQRYR 555
            +I   +  ++ + G  L   + P  +  ++ E  +LR+GT+ +  ++  P P+     +F++ N  EV++G  P ++EVGPY Y +  +K+N+     R  + + +   + FD  +++          P ++ND++T++N  + ++   +D   K T+ +   ++ N   +   ++     I  T  +  IL    D    +          IF + DT  M L    ++ L   +P         KA  K+ E    K I         F+FF  KN T     +TI  G  D      I  +NG+  L    W N ++ ++        SC++I+GTDG+ +PPF    ++  + +F  ++CRT+ ++       EG I A RY +         PE  N CYC      +    N       CL    G +D+S C+ AP+ ++ PH L   +E  A + G++P  E+H  ++D+EP  GTPL   K++Q NM LR++  I L  ++    L P+ W DEG  L+ +  + +++ L   +++ + V   L   VG +L ++   + F +R R
Sbjct:    6 LIWAGIGAMMAVSGALLGWVVFPRAVHEKVIEATELRQGTDQYKRWEALPQPLDFKVYIFNVTNPYEVMQGRRPKVVEVGPYVYFQYRQKDNVRFSRDRSKVHFSQQQMYVFDAESSY----------PLTENDELTVLNMHMNSILQIIDNQAKETITNFRSDVNNTLEKIPVVRVIKRIIERTTPIQSILQLAEDETYDSLRLINVELNRIFGRPDT--MFLRTTPKQFLFDGVPFCVNVIGIAKAICKEIEKRNTKTIRTMPDGSLRFSFFSHKNMTD-DGMFTINTGIKDPSRTQMIELWNGRTTL--DVWNNRSSGLSS-------SCNKIHGTDGSGYPPFRTGVER--MTIFSTDICRTVDIKLTGSSSYEG-IPALRYEIDNNFLHEIGPEYGNDCYCVNKIPKSIVKSNG------CLY--KGALDLSNCFDAPVVLTLPHMLGVAEEYTALIDGMDPEPERHQIFVDVEPYTGTPLNGGKRVQFNMFLRRIDAIKLTDRLQP-TLFPVIWIDEGIALNEDMVKLIDDSLMKVLSLLDVVQWVL-IGVGLLLAVLMPTVYFVKRCR 545          
BLAST of EMLSAG00000005382 vs. SwissProt
Match: gi|332321748|sp|P86905.1|SNMP1_APIME (RecName: Full=Sensory neuron membrane protein 1)

HSP 1 Score: 176.022 bits (445), Expect = 2.410e-47
Identity = 143/526 (27.19%), Postives = 232/526 (44.11%), Query Frame = 0
Query:   10 LGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLME-QNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFEN-----IIKIISPAQLSEGT----FAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITI 525
            LG++   L+  GI +     P  ++SQ+ + + L++G+E    +   P P+     LF++ N  E+  GE P+L EVGP+ Y E  +K +L++ +    L Y     + F+ + +  L  +  +  P      + I++ + LTL  +   +          I+N   + +  K E +F+  +  +IL+ G                            L +    KDF +     ++K    A +++G     F+ F  KN T L     +  G  + +    + E NGK KL           I G+     G C+   GTD T F P L  +    +  F  ++CR++   F+S  +V+G I  Y Y       S S+PE  C+C    SC  +                 +MD++ C GAP+  S PH L A+++    V GL PN E+H   +D EP   TPL AHK++Q N+ L KVA   L+K   +  L P+FW +EG  L  E  ++L  V F  I+I
Sbjct:    6 LGIIGGSLLAFGILICAIAFPPFLRSQVKKQIALKDGSEMRELWSNFPVPLDFKIYLFNVTNPMEITAGEKPILEEVGPFFYDEYKQKVDLVDREEDDSLEYNLKATWFFNPSRSEGLTGEEELIVP-----HVLILSMIKLTLEQQPAAM---------GILNKAVDNIFKKPESVFVRAKAREILFDG----------------------------LPVDCTGKDFASSAICSVLKEKDDALIADGPGRYLFSLFGPKNGTVLPERIRVLRGIKNYKDVGKVTEVNGKTKL----------DIWGE-----GDCNEFNGTDSTIFAPLLTEQDD--IVSFAPDICRSMGARFDSYTKVKG-INTYHYKADLGDMS-SHPEEKCFCPSPDSCLTKN----------------LMDLTKCVGAPLIASLPHLLGAEEKYLKMVDGLHPNEEEHGIAMDFEPMTATPLSAHKRLQFNLYLHKVAKFKLMKNFPEC-LFPIFWVEEGILLGDEFVKKLKTV-FKTISI 452          
BLAST of EMLSAG00000005382 vs. SwissProt
Match: gi|374253737|sp|E1JI63.1|SNMP2_DROME (RecName: Full=Sensory neuron membrane protein 2; Short=SNMP2Dmel)

HSP 1 Score: 176.407 bits (446), Expect = 3.895e-47
Identity = 135/590 (22.88%), Postives = 274/590 (46.44%), Query Frame = 0
Query:    1 MILYSIRVILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRE-TMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLE----------LDIPIKAKDFENIIKIISPAQLSEG---------------------TFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPE--NFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSF-YQRYR 555
            MI +S+ ++  L   V ++GG    + + P M+  ++ +++ +++G+E F  F   P P+     +F++ N++ + +G  P++ E+GPY Y++   +K     ++   +SY +   F+FD   +           P +++D+I  +N   + +   L    + + DI     N  N  L        +   +++I       KS     + D  L LLL  +  +L+          +   ++   F+ +   I+P  +++                       F+FF  KN +     Y +  G+ D    + I + +  + L    W N ++        E   C++I GTD + +PPF   ++   +++F  ++CR++ + ++++++ +G I  YRY +G+   +   PE  N C+C +  +   +  N       CL    G +D++ C  AP+ ++ PH L A  E +  ++GL+P+++KH T++D++   GTPL+  K++Q NM L+ +  I + + +    L+P  W +EG +L+ E        L + +   N V  A   + G I + V+ ++ + YQR R
Sbjct:    1 MIHWSL-IVSALGVCVAVLGGYCGWI-LFPNMVHKKVEQSVVIQDGSEQFKRFVNLPQPLNFKVYIFNVTNSDRIQQGAIPIVEEIGPYVYKQFRQKKVKHFSRDGSKISYVQNVHFDFDAVAS----------APYTQDDRIVALN---MHMNAFLQVFEREITDIFQGFANRLNSRLNQTPGVRVLKRLMERIRGK---RKSVLQISENDPGLALLLVHLNANLKAVFNDPRSMFVSTSVREYLFDGVRFCINPQGIAKAICNQIKESGSKTIREKSDGSLAFSFFGHKNGSG-HEVYEVHTGKGDPMRVLEIQKLDDSHNL--QVWLNASSE------GETSVCNQINGTDASAYPPF--RQRGDSMYIFSADICRSVQLFYQTDIQYQG-IPGYRYSIGENFINDIGPEHDNECFCVDKLANVIKRKNG------CLYA--GALDLTTCLDAPVILTLPHMLGASNEYRKMIRGLKPDAKKHQTFVDVQSLTGTPLQGGKRVQFNMFLKSINRIGITENLPTV-LMPAIWVEEGIQLNGEMVAFFKKKLINTLKTLNIVHWAT--LCGGIGVAVACLIYYIYQRGR 549          
BLAST of EMLSAG00000005382 vs. SwissProt
Match: gi|50400807|sp|O35114.3|SCRB2_MOUSE (RecName: Full=Lysosome membrane protein 2; AltName: Full=85 kDa lysosomal membrane sialoglycoprotein; Short=LGP85; AltName: Full=Lysosome membrane protein II; Short=LIMP II; AltName: Full=Scavenger receptor class B member 2)

HSP 1 Score: 172.94 bits (437), Expect = 1.612e-46
Identity = 144/520 (27.69%), Postives = 239/520 (45.96%), Query Frame = 0
Query:   27 HILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENL-MEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLAD--KLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFR--LIPMFWADEGAELDSEKAEELNNVLFSAITIGNT--VGIALGYVVG 538
             +    +   I +N+ L+ GT+ FN++++PP PVY+ +  F++ N  E+++GE P+L EVGPY+YRE   K N+   +N   +S      + F+   +        +  P    D I  IN  LLT+ D  +L  L + ++ +           L    + LF+   V ++L+ G+  +           ++ L+ + +                    +SP       F  F  +N T     Y    G  +  +F  IVE+NGK  L    W    T            C+ I GTDG  F P +   K   L++F  +LCR++++ F S   VEG + A+RY V   + + ++ EN  +C    +C                   GV+++S C  GAPI MS PHF QAD++  + +KG+ PN E+H +++DI P  G  LR  K+ QIN  +RK   +D   +  D R  + P+ + +E   +D E A +L +V+ + + + N   + +ALG   G
Sbjct:   27 RVFQKAVDQTIEKNMVLQNGTKVFNSWEKPPLPVYIQFYFFNVTNPEEILQGEIPLLEEVGPYTYRELRNKANIQFGENGTTISAVTNKAYVFERNQS--------VGDP--NVDLIRTINIPLLTVVDLAQLTLLRELIEAM-----------LKAYQQKLFVIHTVHELLW-GYKDE-----------ILSLVHIFKPD------------------VSP------NFGLFYERNGTN-DGEYVFLTGEDNYLNFSKIVEWNGKTSL---DWWTTDT------------CNMINGTDGDSFHPLI--SKDEVLYLFPSDLCRSVHITFSSFENVEG-LPAFRYKVPAEILANTS-ENAGFCIPEGNCMDS----------------GVLNISICKNGAPIIMSFPHFYQADEKFVSAIKGMHPNKEEHESFVDINPLTGIILRGAKRFQINTYVRK---LDDFVETGDIRTMVFPVMYLNESVLIDKETANQLKSVINTTLVVTNIPYIIMALGVFFG 450          
BLAST of EMLSAG00000005382 vs. SwissProt
Match: gi|126291|sp|P27615.2|SCRB2_RAT (RecName: Full=Lysosome membrane protein 2; AltName: Full=85 kDa lysosomal membrane sialoglycoprotein; Short=LGP85; AltName: Full=CD36 antigen-like 2; AltName: Full=Lysosome membrane protein II; Short=LIMP II; AltName: Full=Scavenger receptor class B member 2; AltName: CD_antigen=CD36)

HSP 1 Score: 170.629 bits (431), Expect = 9.740e-46
Identity = 145/521 (27.83%), Postives = 237/521 (45.49%), Query Frame = 0
Query:   27 HILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENL-MEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFR--LIPMFWADEGAELDSEKAEELNNVLFSAITIGNT--VGIALGYVVGPIL 541
             +    +   I +N+ L+ GT+ F+++++PP PVY+ +  F++ N  E+++GE P+L EVGPY+YRE   K N+   +N   +S      + F+   +        +  P    D I  IN  LLT+ +         +    EII      L    + LF+T  V ++L+ G+  +           ++ L+ + +                    +SP       F  F  +N T     Y    G  +  +F  IVE+NGK  L    W    T            C+ I GTDG  F P +   K   L++F  + CR++Y+ F S   VEG + A+RY V   + + S+ EN  +C    +C                   GV++VS C  GAPI MS PHF QAD++  + +KG+ PN E+H +++DI P  G  LR  K+ QIN  ++K   +D   +  + R  + P+ + +E   +D E A +L +V+ + + + N   + +ALG   G I 
Sbjct:   27 RVFQKAVDQTIEKNMVLQNGTKVFDSWEKPPLPVYIQFYFFNVTNPEEILQGEIPLLEEVGPYTYRELRNKANVQFGENGTTISAVTNKAYIFERNQS--------VGDPTV--DLIRTINIPLLTVVEMAQ------QPFLREIIE---AMLKAYQQTLFVTHTVHELLW-GYKDE-----------VLSLVHIFRPD------------------VSP------NFGLFYERNGTN-DGEYVFLTGEDNYLNFTKIVEWNGKTSL---DWWTTDT------------CNMINGTDGDSFHPLI--SKDETLYIFPSDFCRSVYITFSSFENVEG-LPAFRYKVPAEILANSS-ENAGFCIPEGNCMDA----------------GVLNVSICKNGAPIIMSFPHFYQADEKFVSAIKGMRPNKEEHESFVDINPLTGIILRGAKRFQINTYVKK---LDDFVETGNIRTMVFPVMYLNESVLIDKETASQLKSVINTTLIVTNIPYIIMALGVFFGLIF 453          
BLAST of EMLSAG00000005382 vs. SwissProt
Match: gi|2498525|sp|Q14108.2|SCRB2_HUMAN (RecName: Full=Lysosome membrane protein 2; AltName: Full=85 kDa lysosomal membrane sialoglycoprotein; Short=LGP85; AltName: Full=CD36 antigen-like 2; AltName: Full=Lysosome membrane protein II; Short=LIMP II; AltName: Full=Scavenger receptor class B member 2; AltName: CD_antigen=CD36)

HSP 1 Score: 169.859 bits (429), Expect = 2.206e-45
Identity = 152/524 (29.01%), Postives = 238/524 (45.42%), Query Frame = 0
Query:   27 HILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENL-MEQNSRYLSY--GKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFS-MSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFR--LIPMFWADEGAELDSEKAEELNNVLFSAITIGNT--VGIALGYVVGPIL 541
             +    +   I + + LR GTE F+++++PP PVY  +  F++ N  E++RGE P + EVGPY+YRE   K N+    N   +S    K   FE D++          +  P  K D I  +N  +LT+      +  +      EII      L    + LF+T  VD++L+ G+  +           ++ L+ V +                    ISP       F  F  KN T   +Y  +  G     +F  IVE+NGK  L    W      IT +       C+ I GTDG  F P +   K   L++F  + CR++Y+ F S+ E   G+ A+RY V   + +  S+   FC  +                  CL    GV++VS C  GAPI MS PHF QAD+   + ++G+ PN E H T++DI P  G  L+A K+ QIN+ ++K   +D   +  D R  + P+ + +E   +D E A  L +++ + + I N   + +ALG   G + 
Sbjct:   27 RVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQS----------VGDP--KIDLIRTLNIPVLTV------IEWSQVHFLREIIE---AMLKAYQQKLFVTHTVDELLW-GYKDE-----------ILSLIHVFRPD------------------ISPY------FGLFYEKNGTNDGDYVFL-TGEDSYLNFTKIVEWNGKTSL--DWW------ITDK-------CNMINGTDGDSFHPLI--TKDEVLYVFPSDFCRSVYITF-SDYESVQGLPAFRYKVPAEILANTSDNAGFCIPE----------------GNCLGS--GVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKK---LDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTLIITNIPYIIMALGVFFGLVF 453          
BLAST of EMLSAG00000005382 vs. SwissProt
Match: gi|544584795|sp|C3U0S3.3|SNMP2_AEDAE (RecName: Full=Sensory neuron membrane protein 2; Short=SNMP2Aaeg)

