EMLSAG00000005923, EMLSAG00000005923-688689 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000005923
Unique NameEMLSAG00000005923-688689
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
L F95 UN17_g1274 female
  1. PreAdult
  2. Adult
-Missing-
no visible phenotype
17.04.2013 - 14:29
10.06.2013 (All day)
Homology
BLAST of EMLSAG00000005923 vs. C. finmarchicus
Match: gi|592799004|gb|GAXK01155564.1| (TSA: Calanus finmarchicus comp105190_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 37.3502 bits (85), Expect = 3.158e-2
Identity = 14/30 (46.67%), Postives = 19/30 (63.33%), Query Frame = 0
Query:   29 EEGQQRFDCSLCHSRYKHHSSLFRHFKSAH 58
            E+G++R+ C LC   YKH  SLF H +  H
Sbjct:  810 EDGEERYQCDLCDRSYKHKKSLFAHLEWKH 899          
BLAST of EMLSAG00000005923 vs. C. finmarchicus
Match: gi|592815746|gb|GAXK01138822.1| (TSA: Calanus finmarchicus comp1079525_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 36.1946 bits (82), Expect = 5.799e-2
Identity = 15/39 (38.46%), Postives = 24/39 (61.54%), Query Frame = 0
Query:   26 VTLEEGQQRFDCSLCHSRYKHHSSLFRHFKSAHHKEYEE 64
            V +++ ++RF CS C  +Y H S L RH  + H+ + EE
Sbjct:  563 VDIDKEKKRFVCSFCFRKYMHKSHLRRHLNAFHNSQLEE 679          
BLAST of EMLSAG00000005923 vs. C. finmarchicus
Match: gi|592906710|gb|GAXK01051665.1| (TSA: Calanus