HSP 1 Score: 169.474 bits (428), Expect = 9.055e-45
Identity = 146/543 (26.89%), Postives = 249/543 (45.86%), Query Frame = 0
Query:   40 NLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRY-LSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEE---VDKILYTGFDSKSAA----------IFDKLDTFLMLLLEVIQESLELDIPI--------KA--KDFENI-IKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEF-NGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPE--NFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVG-IALGYVVGPILLIVSIILSFYQR 553
            N +LR+ T  F  ++  P P+     +F++ N  EV  G  P ++EVGPY Y +   K+N+     R  + + +   + FD  +++          P ++ND++T++N  + ++   +D   K         +NN  E + +      I E+   +  IL    D    +          IF + D+  M L    +E L   +P         KA  K+ E    K I         F+FF  KN T     YTI  G   + +   ++E+ NG+N L    W N       Q +     C++I GTDG+ +PPF    ++  + +F  ++CRT+ +++      EG I A R+       +   PE  N CYC      A   +N       CL    G +D+S C+ AP+ ++ PH + A +E  + + GL P+ EKH  ++D+EP  GTPL   K++Q NM LR++  I L  ++    L P+ W +EG  L+ +  + +++ L   +T+ + V  + +G   G +L I+  I+ F +R
Sbjct:    5 NTELRQDTPQFKRWEAVPQPLDFKVYIFNVTNPYEVQMGRRPRVVEVGPYVYFQYRHKDNIRFSRDRSKVHFSQQQMYVFDAESSY----------PLTENDQLTVLNMHMNSILQIIDTQAKETITNFRSDVNNTLEKIPVVRVIKRIIEKTTPIQSILQLAEDETYDSLRLINAELNRIFGRPDS--MFLRTTPREFLFEGVPFCVNVIGIAKAICKEIEKRNTKTIRVQPDGSMKFSFFNHKNMTN-DGTYTINTG-IKEPALTQMIEYWNGRNTLDR--WIN-------QSAGSSSKCNKIVGTDGSGYPPFREGVER--MTIFSSDICRTVDIKYVGPSSYEG-IPALRFETDSHFLNEIGPEYGNDCYCVNRIPKAIVKNNG------CLY--KGALDLSTCFDAPVVLTHPHMMGAAQEYTSLIDGLYPDPEKHQIFVDVEPLTGTPLNGGKRVQFNMFLRRIDSIRLTDRLQT-TLFPVLWIEEGIALNEDMVKLIDDSLMKVLTLLDIVQWVMIG--SGLLLAIIMPIVYFIKR 510          
BLAST of EMLSAG00000005382 vs. SwissProt
Match: gi|37999904|sp|Q8WTV0.1|SCRB1_HUMAN (RecName: Full=Scavenger receptor class B member 1; Short=SRB1; AltName: Full=CD36 and LIMPII analogous 1; Short=CLA-1; AltName: Full=CD36 antigen-like 1; AltName: Full=Collagen type I receptor, thrombospondin receptor-like 1; AltName: Full=SR-BI; AltName: CD_antigen=CD36)

HSP 1 Score: 166.007 bits (419), Expect = 1.902e-43
Identity = 137/507 (27.02%), Postives = 221/507 (43.59%), Query Frame = 0
Query:    9 ILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVF---SMSNP-ENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC-YGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSE 510
            + GLL  VL  G + + M  +P++IK Q+ +N+ +   +  FN +KE P P YLS   F + N +E+++GE P + E GPY YRE   K N+   N+  +S+ +Y  F+F  + +H            S++D I + N ++L  A  ++  P T+K I          A     E  F+   V +I++   D                L+ +I +      P K K                  F  F   N +     +T+  G  +      + ++NG +K+    W                 C+ I GT G  +PPF+  +    L  +  E CR++ + ++ E  V  GI  YR+   K +F   S+  P E FC C E                       G+ +VS C + AP+F+S PHFL AD  +   V GL PN E H+ +LDI P  G P+    K+Q+++ ++ VAGI    K+    ++P+ W  E   ++ E
Sbjct:   16 VAGLLCAVL--GAVMIVM--VPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHG-----------SESDYIVMPNILVLGAAVMMENKPMTLKLIM-------TLAFTTLGERAFMNRTVGEIMWGYKDP---------------LVNLINKYFPGMFPFKDK------------------FGLFAELNNSD-SGLFTVFTGVQNISRIHLVDKWNGLSKV--DFW-------------HSDQCNMINGTSGQMWPPFMTPESS--LEFYSPEACRSMKLMYK-ESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLE----------------------SGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPV-VLPLLWFAESGAMEGE 425          
BLAST of EMLSAG00000005382 vs. SwissProt
Match: gi|332321722|sp|E0W3E3.1|SNMP1_PEDHC (RecName: Full=Sensory neuron membrane protein 1)

HSP 1 Score: 157.147 bits (396), Expect = 1.507e-40
Identity = 145/514 (28.21%), Postives = 223/514 (43.39%), Query Frame = 0
Query:   10 LGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVI-RGEPPVLLEVGPYSYRETMRKENLM--EQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLF 520
            LG++   + I GI     + P +I+ QI   + L  G+E    +++ P P+     +F+I N  EV   G+ P L E+GPY Y+E   K  ++  E +     + K T F+  E              P + ++ + I NP+L+ L    +   K V      +IN     L  K + +F+  +V  +L+ G       IF+   T        +   L+ + P       ++ K           F+    KN T+      I+ G  D      ++  NGKNKL    W              G  C+ + GTDGT FP  +   +   +W F  ELCR+I  +F  + E +G I A+RY V     S ++P   C C     C K+                G M++  C G P+  + PHF  + ++    VKGL PN E H+ + DIEP  GTPL A K+IQ +  L K+  IDL K + D  L+P  W +E  EL     ++LN+ LF
Sbjct:    7 LGIIGTTISIFGIGFGWGVFPWLIRMQI-GRVSLSPGSETREFWEKIPFPIDFKIHIFNITNHVEVQNEGKIPNLQEIGPYYYKEWKEKSEMIDYENDDSITFFMKNTWFDNKEKTL-----------PLTGDEMVIIPNPILVGLITAAEREKKGV----LPMINKAIPILFNKPDSVFLKIKVYDLLFGGI------IFNC--TTKDFSASAVCAVLKKEAPFLETVSRSVFK-----------FSILNQKNGTEEPLKLQIKRGIKDYTEVGKVIGANGKNKL--TNW-------------RGRPCNNLEGTDGTIFPSDISEHQD--IWSFNLELCRSIPAKFVRKSEYKG-IPAFRYNVTIGDTS-TDPSLKCLCINDTFCWKK----------------GAMELLKCSGLPVVATLPHFYDSHEDFLNGVKGLSPNEENHSIFFDIEPMTGTPLYAKKRIQFSFPLGKINKIDLTKNLPD-TLLPFLWVEESIELPDYLIDKLNSELF 449          
BLAST of EMLSAG00000005382 vs. SwissProt
Match: gi|48474224|sp|Q8SQC1.1|SCRB1_PIG (RecName: Full=Scavenger receptor class B member 1; Short=SRB1; AltName: Full=High density lipoprotein receptor SR-BI; AltName: Full=SR-BI)

HSP 1 Score: 154.836 bits (390), Expect = 8.184e-40
Identity = 142/562 (25.27%), Postives = 246/562 (43.77%), Query Frame = 0
Query:    6 IRVILGLLSIVLI-IGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVF---SMSNP-ENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC-YGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLF---SAITIGNTVGIALGYVVGPILLIVSIILSFYQ-RYREK 557
            +   LG + ++L  +G + + M  +P++IK Q+ +N+ +   +  FN +KE P P YLS   F + N NE+++G+ P + E GPY YRE   K N+   ++  +S+ +Y  ++F    +  L+           +D I I N ++L+ +  ++  P ++K     I+     ALG +A   F+   V +I++ G++                L+ +I +      P K                  G F  F   N +     +T+  G  D      + ++NG +K+    W                 C+ I GT G  + PF+  +    L  +  E CR++ + ++ +   EG I  +R+     +F   S+  P E FC C E                       G+ +VS C + AP+F+S PHF  AD  +   V GL PN+E+H+ +LDI P  G P+    K+Q+++ ++ V GI    K+    ++P+ W  E   ++ E  +     L      +     V +ALG V    LL + I+   YQ R +EK
Sbjct:   10 VAAALGFVGLLLAALGAVMIVM--VPSIIKQQVLKNVRIDPSSLSFNMWKEIPVPFYLSVYFFDVINPNEILQGQKPQVRERGPYVYREFRHKSNITFNDNDTVSFLEYRSYQFQPHKSRGLE-----------SDYIVIPNILVLSASVMMEDRPMSLK----LIMTFAFSALGERA---FVNRTVGEIMW-GYEDP--------------LIHLINKYFPNMFPFK------------------GKFGLFAELNNSD-SGLFTVFTGVKDFSRIHLVDKWNGLSKV--NFW-------------HSDQCNMINGTSGQMWAPFMTPESS--LEFYSPEACRSMKLIYKEQGVFEG-IPTFRFVAPNTLFANGSVYPPNEGFCPCME----------------------SGIQNVSTCRFNAPLFLSHPHFYNADPVLAEAVSGLHPNTEEHSLFLDIHPVTGIPMNCSVKLQLSLYIKSVKGIGQTGKIEPV-VLPLLWFAESGAMEGETLQTFYTQLVLMPKVLHYAQYVLLALGCV----LLFIPIV---YQIRSQEK 469          
BLAST of EMLSAG00000005382 vs. Select Arthropod Genomes
Match: gb|EFA01368.1| (Sensory neuron membrane protein 2-like Protein [Tribolium castaneum])

HSP 1 Score: 203.756 bits (517), Expect = 6.478e-58
Identity = 154/563 (27.35%), Postives = 266/563 (47.25%), Query Frame = 0
Query:    5 SIRVILG--LLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRG-EPPVLLEVGPYSYRETMRKENLMEQNSR--YLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLP-KTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFD---SKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSFYQRYREKR 558
            +I+V+L   ++S+ L+I  ++L   + P +++S++ + + L +GT+ ++ F E P PV     LF++ N  +V+ G E P L E+GP+ Y++  RK+ ++ +N     +SY +   FEFD             + P ++   +T++NP L+++    + L      D C +     N+        +FI   V K+L+ GF    + S  I   ++  L+  +   + + +L +P    D+  I             F++   K        YT++ G  + E   +IV +N               S+  +   EG +C  + GTD T +PP +     F  +++  ++CR + + ++ E E   GI  Y +   +     S PE  CYC +          D      C    DGV+D+  C+G P+  S PHFL AD +  + V+GL P  EKH TYL +EPN GTPL+  K+IQ+N V+R + GI  + +     L+P+ W +EG  L  +  +EL +  F  + I + V  AL  V+  IL+    I+   +R   K 
Sbjct:    7 TIKVLLVCVVISVALLIVSLALAFKVFPDLLESEVNKAVRLEDGTKQYDRFVELPFPVDFKVYLFNVSNPQQVLDGTEKPKLEEIGPFVYKQ-YRKKTILGKNEEEDTISYTQKETFEFDA----------EASKPLTEESVVTVLNPALMSIYQLAEDLHLAGAADTCIKQTFENNQG------KVFIEANVRKLLFDGFSFCKNTSPGICGLVND-LICAIAATKRNSDLVLP----DYSLI-------------FSYLNYKRKPD-DGKYTVKRGLTNIEKLGHIVAWND--------------SLYTKFWGEGTTCSEVKGTDSTLYPPRVTTDSAF--YIYSTDICRFVKINYKGE-ESYKGIDGYLFETSEDTLRSSAPEEDCYCSKL-------SRDMEGKKSCFL--DGVIDMQTCFGVPVLFSFPHFLWADNKYLSAVEGLNPVEEKHKTYLVVEPNTGTPLKGMKRIQLNGVIRPIVGIKSMLQTKR-ALLPLLWIEEGVSLPQKYVDELKSSYFDKVQIVDGVRYAL-IVISAILVGAFGIIILRKRSHAKH 505          
BLAST of EMLSAG00000005382 vs. Select Arthropod Genomes
Match: gb|KFM67984.1| (Lysosome membrane protein 2, partial [Stegodyphus mimosarum])

HSP 1 Score: 196.052 bits (497), Expect = 5.640e-55
Identity = 147/542 (27.12%), Postives = 258/542 (47.60%), Query Frame = 0
Query:   26 MHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENL-MEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICF----EIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSM--SNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSFYQRYREKRA 559
            + I P+++K++I +NL L EG E +  +K+ P PV     +F+I N  E+  G  P++ EVGPY +++   K+ L  ++  + ++Y    ++ F  + +  +  K                   + +L   L G+   +K + +     I+      L    E LF      ++L+ G+                  +E+I++ L+L  P  +K          P  L   TF F  GKN +     +++  G  D   +  IV +N  +K+P   W             +   C+ + GTDG+QFPP +   ++  L+++  ELCR++++E+E +V V+G I A R+   +R+F+    NP+N CYC E   C         +LS       G++DVS C  G  + ++ PHF Q  +     + GL P+ E H TY+DIEPN G  LRA +K+Q+N +L K   ++  K V +  +IP+ W  E AE+DSE A      + + IT+  +V  A   V+G + ++ +  ++ Y   ++++ 
Sbjct:   30 LSIFPSILKAKIEQNLVLEEGKEAYEKWKKTPIPVTFKVFIFNITNPKEIANGSRPLVSEVGPYVFKQLRSKDVLRWDEVEKTVTYNDIKQYHFVPSLSADMSEK-------------------IYSLNLPLQGIIMFIKKLAYFARAMIVPALENMLTTYDEKLFTHRTARELLFDGYK-----------------VELIEDLLDLAKPFVSK---------VPQILPNNTFGFLYGKNNSG-DGIFSVFTGEDDIAKYSQIVRWNNMSKIP--FW-------------KDDFCNMMNGTDGSQFPPPV--TRRDILYVYTPELCRSVFLEYERDVLVQG-IPALRFVTPERLFASPKDNPDNMCYCTEPQYC---------ELS-------GILDVSPCRKGMKLAVTGPHFYQGHEIFAKRIDGLTPSRELHETYVDIEPNTGLVLRASRKLQMNFILDKFEDLEETKSV-EMNVIPLIWVTEEAEIDSEVAALFTAKVRTPITVAKSVLTAC-IVLGILWIVTAGFVTVYILMKQQKT 489          
BLAST of EMLSAG00000005382 vs. Select Arthropod Genomes
Match: EFX72214.1 (hypothetical protein DAPPUDRAFT_326408 [Daphnia pulex])

HSP 1 Score: 193.741 bits (491), Expect = 3.739e-54
Identity = 165/568 (29.05%), Postives = 263/568 (46.30%), Query Frame = 0
Query:    3 LYSIRVILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIR-GEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLP--KTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKI--ISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKN--KLPE--AXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFS--MSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYG-APIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSFYQRYREKR 558
            L+   +I+G+   V  +    L    +P +I +   + L L E    +N + +PP P+Y  + +F+  N N+V+R G  P+++E+GPYSYRE  +K   + +NS  + Y +  ++ +    T             S +D IT +NPV +T++  LD LP      DI  ++I+N    L  + E +F+T   D++++ G+          +DT++ L  E IQ+      P        +  +  I P+   + T   FK KN +     + +  G FD  +F +I E  G+N  KL      WP            E   C+ I GTDGT FP  +    K  +W++  +LCR+IYV +E   E    +   R+ + K V     + PEN C+C            DE D   C     G + + ACYG AP+  S PHF   D      V+GL PN  KH TYL +E    T L A K++Q+++ +RK    D L        +PM W +E A++D   A+E N      + I  T  +   + +G IL +V + L     ++EK+
Sbjct:    6 LFKNGLIVGIFGAVFTVTIAILGWVAMPNIIANVSKKTLVLEENNFVWNIWYDPPYPIYTDFYIFNCTNYNDVVRNGTKPIVVELGPYSYREYRKKNTSVLENSDEIVYYREHRWYYFSQATS--------GPGLSLSDVITTVNPVYMTVSKFLDILPVNNPAVDIVVDLIDN---FLKERNESVFMTVTADELIFKGW---------PMDTYIELY-ERIQDIFNPWPPFFPPLPPGLPTLPEIPPSVRDDITLGLFKAKNDSD-DGIFRVNRGTFDYRAFADI-EAWGRNQEKLSPYLTFWP-----------GEKSYCNEIQGTDGTVFPYGIDVDDK--IWIYQTDLCRSIYVVYEQH-ETYADLPGRRFNLPKSVLENRTNAPENECFCL-----------DEEDEGVCPNT--GALFIGACYGGAPLIGSNPHFYNGDPRYVNGVEGLNPNQSKHETYLILEERTNTLLYASKRVQLSIDVRKTRLSDTLNLTTRV-FLPMLWYEENAQIDEGTAKEFN------VFIILTAVMWTLFAIGLILTVVGVFLIGLHFHKEKK 516          
BLAST of EMLSAG00000005382 vs. Select Arthropod Genomes
Match: EAA11629.4 (AGAP005716-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 181.415 bits (459), Expect = 1.647e-49
Identity = 139/556 (25.00%), Postives = 263/556 (47.30%), Query Frame = 0
Query:    8 VILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRY-LSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIIN---PVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGT--FAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPE--NFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSFYQRYR 555
            +I   +  ++ + G  L   + P  +  ++ E  +LR+GT+ +  ++  P P+     +F++ N  EV++G  P ++EVGPY Y +  +K+N+     R  + + +   + FD  +++          P ++ND++T++N     +L +A+  D    +++ I  E+    N   G + + +F+     + L+ G               +   + VI  +  +   I+ ++ + I        + +G+  F+FF  KN T     +TI  G  D      I  +NG+  L    W N ++ ++        SC++I+GTDG+ +PPF    ++  + +F  ++CRT+ ++       EG I A RY +         PE  N CYC      +    N       CL    G +D+S C+ AP+ ++ PH L   +E  A + G++P  E+H  ++D+EP  GTPL   K++Q NM LR++  I L  ++    L P+ W DEG  L+ +  + +++ L   +++ + V   L   VG +L ++   + F +R R
Sbjct:    6 LIWAGIGAMMAVSGALLGWVVFPRAVHEKVIEATELRQGTDQYKRWEALPQPLDFKVYIFNVTNPYEVMQGRRPKVVEVGPYVYFQYRQKDNVRFSRDRSKVHFSQQQMYVFDAESSY----------PLTENDELTVLNMHMNSILQIAE--DETYDSLRLINVEL----NRIFG-RPDTMFLRTTPKQFLFDG---------------VPFCVNVIGIAKAICKEIEKRNTKTI------RTMPDGSLRFSFFSHKNMTD-DGMFTINTGIKDPSRTQMIELWNGRTTL--DVWNNRSSGLSS-------SCNKIHGTDGSGYPPFRTGVER--MTIFSTDICRTVDIKLTGSSSYEG-IPALRYEIDNNFLHEIGPEYGNDCYCVNKIPKSIVKSNG------CLY--KGALDLSNCFDAPVVLTLPHMLGVAEEYTALIDGMDPEPERHQIFVDVEPYTGTPLNGGKRVQFNMFLRRIDAIKLTDRLQP-TLFPVIWIDEGIALNEDMVKLIDDSLMKVLSLLDVVQWVL-IGVGLLLAVLMPTVYFVKRCR 500          
BLAST of EMLSAG00000005382 vs. Select Arthropod Genomes
Match: EFX73750.1 (hypothetical protein DAPPUDRAFT_307609 [Daphnia pulex])

HSP 1 Score: 178.333 bits (451), Expect = 8.827e-49
Identity = 149/544 (27.39%), Postives = 262/544 (48.16%), Query Frame = 0
Query:    9 ILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLL-EVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKL-DGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQAD-KEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNV--LFSAITIGNT--VGIALGYVVGPILLIV 544
            I+G + + +II   +L   ++P +  S   E +  ++    + A+  PP P+YL + LF+  N ++   G   + L ++GP+S+ E   K N++E+N   LSY +   + +   +  +             +  +T +NPV  TLA  + D  P     I   +    ++ L  + E  F+T  V ++L+ G+  +            + +LE++ E L         +  +      P    +  F FF G+N T L  + TIE+G  D      I ++NGK+ +  + W +               C+ I GTDG  +PP +   +K  +++F  ++CR++Y  +E +   EG IT  R+ V + VF   +PEN CYC ++      ++N +   S+      GV+D+  C  G P+ +S PHF  AD K V A+V GL+PN + H T+ D+EP LG PL A K++Q+N+  R+      L  + D  + P+ W +E A+LD+  A ++N    +  A+ I     +G  +  VV  ++++V
Sbjct:   10 IVGSVGVAVIILSSTLGWILVPDIATS---EAVITKDNEAVYGAWTIPPVPIYLEFFLFNCTNCDDPTNGSVVLNLDQLGPFSFTEGRIKFNVIEKNG-LLSYRENISYFYTPKDGER-----------DLDVNVTTVNPVYFTLASLISDNAPTPA--IATSLSRLMHQLLADEGEHPFMTHTVREMLFEGWSLQP----------YVNILELLYEQL--------SNSTDSTLPPLPELPEDPKFGFFYGRNGTNLGEF-TIESGANDLNELGYIKKWNGKSSV--SYWNDTF-------------CNMINGTDGAIYPPIVDVNEK--IYVFTPDVCRSLYATYEKDTVTEG-ITGRRFTVPEIVFDTLDPENVCYCSQY------SENPDLCFSR------GVLDMRPCLLGVPVVLSTPHFYMADPKYVDAFV-GLKPNKDWHETHFDLEPLLGVPLFASKRLQLNIDARRYQVPKGLLNIND-TVFPVIWLNESAKLDASTANDVNKAVNVIDALNISRWCFLGAGIALVVASLIMLV 485          
BLAST of EMLSAG00000005382 vs. Select Arthropod Genomes
Match: AGB94234.1 (sensory neuron membrane protein 2, isoform D [Drosophila melanogaster])

HSP 1 Score: 176.407 bits (446), Expect = 1.888e-47
Identity = 135/590 (22.88%), Postives = 274/590 (46.44%), Query Frame = 0
Query:    1 MILYSIRVILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRE-TMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLE----------LDIPIKAKDFENIIKIISPAQLSEG---------------------TFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPE--NFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSF-YQRYR 555
            MI +S+ ++  L   V ++GG    + + P M+  ++ +++ +++G+E F  F   P P+     +F++ N++ + +G  P++ E+GPY Y++   +K     ++   +SY +   F+FD   +           P +++D+I  +N   + +   L    + + DI     N  N  L        +   +++I       KS     + D  L LLL  +  +L+          +   ++   F+ +   I+P  +++                       F+FF  KN +     Y +  G+ D    + I + +  + L    W N ++        E   C++I GTD + +PPF   ++   +++F  ++CR++ + ++++++ +G I  YRY +G+   +   PE  N C+C +  +   +  N       CL    G +D++ C  AP+ ++ PH L A  E +  ++GL+P+++KH T++D++   GTPL+  K++Q NM L+ +  I + + +    L+P  W +EG +L+ E        L + +   N V  A   + G I + V+ ++ + YQR R
Sbjct:    1 MIHWSL-IVSALGVCVAVLGGYCGWI-LFPNMVHKKVEQSVVIQDGSEQFKRFVNLPQPLNFKVYIFNVTNSDRIQQGAIPIVEEIGPYVYKQFRQKKVKHFSRDGSKISYVQNVHFDFDAVAS----------APYTQDDRIVALN---MHMNAFLQVFEREITDIFQGFANRLNSRLNQTPGVRVLKRLMERIRGK---RKSVLQISENDPGLALLLVHLNANLKAVFNDPRSMFVSTSVREYLFDGVRFCINPQGIAKAICNQIKESGSKTIREKSDGSLAFSFFGHKNGSG-HEVYEVHTGKGDPMRVLEIQKLDDSHNL--QVWLNASSE------GETSVCNQINGTDASAYPPF--RQRGDSMYIFSADICRSVQLFYQTDIQYQG-IPGYRYSIGENFINDIGPEHDNECFCVDKLANVIKRKNG------CLYA--GALDLTTCLDAPVILTLPHMLGASNEYRKMIRGLKPDAKKHQTFVDVQSLTGTPLQGGKRVQFNMFLKSINRIGITENLPTV-LMPAIWVEEGIQLNGEMVAFFKKKLINTLKTLNIVHWAT--LCGGIGVAVACLIYYIYQRGR 549          
BLAST of EMLSAG00000005382 vs. Select Arthropod Genomes
Match: ACZ94643.1 (sensory neuron membrane protein 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 176.407 bits (446), Expect = 1.888e-47
Identity = 135/590 (22.88%), Postives = 274/590 (46.44%), Query Frame = 0
Query:    1 MILYSIRVILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRE-TMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLE----------LDIPIKAKDFENIIKIISPAQLSEG---------------------TFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPE--NFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSF-YQRYR 555
            MI +S+ ++  L   V ++GG    + + P M+  ++ +++ +++G+E F  F   P P+     +F++ N++ + +G  P++ E+GPY Y++   +K     ++   +SY +   F+FD   +           P +++D+I  +N   + +   L    + + DI     N  N  L        +   +++I       KS     + D  L LLL  +  +L+          +   ++   F+ +   I+P  +++                       F+FF  KN +     Y +  G+ D    + I + +  + L    W N ++        E   C++I GTD + +PPF   ++   +++F  ++CR++ + ++++++ +G I  YRY +G+   +   PE  N C+C +  +   +  N       CL    G +D++ C  AP+ ++ PH L A  E +  ++GL+P+++KH T++D++   GTPL+  K++Q NM L+ +  I + + +    L+P  W +EG +L+ E        L + +   N V  A   + G I + V+ ++ + YQR R
Sbjct:    1 MIHWSL-IVSALGVCVAVLGGYCGWI-LFPNMVHKKVEQSVVIQDGSEQFKRFVNLPQPLNFKVYIFNVTNSDRIQQGAIPIVEEIGPYVYKQFRQKKVKHFSRDGSKISYVQNVHFDFDAVAS----------APYTQDDRIVALN---MHMNAFLQVFEREITDIFQGFANRLNSRLNQTPGVRVLKRLMERIRGK---RKSVLQISENDPGLALLLVHLNANLKAVFNDPRSMFVSTSVREYLFDGVRFCINPQGIAKAICNQIKESGSKTIREKSDGSLAFSFFGHKNGSG-HEVYEVHTGKGDPMRVLEIQKLDDSHNL--QVWLNASSE------GETSVCNQINGTDASAYPPF--RQRGDSMYIFSADICRSVQLFYQTDIQYQG-IPGYRYSIGENFINDIGPEHDNECFCVDKLANVIKRKNG------CLYA--GALDLTTCLDAPVILTLPHMLGASNEYRKMIRGLKPDAKKHQTFVDVQSLTGTPLQGGKRVQFNMFLKSINRIGITENLPTV-LMPAIWVEEGIQLNGEMVAFFKKKLINTLKTLNIVHWAT--LCGGIGVAVACLIYYIYQRGR 549          
BLAST of EMLSAG00000005382 vs. Select Arthropod Genomes
Match: ABI31242.1 (sensory neuron membrane protein 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 175.252 bits (443), Expect = 2.128e-47
Identity = 131/562 (23.31%), Postives = 268/562 (47.69%), Query Frame = 0
Query:    1 MILYSIRVILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRE-TMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIIN---PVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPE--NFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSF-YQRYR 555
            MI +S+ ++  L   V ++GG    + + P M+  ++ +++ +++G+E F  F   P P+     +F++ N++ + +G  P++ E+GPY Y++   +K     ++   +SY +   F+FD   +           P +++D+I  +N     +L +++   GL      +    +N   +A+      +F++  V + L+ G                 +   +  + +   I  + K  E+  K I         F+FF  KN +     Y +  G+ D    + I + +  + L    W N ++        E   C++I GTD + +PPF   ++   +++F  ++CR++ + ++++++ +G I  YRY +G+   +   PE  N C+C +  +   +  N       CL    G +D++ C  AP+ ++ PH L A  E +  ++GL+P+++KH T++D++   GTPL+  K++Q NM L+ +  I + + +    L+P  W +EG +L+ E        L + +   N V  A   + G I + V+ ++ + YQR R
Sbjct:    1 MIHWSL-IVSALGVCVAVLGGYCGWI-LFPNMVHKKVEQSVVIQDGSEQFKRFVNLPQPLNFKVYIFNVTNSDRIQQGAIPIVEEIGPYVYKQFRQKKVKHFSRDGSKISYVQNVHFDFDAVAS----------APYTQDDRIVALNMHMNSVLQISENDPGLA-----LLLVHLNANLKAVFNDPRSMFVSTSVREYLFDG-----------------VRFCINPQGIAKAICNQIK--ESGSKTIREKSDGSLAFSFFGHKNGSG-HEVYEVHTGKGDPMRVLEIQKLDDSHNL--QVWLNASSE------GETSVCNQINGTDASAYPPF--RQRGDSMYIFSADICRSVQLFYQTDIQYQG-IPGYRYSIGENFINDIGPEHDNECFCVDKLANVIKRKNG------CLYA--GALDLTTCLDAPVILTLPHMLGASNEYRKMIRGLKPDAKKHQTFVDVQSLTGTPLQGGKRVQFNMFLKSINRIGITENLPTV-LMPAIWVEEGIQLNGEMVAFFKKKLINTLKTLNIVHWAT--LCGGIGVAVACLIYYIYQRGR 503          
BLAST of EMLSAG00000005382 vs. Select Arthropod Genomes
Match: XP_016770009.1 (PREDICTED: sensory neuron membrane protein 1 [Apis mellifera])

HSP 1 Score: 175.637 bits (444), Expect = 4.278e-47
Identity = 143/526 (27.19%), Postives = 232/526 (44.11%), Query Frame = 0
Query:   10 LGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLME-QNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFEN-----IIKIISPAQLSEGT----FAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITI 525
            LG++   L+  GI +     P  ++SQ+ + + L++G+E    +   P P+     LF++ N  E+  GE P+L EVGP+ Y E  +K +L++ +    L Y     + F+ + +  L  +  +  P      + I++ + LTL  +   +          I+N   + +  K E +F+  +  +IL+ G                            L +    KDF +     ++K    A +++G     F+ F  KN T L     +  G  + +    + E NGK KL           I G+     G C+   GTD T F P L  +    +  F  ++CR++   F+S  +V+G I  Y Y       S S+PE  C+C    SC  +                 +MD++ C GAP+  S PH L A+++    V GL PN E+H   +D EP   TPL AHK++Q N+ L KVA   L+K   +  L P+FW +EG  L  E  ++L  V F  I+I
Sbjct:   60 LGIIGGSLLAFGILICAIAFPPFLRSQVKKQIALKDGSEMRELWSNFPVPLDFKIYLFNVTNPMEITAGEKPILEEVGPFFYDEYKQKVDLVDREEDDSLEYNLKATWFFNPSRSEGLTGEEELIVP-----HVLILSMIKLTLEQQPAAM---------GILNKAVDNIFKKPESVFVRAKAREILFDG----------------------------LPVDCTGKDFASSAICSVLKEKDDALIADGPGRYLFSLFGPKNGTVLPERIRVLRGIKNYKDVGKVTEVNGKTKL----------DIWGE-----GDCNEFNGTDSTIFAPLLTEQDD--IVSFAPDICRSMGARFDSYTKVKG-INTYHYKADLGDMS-SHPEEKCFCPSPDSCLTKN----------------LMDLTKCVGAPLIASLPHLLGAEEKYLKMVDGLHPNEEEHGIAMDFEPMTATPLSAHKRLQFNLYLHKVAKFKLMKNFPEC-LFPIFWVEEGILLGDEFVKKLKTV-FKTISI 506          
BLAST of EMLSAG00000005382 vs. Select Arthropod Genomes
Match: XP_006562934.1 (PREDICTED: sensory neuron membrane protein 1 [Apis mellifera])

HSP 1 Score: 175.637 bits (444), Expect = 4.278e-47
Identity = 143/526 (27.19%), Postives = 232/526 (44.11%), Query Frame = 0
Query:   10 LGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLME-QNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFEN-----IIKIISPAQLSEGT----FAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITI 525
            LG++   L+  GI +     P  ++SQ+ + + L++G+E    +   P P+     LF++ N  E+  GE P+L EVGP+ Y E  +K +L++ +    L Y     + F+ + +  L  +  +  P      + I++ + LTL  +   +          I+N   + +  K E +F+  +  +IL+ G                            L +    KDF +     ++K    A +++G     F+ F  KN T L     +  G  + +    + E NGK KL           I G+     G C+   GTD T F P L  +    +  F  ++CR++   F+S  +V+G I  Y Y       S S+PE  C+C    SC  +                 +MD++ C GAP+  S PH L A+++    V GL PN E+H   +D EP   TPL AHK++Q N+ L KVA   L+K   +  L P+FW +EG  L  E  ++L  V F  I+I
Sbjct:   60 LGIIGGSLLAFGILICAIAFPPFLRSQVKKQIALKDGSEMRELWSNFPVPLDFKIYLFNVTNPMEITAGEKPILEEVGPFFYDEYKQKVDLVDREEDDSLEYNLKATWFFNPSRSEGLTGEEELIVP-----HVLILSMIKLTLEQQPAAM---------GILNKAVDNIFKKPESVFVRAKAREILFDG----------------------------LPVDCTGKDFASSAICSVLKEKDDALIADGPGRYLFSLFGPKNGTVLPERIRVLRGIKNYKDVGKVTEVNGKTKL----------DIWGE-----GDCNEFNGTDSTIFAPLLTEQDD--IVSFAPDICRSMGARFDSYTKVKG-INTYHYKADLGDMS-SHPEEKCFCPSPDSCLTKN----------------LMDLTKCVGAPLIASLPHLLGAEEKYLKMVDGLHPNEEEHGIAMDFEPMTATPLSAHKRLQFNLYLHKVAKFKLMKNFPEC-LFPIFWVEEGILLGDEFVKKLKTV-FKTISI 506          
BLAST of EMLSAG00000005382 vs. nr
Match: gi|858945681|gb|AKO62849.1| (scavenger receptor B1 [Marsupenaeus japonicus])

HSP 1 Score: 231.106 bits (588), Expect = 1.825e-65
Identity = 160/524 (30.53%), Postives = 259/524 (49.43%), Query Frame = 0
Query:    8 VILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSR-YLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVL---FSAITIG 526
             IL  + +VLI+G +  +     ++  + +   L L+ G++   +FK PP P+++ + +F++ N  EV+ G  PVL +VGPY+Y E   K +L   + +  ++Y +   F F E  +  L          +++D+IT IN V+++L  +       V+     ++       G++    F+T+ V ++L+ G+D                      E +   I    KD         P QL+ G F FF  KN T     YT+  G    E + NIV + G++ +  + W N    + G     G +C+ I GT G QFP  +  KK  P+ ++  ELCR+IY EF+ EV   G +T YRY +  R+ + + PEN CYC + F+C                 +  +++VS C  GAP+ MS PHF Q D E    V GL P +E+H TYLDIEP  G  +RA K+IQ+NM LR+ + +   + V+D  + P+ W +E A +  E+ + L+  L   F+ +T+G
Sbjct:    8 AILVTVGVVLIVGSLCFQAK-FQSVFDNILANKLMLKPGSKTLESFKSPPVPIFMQFYIFNLTNKEEVLAGAKPVLQQVGPYTYAEKQLKYDLQFDDEKGTVTYLQNKTFVFREDLSEGL----------AESDRITTINAVMMSLGSRFSKFSGGVQ----ALVEMWFMRFGVEP---FVTKPVGELLFHGYD----------------------EPMLGSIGALTKD---------PVQLT-GKFGFFYPKNNTN-DGTYTVYTGVKGMEDYQNIVSWKGESDV--SFWKN---DMWG-----GNTCNMINGTSGNQFPQPVLKKK--PVRLYTAELCRSIYAEFQREVS-HGPVTLYRYVLPDRLLA-NTPENKCYCTDDFTC-----------------RASMINVSPCRKGAPVVMSTPHFYQGDPEDAEQVVGLRPRAEEHETYLDIEPTTGVTMRAAKRIQVNMPLRRYSNLPSFRNVSDV-IFPILWVNESAVVPLERTQALHRTLILPFTLVTVG 448          
BLAST of EMLSAG00000005382 vs. nr
Match: gi|941507801|gb|ALK82306.1| (scavenger receptor class B type I protein [Macrobrachium nipponense])

HSP 1 Score: 223.016 bits (567), Expect = 2.374e-62
Identity = 159/546 (29.12%), Postives = 268/546 (49.08%), Query Frame = 0
Query:   13 LSIVLIIGGI-----SLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEV-IRGEPPVLLEVGPYSYRETMRKENLM-EQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLE---LDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFS--MSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC-YGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTV-GIALGYVVGPILLIV 544
            ++I+ +IG I     S+ + + P++  S + + L L   +     F  PP P+Y+ + LFH+ N +++   G  P L +VGPY+Y E   K N+    +   ++Y +   + F E  +H LK          ++D+IT INP+++ LAD +D           ++I    E       D+F TE V   ++ GFD      FD  +  +++    + E L     DI  K  +   +I +  P  L      F K        + Y ++ G    + +++IV +NGK+ L  + W                 C +I GTDGTQFPP +   K   L+++  ELCR++Y+ +E EV+V G +T YR+   K      + NP+N C+C               ++S CL     +++++ C + API +S PHF Q ++E    + GL P+ E+H TYLDIEPN G  +RA KK+Q+N+ L++       K V +  + P+ W +E A++D + A  +   L+S  TI + + G  +G  +G +L++V
Sbjct:    7 VTIMTVIGSILVLLCSIFLGVFPSIFNSIVNKMLVLSRDSATLGDFISPPVPIYMQFYLFHVTNPDDIRFHGAKPKLKQVGPYTYAEVRTKHNMTWNDDDGTVTYLQDKSYFFREDMSHGLK----------ESDEITTINPIMVVLADFVDRYRTDQNKKLLDLIWTEIEV----GFDIFATEAVGNTIFYGFDLPEFD-FDFSNLSVIIPGVNVTEGLSGSLYDILTKLNE-RGVIDVEPPESLRSNQIHFLKNNTD---DHPYEVKTGAQGLDDYLHIVSWNGKSSL--SYW-------------NDEYCDQINGTDGTQFPPQV--SKDQALYIYTSELCRSLYLTYEKEVDVHG-VTTYRFIPPKDALEDPLVNPDNQCFCYP-------------NVSYCLHA--SMLNMAPCAFDAPIVLSTPHFYQGNQEDIDSIDGLSPHKEEHETYLDIEPNTGVAMRAMKKMQLNVPLKRYGSFPSFKNVPEV-IFPIVWVNESAQIDEDTASSVRKALYSPFTIVDAICGTLIG--IGALLILV 497          
BLAST of EMLSAG00000005382 vs. nr
Match: gi|1061475003|gb|ODM93105.1| (Scavenger receptor class B member 1 [Orchesella cincta])

HSP 1 Score: 219.935 bits (559), Expect = 1.209e-60
Identity = 172/558 (30.82%), Postives = 277/558 (49.64%), Query Frame = 0
Query:    3 LYSIRVILGLLSIVLIIGGISLKMHILPAMIKSQIYEN--LDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSR--YLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKL-DGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNP----ENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVK--GLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIIL 548
            L    +++ L+++ L+   +SL   I+P +I+ +I +   +      E ++A+  PP PVYL   LF+I N  E   G  P LLE+GPY +RE   K N+   ++    ++Y ++  + F++          R++      DKITIIN      A K+   LP  + D+   I+ N  E+L       FI + V++ L+ G+               +  LE I++ +   +                  +    F FF G+N T+ Q  YT+  G  DK S   I++F  +++L                 ++  +C++I GTDGT F PF+  +K   L +F  ELCR++Y+ + ++ + EG I  YR+     V  M +P    EN C+C          D+DE    +CLK   G +D+  C  GAPI MS PHFL A+ E   Y++  GL P+  KH T+LDIEP  G  L+A KKIQ+N++L++V GI  + +V +  L+P+ WADE A LD+E   +  + LF  + + + +     +V+  I LIVS++L
Sbjct:   51 LKQTSIVIVLVALPLLFLAVSLGWIIVPCIIRHEILKKAVISPEVNPELYSAWIHPPVPVYLKVYLFNISNPKEFQNGSKPKLLEMGPYIFRENRTKVNIHHDDATNDAITYEEHITYHFEQ----------RLSGNAKLEDKITIINVPFAAAAIKIAHDLPWPMNDLAQMILINYKESL-------FIEKTVEEALFKGWK--------------VPFLEKIEQDVGFTL------------------IPSNEFGFFVGQNDTE-QGPYTVSRGSEDKSSLGVILKFKNQSEL--------------DFWTKSSTCNQIQGTDGTIFSPFV--QKSTVLRLFNPELCRSVYLTYTADTDFEG-IRGYRFTAPASV--MKDPTEGDENRCFCI--------YDDDE----KCLK--QGALDLGPCREGAPIAMSTPHFLDANAE---YIENSGLVPHRHKHETFLDIEPTTGIILQASKKIQVNLILKRVNGISSMSRVPEM-LLPLVWADECASLDAESKGKFQSALF-YLWLADFIS---KWVLLAIALIVSLLL 517          
BLAST of EMLSAG00000005382 vs. nr
Match: gi|1005968303|ref|XP_015791952.1| (PREDICTED: platelet glycoprotein 4-like [Tetranychus urticae] >gi|1005968306|ref|XP_015791953.1| PREDICTED: platelet glycoprotein 4-like [Tetranychus urticae] >gi|1005968308|ref|XP_015791954.1| PREDICTED: platelet glycoprotein 4-like [Tetranychus urticae])

HSP 1 Score: 216.083 bits (549), Expect = 5.723e-60
Identity = 166/550 (30.18%), Postives = 271/550 (49.27%), Query Frame = 0
Query:    6 IRVILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEP-PVLLEVGPYSYRETMRK-ENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINP---VLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXW-PNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVF--SMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSI 546
            I  IL +LS + ++          P +I  +I E + L  G+E  + + +   P+ +S+++F + N  EV  G   P+++E GPY + E+  K     ++ S  +SY ++  + F           NR  +  S +D+ +I N    VL TL  K      T+K +   I++N    + I  + LFI ++V +IL+ G+              +  + ++IQ+     + I+ +D                TF FF  KN T     YT+ NG  D   F  I +++ K+K+    W PN               C+ I GTDG+QF P +  K+   L++F  ELCR+IY+E+E + E+ G I   ++ + KR+F     NPEN C+C               D ++ L   DG+MD S C  GAPI +S PHF   DK +   VKGL P+ +KH TYL+IEPN G    A +++QIN+V+R   GI LL+ V +  ++P+ W  E A +D   A +  + +   I +GN++ IA  + VG +L+++++
Sbjct:   14 IGFILAILSTIALL--------YFPDIISKKIKEKVPLVHGSESMDRWLKVKVPITMSFTIFEVTNPTEVASGSAQPIVVERGPYVFDESRHKIVTGSDEESGSISYNQFKTYIF-----------NRNKSIGSLDDEYSIPNVPAIVLSTLIAK-KKTTATIKQLIMPILDN---LMVISNQQLFIKKKVREILFDGYQ-------------ISFVHQLIQQLKTFGVSIQLQD----------------TFGFFLNKNGTH-DGEYTVHNGLLDINRFTKIEKWSDKSKV--NFWEPN-------------SFCNDINGTDGSQFNPGV--KRTDVLYIFSSELCRSIYIEYEKDTEIRG-INTLKFILPKRLFLSPDRNPENGCFC--------------LDKNEPLCGYDGIMDASPCKKGAPIVLSSPHFYNGDKRLLNGVKGLNPDKKKHETYLNIEPNTGLVFDATQRLQINVVIRPHTGIGLLRNVKEV-VLPVLWLQESATVDEFSANKFKSQVTKTIVVGNSILIAFIF-VGIVLILIAV 476          
BLAST of EMLSAG00000005382 vs. nr
Match: gi|998513552|ref|XP_015517411.1| (PREDICTED: sensory neuron membrane protein 2 isoform X1 [Neodiprion lecontei])

HSP 1 Score: 213.772 bits (543), Expect = 6.297e-59
Identity = 155/562 (27.58%), Postives = 260/562 (46.26%), Query Frame = 0
Query:    6 IRVILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFD--SKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAF--FKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFS--MSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTV--GIALGYVVGPILLIVSIILSFYQRYREKRA 559
            + +++ ++  V+ + G  +   ++P +I  ++ E++ L EG++ F  ++  P PV      F++ N ++V  G  P++ E+GPY Y++   K N+   +   LSY ++  +EFDE            + P ++ D IT++N  L+++A   +    +       ++N+    +      +F+T      L+ G      S  I + L                          EN   +  P +LS+G F F     KN T    YY+I +G  D      I+ +   + L    W             E G+C+ I G D + +PPF    +   + +F  ++CR++ V+F SEV    GI +Y+Y VGK + S  ++NPEN C+C       + TD        CL   DG M++  C GAP+ +S PHF  AD+  Q  V GL PN   H  +L++EP  GT LR  K++Q N+ LR ++ I L   +    L+P+ W DE  EL  E  +ELN  LF  + + NT+  G+  G   G +L ++  +       R + A
Sbjct:    5 VAIVITVIGAVIAVAGGLVGYLVIPDIIDERVEESVKLVEGSDAFERWQNVPVPVLYKIYFFNVSNPDDVQNGLQPIVEEIGPYVYKQYRTKINIAAADD-VLSYYQHQLYEFDE----------EASAPLTEYDDITVVNLPLMSIATVAEYNSGSTLLSQLTLLNSAISTIFQSPTSVFLTTTPRDFLFDGVYVYCNSTGIINSL---------------------VCNQIENYAPVTMP-RLSDGRFKFSLLSHKNDTN-DGYYSINSGLNDVSQLGEILAWENSSVL--DTW------------GEDGTCNDIVGCDASLYPPF--RTQGSSVNIFSTDICRSVRVDF-SEVSSFSGIESYKYEVGKDMLSSPLTNPENQCFCLNRTQGIRGTDG-------CLL--DGAMELWDCQGAPVVLSHPHFYLADESYQNGVDGLSPNRSLHEIFLELEPITGTLLRGSKRVQFNIFLRPISRISLTTNLPT-TLMPIVWIDESVELTDELIDELNASLFDVLDLVNTILWGVIAG---GAVLFVIGFVWMLISCCRSRSA 502          
BLAST of EMLSAG00000005382 vs. nr
Match: gi|1000733478|ref|XP_015589176.1| (PREDICTED: sensory neuron membrane protein 2-like [Cephus cinctus])

HSP 1 Score: 209.149 bits (531), Expect = 2.419e-57
Identity = 154/539 (28.57%), Postives = 258/539 (47.87%), Query Frame = 0
Query:    8 VILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIIN-PVL--LTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDT-FLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAF--FKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFS--MSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVG 538
            +I+  + I++   G  L+  + P +++ Q+ +++ L  GT+ +  ++E P P+      F++ N  EV  G  P + E+GPY Y +   K N+ + NS  LSY +   +EFDE  ++          P +++D ITI+N P++  +T+A+   G   +        +N+    +     ++FI       L+ G       I+   +T FL ++   +   +E + P+               +LS+G F F  F  KN +         +GR+   S ++ V   G+       W N     T +   E  +C+ IYG+D T FPPF     +  + +F  ++CRT+ +E+  +  + G I  +RY   +R+ +    NP+N C+C       +  D        CL   DG +++  C GAPI +S PHFL AD + Q+ V GL PN   H  ++D+EP  G PLR  K++Q N+ LR V  I L   + +  L+P+FW DEG EL+ E  EEL   LF  +       I  G+++G
Sbjct:    7 IIILTIGILVAGAGAFLRYWLFPLLVEQQVTKSVKLIAGTDAYERWEELPIPIIFKVYFFNVSNPEEVHEGGTPNVTEIGPYIYNQYRSKVNITQDNSDVLSYYQNAIYEFDENASY----------PLTEHDSITIVNLPLMSVITVAEHTAGSSYSQ----LTALNSAVNTIFSNPSNVFIETTPRDFLFDG-------IYLMCNTSFLSIITRTVCNRIEENAPVTMP------------RLSDGRFRFSLFDHKNNSN--------DGRYSINSGVDNVSLLGE----ILSWENSTMVDTWR---ENSTCNNIYGSDSTIFPPF--RTPESDVNIFNTDICRTVRLEYMEDSTLSG-IIGHRYVSEERMLASPTKNPDNECFCLNKTKGIRGDDG-------CLL--DGTIELWDCQGAPIVLSLPHFLLADGQYQSGVNGLNPNVSLHRIFIDLEPYTGMPLRGSKRVQFNIFLRTVNRIALTANL-NTVLMPIFWIDEGMELNDELIEELQTSLFDVLR--TLTIIQCGFIIG 482          
BLAST of EMLSAG00000005382 vs. nr
Match: gi|998513554|ref|XP_015517412.1| (PREDICTED: sensory neuron membrane protein 2 isoform X2 [Neodiprion lecontei])

HSP 1 Score: 208.764 bits (530), Expect = 3.102e-57
Identity = 154/540 (28.52%), Postives = 254/540 (47.04%), Query Frame = 0
Query:   18 IIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFD--SKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAF--FKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFS--MSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTV------GIALGYVVGPILLIVS 545
            + GG+ +   ++P +I  ++ E++ L EG++ F  ++  P PV      F++ N ++V  G  P++ E+GPY Y++   K N+   +   LSY ++  +EFDE            + P ++ D IT++N  L+++A   +    +       ++N+    +      +F+T      L+ G      S  I + L                          EN   +  P +LS+G F F     KN T    YY+I +G  D      I+ +   + L    W             E G+C+ I G D + +PPF    +   + +F  ++CR++ V+F SEV    GI +Y+Y VGK + S  ++NPEN C+C       + TD        CL   DG M++  C GAP+ +S PHF  AD+  Q  V GL PN   H  +L++EP  GT LR  K++Q N+ LR ++ I L   +    L+P+ W DE  EL  E  +ELN  LF  + + NT+      G A+ +V+G + +++S
Sbjct:    3 VAGGL-VGYLVIPDIIDERVEESVKLVEGSDAFERWQNVPVPVLYKIYFFNVSNPDDVQNGLQPIVEEIGPYVYKQYRTKINIAAADD-VLSYYQHQLYEFDE----------EASAPLTEYDDITVVNLPLMSIATVAEYNSGSTLLSQLTLLNSAISTIFQSPTSVFLTTTPRDFLFDGVYVYCNSTGIINSL---------------------VCNQIENYAPVTMP-RLSDGRFKFSLLSHKNDTN-DGYYSINSGLNDVSQLGEILAWENSSVL--DTW------------GEDGTCNDIVGCDASLYPPF--RTQGSSVNIFSTDICRSVRVDF-SEVSSFSGIESYKYEVGKDMLSSPLTNPENQCFCLNRTQGIRGTDG-------CLL--DGAMELWDCQGAPVVLSHPHFYLADESYQNGVDGLSPNRSLHEIFLELEPITGTLLRGSKRVQFNIFLRPISRISLTTNLPT-TLMPIVWIDESVELTDELIDELNASLFDVLDLVNTILWGVIAGGAVLFVIGFVWMLIS 480          
BLAST of EMLSAG00000005382 vs. nr
Match: gi|1073718178|gb|JAU02017.1| (putative plasma membrane glycoprotein cd36, partial [Amblyomma sculptum])

HSP 1 Score: 203.371 bits (516), Expect = 2.864e-55
Identity = 163/548 (29.74%), Postives = 253/548 (46.17%), Query Frame = 0
Query:    8 VILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKE-NLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIIN-PVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSN--PENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSF 550
             I G++ +V ++G I       P +++ ++ E L L+EG+E  + +     P+Y+S+ LF+I N  E   GE   + +VGPY YRE  +KE    ++    + Y     F F+ + +             +++D + +IN PV+   A     +P+    +   I+++    +    E L     V ++L+ G+                      Q  L  D+   AK F  + K+ +P  L   TF  F  +N +     Y++  G  D   F  + ++N    L    W              G +C+ I GTDG QFPPFL   K   L++F  +LCR++Y  +E + EV G I A+R+ +   +F  ++   EN C+C                LS  +  K GV  VSAC  GAPI +S PHF Q D++    V GL PN E H T+LDI P  G  +RA K++QIN+ LR+   + LLK V D  + P+ W +E AEL    AEE    +     IGN   IA G +VG +   +  I+ F
Sbjct:    5 AICGVILLVGVLGHI-----YFPTIMRGKVAEQLQLKEGSETLDKWSNVKVPIYMSFQLFNITNPEEFGAGELADVKQVGPYVYREYRKKEIQGFDKERNTVQYYDRKSFVFEPSMSAG-----------TEDDMVNVINVPVVAISALTGKKVPEMAAPLIMPIVDS---MMRKHNETLATRRSVREMLFGGY----------------------QVGLMRDLIRLAKAF--LPKLENP--LKNNTFGLFFERNNSH-DGLYSVYTGEGDPAKFAKLEQWNNLRNL--TYW-------------AGPTCNMINGTDGGQFPPFL--SKDSTLYVFSTDLCRSMYFRYEKDTEVHG-IRAWRFTIPATLFESADVREENRCFC----------------LSSPVCPKSGVTHVSACRKGAPIVLSSPHFYQGDEDFVRAVHGLRPNKEMHETFLDIHPLTGLVMRASKRLQINVDLRRNDRLTLLKNVQD-TVFPVVWIEERAELAPAMAEEFKQKVEFPQKIGNAT-IASGLIVGGVGSCICAIMVF 470          
BLAST of EMLSAG00000005382 vs. nr
Match: gi|91092044|ref|XP_970008.1| (PREDICTED: sensory neuron membrane protein 2 [Tribolium castaneum] >gi|270004920|gb|EFA01368.1| Sensory neuron membrane protein 2-like Protein [Tribolium castaneum])

HSP 1 Score: 203.756 bits (517), Expect = 3.169e-55
Identity = 154/563 (27.35%), Postives = 266/563 (47.25%), Query Frame = 0
Query:    5 SIRVILG--LLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRG-EPPVLLEVGPYSYRETMRKENLMEQNSR--YLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLP-KTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFD---SKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSFYQRYREKR 558
            +I+V+L   ++S+ L+I  ++L   + P +++S++ + + L +GT+ ++ F E P PV     LF++ N  +V+ G E P L E+GP+ Y++  RK+ ++ +N     +SY +   FEFD             + P ++   +T++NP L+++    + L      D C +     N+        +FI   V K+L+ GF    + S  I   ++  L+  +   + + +L +P    D+  I             F++   K        YT++ G  + E   +IV +N               S+  +   EG +C  + GTD T +PP +     F  +++  ++CR + + ++ E E   GI  Y +   +     S PE  CYC +          D      C    DGV+D+  C+G P+  S PHFL AD +  + V+GL P  EKH TYL +EPN GTPL+  K+IQ+N V+R + GI  + +     L+P+ W +EG  L  +  +EL +  F  + I + V  AL  V+  IL+    I+   +R   K 
Sbjct:    7 TIKVLLVCVVISVALLIVSLALAFKVFPDLLESEVNKAVRLEDGTKQYDRFVELPFPVDFKVYLFNVSNPQQVLDGTEKPKLEEIGPFVYKQ-YRKKTILGKNEEEDTISYTQKETFEFDA----------EASKPLTEESVVTVLNPALMSIYQLAEDLHLAGAADTCIKQTFENNQG------KVFIEANVRKLLFDGFSFCKNTSPGICGLVND-LICAIAATKRNSDLVLP----DYSLI-------------FSYLNYKRKPD-DGKYTVKRGLTNIEKLGHIVAWND--------------SLYTKFWGEGTTCSEVKGTDSTLYPPRVTTDSAF--YIYSTDICRFVKINYKGE-ESYKGIDGYLFETSEDTLRSSAPEEDCYCSKL-------SRDMEGKKSCFL--DGVIDMQTCFGVPVLFSFPHFLWADNKYLSAVEGLNPVEEKHKTYLVVEPNTGTPLKGMKRIQLNGVIRPIVGIKSMLQTKR-ALLPLLWIEEGVSLPQKYVDELKSSYFDKVQIVDGVRYAL-IVISAILVGAFGIIILRKRSHAKH 505          
BLAST of EMLSAG00000005382 vs. nr
Match: gi|1067085142|ref|XP_018026485.1| (PREDICTED: lysosome membrane protein 2-like [Hyalella azteca])

HSP 1 Score: 202.216 bits (513), Expect = 1.065e-54
Identity = 156/540 (28.89%), Postives = 254/540 (47.04%), Query Frame = 0
Query:   10 LGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLM-EQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAE-DLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSI 546
            + L  +++++ G+     I P ++K Q+ + L L E +E    F  PP P+++ + +F++ N   V+ GE  VL ++GP++Y E   K +L  E   + + Y +   F F    ++ L          +++  +T++NPVL++L  K   LP     I         + L ++ +   FIT +   +LY G+D                LLE  Q S     PI A                 G F FF  KN +     Y I  G     +   I EF  +  LP   W    T +          C+ I GT+G+QFP  +   KK  L M+  +LCR++Y +FE ++   G +   RY +   V + S PEN C+C + F+C                 +D ++++S C  G+P+  S PHF    +E    V GL P  E+H TYLDIEPN G   RAHK++QINM L++   +  L+KV +  ++P+ W +E A +  E+A+ LN  L   + +   V IA+   +G I+L++++
Sbjct:    9 MSLFGLLILVLGVVFP-QIFPGIMKKQLEKKLVLSEDSETIGNFISPPVPIFMQFYIFNVTNAPAVLEGEKAVLDQIGPFTYEEKRMKFDLFWELEDKTVEYQQNKTFFFRADMSNGL----------TEDTLLTVVNPVLISLGAKFSRLPSLTHGIL--------QLLALRHDMSPFITRKAGHLLYHGYDEP--------------LLE--QLSPLTRNPIHAM----------------GKFGFFFPKNHSS-DGIYRIHTGAQGLNTLQVIDEFQEEPMLP--YW---LTDV----------CNMINGTEGSQFPQPITEDKK--LMMYSSDLCRSLYFKFEKKIN-HGDLVLNRYTLPYEVLAKS-PENDCFCSDDFTC-----------------RDSMVNLSPCKDGSPVVASTPHFYMGTEETINDVVGLNPVKEEHETYLDIEPNTGVTFRAHKRLQINMPLKRYEALPDLQKVREV-ILPIMWLNESAVVPVERADALNAKLTVPLIVVRYVCIAM-VAMGVIILLLAL 458          
BLAST of EMLSAG00000005382 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold427_size174323-snap-gene-0.42 (protein:Tk04509 transcript:maker-scaffold427_size174323-snap-gene-0.42-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_326408")

HSP 1 Score: 365.54 bits (937), Expect = 1.583e-120
Identity = 202/550 (36.73%), Postives = 308/550 (56.00%), Query Frame = 0
Query:   14 SIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKL----DGLP--KTVKDICFEIINNGNEAL----GIKAED-LFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLK-CKDGVMDVSACYGA-PIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSF 550
             I+L++ G  L+  I P +++ Q+Y+ LDLREGTEG+ A+ +PP PV++++  F++ NT  V  G  P L+E+GPY +RE   K++++E N+ +L YG Y  + +D+  T +  C+N    PCS+ D++TI+N VL  +A  L    DG P    +KD+     N+G E       I  ED LF T  V    + G  S S              L+ ++ SLE+           + +I  P +     F FF GKN TK   Y+TI NGR+ +  F+ + +FNG+  L E  WP V  + +   S  GG CH I GTDGTQFP ++   K+   W+FV E+CR+I++++  + +    I AY Y   + VF M NP NFCYC  F  C  +  ND ++  +C K CKDG++ V +CYG  P+ M+ PHF + D+ + + V G++P+ E H T + +EP  G PL AHK+IQIN+ L+K   +  L+KV D  L P+ WADE A ++ E A+   N L     +   + IA G+++G  L++V I + +
Sbjct:   16 GIILVVFGACLQWVIFPIVLEDQLYKQLDLREGTEGYKAWLDPPVPVFMNFYFFNVTNTAAVATGAKPELVEIGPYCFREDRLKQDILELNAEHLQYGLYLAYHYDQAETERQGCQNGSGQPCSRTDQVTILNVVLAAIAQLLGNAADGNPLLPVLKDLLI-TFNDGVEGKLAPDCIDCEDELFTTASVLDFTFEGVPSGS--------------LKALKHSLEIHATTGILGILGLDEIPLPEE-----FFFFMGKNGTKNNQYFTINNGRYTRNKFLEVEKFNGETTLKEKWWPRVGPTPSATASGMGGICHDILGTDGTQFPAYI--DKRVRRWLFVPEMCRSIWLDYVKDTKFL-DIDAYEYRASEDVFDMDNPNNFCYCPGFLDCKIEEPNDTYNNIECKKTCKDGMIFVGSCYGGVPVVMTAPHFFRGDESLISDVIGIKPDLELHDTIMLVEPLSGAPLMAHKRIQINLDLKKSKYVTKLEKVKDL-LFPVIWADENAGINDELADLYKNTLVLIENLVLGISIAFGFILGAALIVVGIFMCW 541          
BLAST of EMLSAG00000005382 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold92_size382268-snap-gene-1.19 (protein:Tk08744 transcript:maker-scaffold92_size382268-snap-gene-1.19-mRNA-1 annotation:"scavenger receptor class b member 1")

HSP 1 Score: 142.51 bits (358), Expect = 2.484e-36
Identity = 130/510 (25.49%), Postives = 218/510 (42.75%), Query Frame = 0
Query:   18 IIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRG-EPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVF--SMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC-YGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAI 523
            ++G ++    +   +++  + + L LR  ++  + ++EPP   +L    F++ N  +V  G E P L EVGPY Y +   KEN+    +  +SY     + F             ++     ND IT +N  +LT                F  + + N         LF    +  +LY+            LD    L   V +     D P+    FE + ++  P   +   F  F  KN +     YT+  G  D      I  FNGK  L    W             +   C+ + G+DG+ F P++  ++   LW F  +LCR++ + +   V  +  I  YR+   + VF    + PEN C+C         TD D      C    DG+  +S C + API +S PHF+ A++     V+G+ P  ++H  Y D++P  GT L A  +IQIN+ ++     D + K+ D  +IP+ W +EG +   E  ++L  ++ SA+
Sbjct:   54 LVGLMAFVYVLFDPVVRHIVLKKLVLRNSSDVAHLWEEPPITPHLKIYFFNLTNPEQVFEGLEKPKLDEVGPYVYHQKWIKENVAWHGNGTMSYSTRKIYTF----------MPELSEGHHSNDVITTLNIPMLT---------------SFYQMRDAN---------LFTAWGLSTVLYS------------LDYKPWLNKTVEELVWGYDEPL----FE-LARMTLPNPPTFDKFGLFFDKNTSGPLAKYTMFTGERDPYKLSKISSFNGKAHL--DFW-------------KEDKCNLVQGSDGSTFSPYI--QQDETLWFFNDQLCRSLPMTYSETVHTKT-IEGYRFVPREDVFMSPATYPENECFC---------TDPD-----LCDMIGDGMFAISKCQFDAPIILSWPHFMGANRSFLNAVEGMNPREDRHQFYFDVQPVTGTTLAAKARIQINLAVKNSKIFDDISKIND-TVIPILWFEEGLD---ELGDDLMTLISSAV 476          
BLAST of EMLSAG00000005382 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold182_size278544-snap-gene-0.13 (protein:Tk04800 transcript:maker-scaffold182_size278544-snap-gene-0.13-mRNA-1 annotation:"scavenger receptor class b member 1")

HSP 1 Score: 135.191 bits (339), Expect = 5.669e-35
Identity = 121/458 (26.42%), Postives = 199/458 (43.45%), Query Frame = 0
Query:   56 PPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDF-----ENIIK----IISPA-QLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMS--NPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC-YGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFW 500
            PP    L   LF+I N +  + G  P L E+GPY Y E   K ++     ++L+ G+  ++                     +  K    NP                            +A G   ED+     V  I   G    +A    +L   L  +LEV+Q+  E  + ++ +D        +IK    I+ P  Q+    F  F GKN +          G  +  +   I+  +GK+ L    W             +G  C++I GTDG+ F P +  + +  L +F  +LC+++ + ++ +V + G I  YR+     VF+    NP N C+C    S +  +       S+C     G+ ++SAC +G+PI +S PHF QAD  + A V+GLEPN  KH  ++D++P LGT LRA  + Q+N+V+++V  I     + D  ++P+ W
Sbjct:    3 PPIRPQLKVYLFNITNVDAFLAGSKPKLKEIGPYVYDEIWEKVDI-----QWLNLGEQVEY---------------------RQKKTYFFNP----------------------------DASGGTEEDILTVPNVPMITAIGGKMTNAGQLVRLA--LGSILEVLQQ--EPFVAVRVRDLLWGYDHPLIKLGNDILPPEEQIPFDKFGLFVGKNNSATSGLIRALTGLENVRNVGQILSVDGKSNL--DLW-------------KGPHCNQIRGTDGSTFHPDVSREDE--LHIFNKDLCQSLPLVYKEDVSMNG-IPGYRFVPPANVFATPEENPTNACFCMADASPSGSS-------SRC-PTPSGLFNMSACQFGSPIMLSWPHFFQADPRLLATVEGLEPNEAKHQFFIDLQPKLGTGLRAAARTQVNIVIKEVEDIKPAIGLRDI-IMPIMW 375          
BLAST of EMLSAG00000005382 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold10_size831480-snap-gene-1.12 (protein:Tk01807 transcript:maker-scaffold10_size831480-snap-gene-1.12-mRNA-1 annotation:"scavenger receptor class b member 1")

HSP 1 Score: 125.561 bits (314), Expect = 3.110e-32
Identity = 93/343 (27.11%), Postives = 156/343 (45.48%), Query Frame = 0
Query:   56 PPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLME--QNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLP---KTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGK-----NKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQE 388
            PP PVY+ + LF ++N+ +  +GE      VGPYSY+E   K N+ E  ++   L+Y +Y  + FD+  +    C+      C  +D + +IN  LL +    D +P    T+KD+  + I +        ++ LF+T+ VDKIL+ G +  S         +L  +L  + E+L LD+            I+ P    E  FA F G+  T     Y +  G  D   ++ I ++        + L  A W        G       + + + GTDG Q  PF+  + +  +W++  ++CR +Y EF+   EV+ GI    + V KR    +   N+ +C E
Sbjct:    9 PPVPVYMKFMLFTVENSEDATKGEKIRFNIVGPYSYKEDRHKVNISEEFEDQNTLTYAQYKGYAFDQDTS----CET-----CKADDNVIMINAPLLGIISVFDEIPLLGDTLKDMLNKAITS-----DTFSDSLFLTDTVDKILFHGSNPGSVR-------WLFSVLAFVNETLNLDLS----------SILPPVLDQEKGFAVFNGRVNTTNNEAYKVNTGYADLSQYLEIEKWGPSIDVLYDDLTPAGWWKENGGWNGS-----NAANTLKGTDGQQVKPFVTEEDR--VWLYQTDICRVLYAEFQEHKEVD-GIPLLGFVVPKRALQANTKFNYGFCME 312          
BLAST of EMLSAG00000005382 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold972_size74859-snap-gene-0.9 (protein:Tk01032 transcript:maker-scaffold972_size74859-snap-gene-0.9-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_303163")

HSP 1 Score: 119.013 bits (297), Expect = 6.415e-29
Identity = 128/566 (22.61%), Postives = 242/566 (42.76%), Query Frame = 0
Query:   12 LLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEP------PVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDI-CFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESL--ELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSN--PENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC-YGAPIFMSQPHFLQADKE-VQAYVKG-LEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLK----KVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSFYQRYREKRA 559
            ++ +  +  GISL + + P +        + +  G+  +  + E P P++++   F++ N  E++  +P      P L+++GPY + E+  K N       +   G   K +F +  T     +    T    +D +T ++ V L+ A+      +  +D   F +    N+ L ++   LF T  V  + + G+              L  ++E +Q+     + IPI    F                  F+    + +   Y+T+  G    +    I E+   +++    +P+               C  + G+ G  FPP   N+ K  +  F  +LCRTI   ++ E EV G ++ YRY + +   + S+   ENFC+            N   D +  L   +G+++VS C + +P ++S PHF  AD+  +  +  G L+P+   HA YL + P+ G PL    ++QIN ++R +   D+ +    +  D    P+ W +    +D E A  L   +   +  G   G  LG V+G    +V I+L+ Y +++++R 
Sbjct:   10 VVGLAFLAMGISL-LAMFPPLYDHIFESMMKVSPGSYSYGIWHELPIPMFMNIYFFNVTNAEEIMNRDPKGKPIVPQLVQMGPYVFAESHIKTN------EFFEEGTGEKVKFQQVKTWHFVEEESSGT---MDDMVTNVDMVALSAAEYA----RYNEDFYTFTL----NDFLNLQNATLFQTIPVRNLTFDGY--------------LGPIMEAVQDPAFDTIGIPIPYDKFG----------------WFYPRNGSAEYDGYFTMYTGMDTLDHVGQICEWKNASRVDPNVFPH--------------HCGELKGSAGEFFPP---NRDKTFVDFFSPDLCRTIRFNYKEESEVRG-LSGYRYYLDEEFLANSSYVSENFCF------------NPTPDPT--LHLPNGMLNVSTCKFNSPAYVSFPHFYLADEALIDQFPPGTLKPDPSLHANYLSLMPDTGVPLEVKIRMQINGLVRSLTKQDVYQIDIYEGLDPIFYPLIWFETTTGVDEEIASLLR--ILPRLNAGFLWGPILGIVLG----VVLILLAGYIQFKDRRT 489          
BLAST of EMLSAG00000005382 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold683_size112676-snap-gene-0.13 (protein:Tk08733 transcript:maker-scaffold683_size112676-snap-gene-0.13-mRNA-1 annotation:"scavenger receptor class b member 1")

HSP 1 Score: 117.087 bits (292), Expect = 5.359e-28
Identity = 123/492 (25.00%), Postives = 207/492 (42.07%), Query Frame = 0
Query:   33 IKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEP-PVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDS-----------KSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQL---SEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRI-YGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFS--MSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLI-PMFWADEG 504
            I+ QI +NL L +G+E F  ++ PP    +   +F++ N ++ + G+  P++ EVGPY+Y + M   +    +   + +     F FD  ++  L  +          D + + N  L     KL   P   K I  EI+ + + A   + +  F++  V + ++ G+DS           +  A  D    F       I  +LE D   K     N+        +   ++ +F     +N TK Q+   I  G    E    +V + G             T++    SSE   C+ I   +D    P  L  +K   L ++V ELCR +  +++ E+  +G +   R+      F     NPEN CYC                LSQ    K G+ D+ +C  G+PI MS PHFL  D E++  V G+ P+  +H  ++D+EP  G  L A  + Q+N+ + K  G      +    ++ P  +  EG
Sbjct:   79 IQGQILKNLPLSQGSEAFEGWRNPPVHPIMYLFIFNLTNQDDFLSGKSKPIVEEVGPYAYVQNMSMTDAEFPSFDIVRFNMQRNFTFDPEDSMGLDYE----------DTVIVPNIPLFGAMHKLAKDPAFAKGIFLEILESYDFA---QDKAPFLSLTVKEFIW-GYDSILLSLKRTEDPRCVANKDGWSDFDDF--GDIDSTLESDAEPKETKVSNVEDNTIDCDIRASNQDSFGLMSIRNVTK-QDLREINTGGTKIELKGRMVSYEGN------------TNLDFWASSE---CNSIKSSSDPAALPMNL--QKSSALDVYVAELCRKLDFKYDQEIFYDG-VKTLRFLPLNNSFDNPQDNPENECYC----------------LSQPCTRKSGLFDIESCKPGSPILMSWPHFLFGDPELKNGVIGINPDPSRHQFFMDVEPTYGFTLSAMAQFQMNVKIEKNNGFGFFDNINSQEVVLPFCYLKEG 519          
BLAST of EMLSAG00000005382 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold472_size162276-snap-gene-0.29 (protein:Tk12252 transcript:maker-scaffold472_size162276-snap-gene-0.29-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_303163")

HSP 1 Score: 116.316 bits (290), Expect = 1.677e-27
Identity = 125/560 (22.32%), Postives = 232/560 (41.43%), Query Frame = 0
Query:   11 GLLSIVLIIGGISLKMH----ILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVI-RGEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFD-ETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQN-YYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSN--PENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC-YGAPIFMSQPHFLQADKEVQAYVK--GLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSFYQRYREKR 558
            GL  I L   G+ +       I P + +  + + + ++EGT  +  +     P++    LF ++N +E + + E P L++ GPY++RE  RK+++M  ++  +SY     + F+ E +   L            +D IT +N  ++  A+   G       +     N G++        LFI + V ++L+ G++          DT L L     QES    IP+                     F +F  +N T   +  + +  G  D      I  +N +N+               Q   E   C RI+G+ G  +PP    + +  L +F  E CRT+   F+ +  +E  +    Y + +  F+     P N+C+     S                    GV + + C   +P ++S PHF QAD   Q+  +   ++P+ ++H + + +EP  G P+    ++QIN+ +  + GI  L  V      P+ W +  A      A+ +  +L     I N +G+ L  ++G I +I+ + +  Y+ Y + +
Sbjct:   23 GLTCICLAFVGLMVSSAGFVVIFPHLFQKILSQQMTIKEGTPAYKEWMATSVPIFTKMYLFSLQNPDETLAKTEKPKLIQRGPYTFREVERKDHVMFNDNHTVSYQVKKNWYFEPEMSVGTL------------DDIITTVNVPMIGSAEASRGQFFMQWGLSSTFDNIGSQ--------LFIKKTVRELLFEGYE----------DTLLALADWFGQES---SIPLD-------------------RFGWFYKRNGTTWADGTFNMYTGERDIAEMGKINHWNYENRT--------------QFDDE---CGRIHGSAGGFYPP---GEARKSLLLFSHEACRTLSFNFKGKQSIEN-VPGLMYKLDETTFANETVYPPNYCFHNNLPS--------------------GVQNSTQCKQDSPAYISFPHFYQADPFFQSQFQDGSIQPDGDRHESRIVLEPLTGIPMEVLIRLQINVRIDPIQGISALANVPKEFYFPVIWFEAHAVATPSVAQTI-ALLVQMPQIANLIGVIL-VMIGLIGVIICVSIRCYRFYVQPK 487          
BLAST of EMLSAG00000005382 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold513_size150706-snap-gene-0.21 (protein:Tk02893 transcript:maker-scaffold513_size150706-snap-gene-0.21-mRNA-1 annotation:"-like protein 2")

HSP 1 Score: 103.99 bits (258), Expect = 2.681e-23
Identity = 124/543 (22.84%), Postives = 221/543 (40.70%), Query Frame = 0
Query:   29 LPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVL--LEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQ------CLKC-KDGVMDVSAC-YGAPIFMSQPHFLQADK-EVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLR---KVAGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVG--IALGYVVGPILLIVSIILSFYQRYR 555
            LP ++ +QI + L +   ++ F+ ++ PP    L   LFH  N  + + G    L   EVGP  Y+ET  K N+ E +   ++Y     F F    T       R++     +  IT+ N  LL+ A                                 I +E   +   GF +   +I      F+   L+ +    E  +   A  F    +I  P     G F  F G N T L   ++I  G  +      +V +N         W                 C+++ G +G  FP    ++    L +FV  +CR++ + F+  V +  GI + R+    + F     +N CYC      + Q +N  W  S        + C  +G+ DV  C +GAP+ +S PHFL  D  ++   ++GL+   E H+  +D+ P LG  L A  ++Q+N+ L     +A +  L   +   ++P+ W +   +   +  E+L   L  + ++G+ +   +A+  V+  +  +V + +++  R R
Sbjct: 3201 LPGLVHNQIMDQLVISPESDLFDFWRHPPLNPDLKLYLFHYANVAQWLNGSETTLKIAEVGPIVYQETWIKSNI-EFDEGLVTYDLVKVFHFQSNQT-------RVDL----DQLITVPNVPLLSAA--------------------------------AILKESGTLAQMGFQTALQSIPIHPTPFVSKTLQEVMWGYEDPLVDLASAFLPPEEIKVP-----GRFGIFSGHNGTSL-GRFSIRTGSSNPRDIGRMVMWNNLEHF--DAW-------------NTHECNKVSGYEGMVFPIDGADQ----LNLFVPNMCRSLPLVFQEHV-MHYGIKSMRFVPHGQAFDYEQEQNHCYCD-----SDQVNNSTWFESHLKNRWNTVPCVGNGLFDVGPCKFGAPLVVSWPHFLYVDPLDLVQGLQGLDAKPELHSFSIDLHPELGLALSAMIRLQLNVRLSFDPHMAELQALPTQSQGMVLPLVWFENSIQ---DLPEDLVGTLRRSSSLGSNLCHVLAVFLVMTLLFQLVGLAVAYLIRSR 3665          
BLAST of EMLSAG00000005382 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1209_size55568-snap-gene-0.8 (protein:Tk03740 transcript:maker-scaffold1209_size55568-snap-gene-0.8-mRNA-1 annotation:"scavenger receptor class b member 1-like")

HSP 1 Score: 102.064 bits (253), Expect = 4.943e-23
Identity = 83/316 (26.27%), Postives = 133/316 (42.09%), Query Frame = 0
Query:  253 FAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFS--------MSNPENFCYC--QEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSAC---YGAPIFMSQPHFLQADKEVQAYVKGLEPNSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKV--AGIDLLKKVADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSFYQR 553
            +  F+ +N T ++      +G  D      + E+NGK+ L    W              G  C +  G D +  PP +    K  L +F+  +CR I +E+E +V    GI   R+   K              NP+N CYC  +E F C K                 GV+++  C     AP+ +S PHF  AD      V GL+P  EKH  YLD+ P  G PL    + Q+N+++ +   +  + ++ + +  L+P  WA +G +  SE   E      SA      +G  +  ++G + L   +   F+QR
Sbjct:  307 WGLFRDRNVT-MREPVRFFSGVGDLHMKGVVKEYNGKDHL--GWW------------KPGSVCDQAKGQDSSTLPPGITKNDK--LDIFISLMCRGIVLEYEQDVN-HAGIRTLRFIPPKNALGAHDDPNPEFKNPDNECYCLEEEGFRCFKS----------------GVLNMEPCKRETNAPLALSMPHFYDADPYYGQMVGGLKPEKEKHQFYLDVMPEFGFPLAIRPRFQLNILIGRYMSSTWEAIQGMQEELLVPFLWAQDGFDEPSEVMAEQLLFGLSAPKKVPMMGAVVCLLIGAVCLAACLGYFFWQR 588          

HSP 2 Score: 52.7582 bits (125), Expect = 1.792e-7
Identity = 32/117 (27.35%), Postives = 63/117 (53.85%), Query Frame = 0
Query:   11 GLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLK 127
            G++ I+ +I GI + + +   +++ +I  ++ L EG++   ++  PP   +L+   FH+ N   V+ G+ P+L E GPY Y  T  K++  + N          +F  D+T T++L+
Sbjct:   46 GVIGILFVILGIVVLL-MGEGLLREKIVSSMALAEGSDRLQSWLHPPVQPHLTGYAFHVTNPEAVLAGKKPILEERGPYVYTSTNVKDS--DDN---------IQFHDDDTITYRLR 150          
BLAST of EMLSAG00000005382 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold367_size194084-snap-gene-0.38 (protein:Tk00496 transcript:maker-scaffold367_size194084-snap-gene-0.38-mRNA-1 annotation:"scavenger receptor class b member 1-like")

HSP 1 Score: 78.5666 bits (192), Expect = 1.335e-15
Identity = 129/558 (23.12%), Postives = 218/558 (39.07%), Query Frame = 0
Query:    6 IRVILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGFNAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPV--LLEVGPYSYRETMRKENLMEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLLTLADKLDGLPKTV---KDICFEIINN---GNEALGIKA-------EDLFITEEVDKILYTGFDSKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSEGTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNVATSITGQLSSEGGSCHRIYGT-DGTQFPPFLFNKKKFPLWMFVGELCRTIYVEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDEWDLSQCLKCKDGVMDVSACY-GAPIFMSQPHFLQADKEVQAYVKGLEP-NSEKHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKK-VADFRLIPMFWADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIV 544
            I  + GLLS+V  +  + L   +  + ++ Q+ +    R  +  F A+K+PP        +F++ N  +V+ G      + E+GP+ Y     K        R +++G        ++ T      +    P   +  + + N +++T   K +  P+     ++I + I+ +   G   L +         ED     + D +   G   +S   FD  D FL     V         P     F  ++                 G+N +  +   TIE G     S   +VE +G++    A  P+              SC RI G  + +  PP   +       + +G +CR+I +E  + V   G I ++RY      F+ ++   F           Q   DE      L+   G M V+ C  GAP+ +S PHF          V GL P  +  H  Y+D+EP LG PL    + Q++++L        L K V +  L+P+FW  EG    S   +ELN V F  + + N V + L  V     L++
Sbjct:   54 ITGVCGLLSVVCALICVVLYEDVH-SWVRYQLTQETIFRNDSLFFEAWKDPPITPKTKVFVFNVTNHEQVLAGTASQFEVRELGPFVYTARTIK--------RVIAWGHGGATLTFQSKTTYHYVADESAYPDDTSTFVIVPNILMMTGMLKTEVRPQPAFVKQNIVWPILTSAGFGTPFLNLSVASFVWGYEDELGCLDSDPV---GQHEESPFAFD--DDFLDPGPRVTPPKRNYRQPDGRCVFGTLV-----------------GRNDS-WEAPITIETGLTGLGSKGRVVEADGRSSF-RAWRPD-------------SSCDRITGNFEPSALPPQAGDSFN----LLLGIMCRSIRMEHVANVSY-GQIQSHRYVPYNHSFNFTSDSCF-----------QPLGDE------LRLAPGAMRVATCTEGAPLLVSFPHFHGGSDWYLNQVHGLTPAQAHLHLPYIDLEPTLGAPLGIQIRFQVSLLLESDPNFPPLAKLVRNQLLLPVFWVQEGYH--SPLQKELNLVAF-GLHLPNYVALGLPVVFAVTALVM 540          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000005382 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-1.765e-4626.63symbol:SCARB2 "Uncharacterized protein" species:90... [more]
-1.897e-4622.88symbol:Snmp2 "Sensory neuron membrane protein 2" s... [more]
-5.079e-4625.35symbol:scarb1 "scavenger receptor class B, member ... [more]
-7.392e-4629.58symbol:SCARB2 "Uncharacterized protein" species:98... [more]
-9.425e-4627.69symbol:Scarb2 "scavenger receptor class B, member ... [more]
-5.291e-4527.83symbol:Scarb2 "Lysosome membrane protein 2" specie... [more]
-5.291e-4527.83symbol:Scarb2 "scavenger receptor class B, member ... [more]
-1.157e-4429.01symbol:SCARB2 "Lysosome membrane protein 2" specie... [more]
-1.325e-4429.60symbol:SCARB2 "Uncharacterized protein" species:99... [more]
-5.315e-4425.91symbol:wu:fi18e02 "wu:fi18e02" species:7955 "Danio... [more]

Pages

back to top
BLAST of EMLSAG00000005382 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592863402|gb|GAXK01094160.1|2.823e-9233.72TSA: Calanus finmarchicus comp48559_c0_seq1 transc... [more]
gi|592863401|gb|GAXK01094161.1|1.365e-8833.33TSA: Calanus finmarchicus comp48559_c0_seq2 transc... [more]
gi|592863399|gb|GAXK01094163.1|1.313e-6838.29TSA: Calanus finmarchicus comp48559_c0_seq4 transc... [more]
gi|592863400|gb|GAXK01094162.1|1.442e-6838.29TSA: Calanus finmarchicus comp48559_c0_seq3 transc... [more]
gi|592884670|gb|GAXK01073705.1|1.707e-5128.37TSA: Calanus finmarchicus comp2078499_c0_seq1 tran... [more]
gi|592798960|gb|GAXK01155608.1|7.988e-3927.21TSA: Calanus finmarchicus comp104175_c0_seq1 trans... [more]
gi|592768285|gb|GAXK01186283.1|2.229e-3126.40TSA: Calanus finmarchicus comp44521_c1_seq2 transc... [more]
gi|592768286|gb|GAXK01186282.1|2.409e-3126.40TSA: Calanus finmarchicus comp44521_c1_seq1 transc... [more]
gi|592782573|gb|GAXK01171995.1|6.947e-3027.64TSA: Calanus finmarchicus comp62738_c1_seq1 transc... [more]
gi|592861190|gb|GAXK01096372.1|1.868e-2725.14TSA: Calanus finmarchicus comp54192_c3_seq1 transc... [more]

Pages

back to top
BLAST of EMLSAG00000005382 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 5
Match NameE-valueIdentityDescription
EMLSAP000000053820.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s28:642972... [more]
EMLSAP000000066203.468e-3632.27pep:novel supercontig:LSalAtl2s:LSalAtl2s364:51192... [more]
EMLSAP000000090736.206e-3630.36pep:novel supercontig:LSalAtl2s:LSalAtl2s56:118096... [more]
EMLSAP000000032241.292e-3025.44pep:novel supercontig:LSalAtl2s:LSalAtl2s177:51211... [more]
EMLSAP000000039244.269e-2425.07pep:novel supercontig:LSalAtl2s:LSalAtl2s211:13153... [more]
back to top
BLAST of EMLSAG00000005382 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|374253753|sp|Q7Q6R1.5|SNMP2_ANOGA3.355e-4925.57RecName: Full=Sensory neuron membrane protein 2[more]
gi|332321748|sp|P86905.1|SNMP1_APIME2.410e-4727.19RecName: Full=Sensory neuron membrane protein 1[more]
gi|374253737|sp|E1JI63.1|SNMP2_DROME3.895e-4722.88RecName: Full=Sensory neuron membrane protein 2; S... [more]
gi|50400807|sp|O35114.3|SCRB2_MOUSE1.612e-4627.69RecName: Full=Lysosome membrane protein 2; AltName... [more]
gi|126291|sp|P27615.2|SCRB2_RAT9.740e-4627.83RecName: Full=Lysosome membrane protein 2; AltName... [more]
gi|2498525|sp|Q14108.2|SCRB2_HUMAN2.206e-4529.01RecName: Full=Lysosome membrane protein 2; AltName... [more]
gi|544584795|sp|C3U0S3.3|SNMP2_AEDAE9.055e-4526.89RecName: Full=Sensory neuron membrane protein 2; S... [more]
gi|37999904|sp|Q8WTV0.1|SCRB1_HUMAN1.902e-4327.02RecName: Full=Scavenger receptor class B member 1;... [more]
gi|332321722|sp|E0W3E3.1|SNMP1_PEDHC1.507e-4028.21RecName: Full=Sensory neuron membrane protein 1[more]
gi|48474224|sp|Q8SQC1.1|SCRB1_PIG8.184e-4025.27RecName: Full=Scavenger receptor class B member 1;... [more]

Pages

back to top
BLAST of EMLSAG00000005382 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
gb|EFA01368.1|6.478e-5827.35Sensory neuron membrane protein 2-like Protein [Tr... [more]
gb|KFM67984.1|5.640e-5527.12Lysosome membrane protein 2, partial [Stegodyphus ... [more]
EFX72214.13.739e-5429.05hypothetical protein DAPPUDRAFT_326408 [Daphnia pu... [more]
EAA11629.41.647e-4925.00AGAP005716-PA [Anopheles gambiae str. PEST][more]
EFX73750.18.827e-4927.39hypothetical protein DAPPUDRAFT_307609 [Daphnia pu... [more]
AGB94234.11.888e-4722.88sensory neuron membrane protein 2, isoform D [Dros... [more]
ACZ94643.11.888e-4722.88sensory neuron membrane protein 2, isoform C [Dros... [more]
ABI31242.12.128e-4723.31sensory neuron membrane protein 2, isoform B [Dros... [more]
XP_016770009.14.278e-4727.19PREDICTED: sensory neuron membrane protein 1 [Apis... [more]
XP_006562934.14.278e-4727.19PREDICTED: sensory neuron membrane protein 1 [Apis... [more]

Pages

back to top
BLAST of EMLSAG00000005382 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|858945681|gb|AKO62849.1|1.825e-6530.53scavenger receptor B1 [Marsupenaeus japonicus][more]
gi|941507801|gb|ALK82306.1|2.374e-6229.12scavenger receptor class B type I protein [Macrobr... [more]
gi|1061475003|gb|ODM93105.1|1.209e-6030.82Scavenger receptor class B member 1 [Orchesella ci... [more]
gi|1005968303|ref|XP_015791952.1|5.723e-6030.18PREDICTED: platelet glycoprotein 4-like [Tetranych... [more]
gi|998513552|ref|XP_015517411.1|6.297e-5927.58PREDICTED: sensory neuron membrane protein 2 isofo... [more]
gi|1000733478|ref|XP_015589176.1|2.419e-5728.57PREDICTED: sensory neuron membrane protein 2-like ... [more]
gi|998513554|ref|XP_015517412.1|3.102e-5728.52PREDICTED: sensory neuron membrane protein 2 isofo... [more]
gi|1073718178|gb|JAU02017.1|2.864e-5529.74putative plasma membrane glycoprotein cd36, partia... [more]
gi|91092044|ref|XP_970008.1|3.169e-5527.35PREDICTED: sensory neuron membrane protein 2 [Trib... [more]
gi|1067085142|ref|XP_018026485.1|1.065e-5428.89PREDICTED: lysosome membrane protein 2-like [Hyale... [more]

Pages

back to top
BLAST of EMLSAG00000005382 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 11
Match NameE-valueIdentityDescription
maker-scaffold427_size174323-snap-gene-0.421.583e-12036.73protein:Tk04509 transcript:maker-scaffold427_size1... [more]
maker-scaffold92_size382268-snap-gene-1.192.484e-3625.49protein:Tk08744 transcript:maker-scaffold92_size38... [more]
maker-scaffold182_size278544-snap-gene-0.135.669e-3526.42protein:Tk04800 transcript:maker-scaffold182_size2... [more]
maker-scaffold10_size831480-snap-gene-1.123.110e-3227.11protein:Tk01807 transcript:maker-scaffold10_size83... [more]
maker-scaffold972_size74859-snap-gene-0.96.415e-2922.61protein:Tk01032 transcript:maker-scaffold972_size7... [more]
maker-scaffold683_size112676-snap-gene-0.135.359e-2825.00protein:Tk08733 transcript:maker-scaffold683_size1... [more]
maker-scaffold472_size162276-snap-gene-0.291.677e-2722.32protein:Tk12252 transcript:maker-scaffold472_size1... [more]
maker-scaffold513_size150706-snap-gene-0.212.681e-2322.84protein:Tk02893 transcript:maker-scaffold513_size1... [more]
maker-scaffold1209_size55568-snap-gene-0.84.943e-2326.27protein:Tk03740 transcript:maker-scaffold1209_size... [more]
maker-scaffold367_size194084-snap-gene-0.381.335e-1523.12protein:Tk00496 transcript:maker-scaffold367_size1... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s28supercontigLSalAtl2s28:642972..644719 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Biotypeprotein_coding
Descriptionmaker-LSalAtl2s28-augustus-gene-6.15
Evidenceexperimental
Logic nameensemblgenomes
NotePutative heme scavenger receptor class B
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000005382EMLSAT00000005382-701229Lepeophtheirus salmonismRNA


Synonyms
The feature 'EMLSAG00000005382' has the following synonyms
Synonym
LsHSCARB
SCARB
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000005382 (primary cross-reference)
Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s28:642972..644719-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000005382-688148 ID=EMLSAG00000005382-688148|Name=EMLSAG00000005382|organism=Lepeophtheirus salmonis|type=gene|length=1748bp|location=Sequence derived from alignment at LSalAtl2s28:642972..644719- (Lepeophtheirus salmonis)
ATGATTTTATACTCAATCCGAGTCATCCTAGGTCTTCTTTCCATCGTCTT AATTATTGGCGGAATATCCCTCAAAATGCACATCTTACCAGCAATGATTA AATCTCAGATATACGAAAATCTCGACTTGCGTGAAGGTACCGAGGGCTTC AATGCTTTTGTAAGTAGTTTTAAGCCATATTTTCATGTGTATACCTAATT GTTGTATATTTAATTTCTCAATATTAGAAGGAACCACCTGCTCCTGTCTA CCTTAGCTATAGTTTATTTCACATTAAGAATACAAATGAGGTGATAAGAG GAGAGCCACCCGTTCTATTAGAGGTAGGCCCTTATTCGTATAGGGAAACC ATGAGAAAAGAAAATTTGATGGAGCAAAACTCAAGATATTTGTCTTATGG AAAGTATACAAAATTTGAGTTTGATGAAACGAACACACATAAACTCAAAT GTAAAAATAGAATAAATACACCTTGCTCCAAAAACGATAAAATAACCATT ATAAATCCAGTCCTCCTCACCCTAGCGGATAAACTCGATGGCTTGCCAAA AACAGTAAAAGATATTTGTTTTGAAATTATAAATAATGGTAATGAAGCTC TAGGTATTAAGGCCGAAGATTTATTTATTACTGAAGAAGTTGACAAAATC CTATACACGGGCTTCGACTCTAAGTCTGCTGCTATCTTTGATAAATTGGA TACATTTCTTATGCTCTTGTTAGAAGTCATACAAGAATCCTTGGAGTTGG ATATACCAATTAAAGCAAAAGACTTTGAAAACATAATCAAAATCATTAGT CCTGCACAGCTTTCAGAAGGGACTTTTGCTTTTTTCAAAGGTAAAAATGC AACCAAATTGCAGAATTACTATACCATTGAAAACGGACGGTTCGATAAAG AAAGTTTTATGAATATTGTTGAGTTCAATGGTAAGAATAAATTACCTGAG GCTTKGTGGCCTAATGTAGCCACAAGTATAACGGGKCAACTTTCAAGTGA GGGTGGCTCATGCCATAGAATCTATGGAACGGATGGGACTCAATTTCCAC CGTTTTTATTTAACAAGAAAAAATTTCCTTTGTGGATGTTTGTGGGAGAG CTTTGTAGAACAATATATGTGGAGTTTGAGTCCGAAGTGGAAGTGGAAGG AGGGATCACAGCCTATCGTTATGGAGTAGGGAAGAGAGTTTTCTCAATGA GTAACCCTGAAAACTTTTGTTATTGTCAAGAATTTTTCTCATGCGCCAAG CAAACGGATAATGATGAATGGGATCTATCCCAATGCTTGAAATGTAAGGA TGGTGTTATGGACGTTTCTGCATGTTATGGAGCTCCAATTTTTATGTCTC AGCCTCATTTTCTTCAAGCTGATAAAGAAGTTCAAGCCTACGTCAAAGGT CTAGAACCGAATTCAGAGAAACATGCAACTTATCTTGACATAGAACCCAA TCTAGGAACACCATTGAGAGCACACAAGAAAATTCAAATCAACATGGTCC TAAGGAAAGTAGCAGGGATTGATTTACTCAAAAAAGTTGCGGATTTCCGC TTGATCCCCATGTTCTGGGCTGATGAAGGGGCTGAATTAGATTCGGAAAA AGCAGAGGAGTTAAACAATGTTCTCTTCAGTGCTATTACAATAGGAAATA CTGTGGGGATTGCTCTTGGCTATGTCGTTGGCCCAATACTCTTAATTGTT TCTATAATTCTCTCTTTCTATCAAAGGTATCGAGAAAAACGGGCCTAG
back to top
File Attachments
AttachmentSize
Image icon CCTOP membrane topology prediction35.82 KB
Add to Basket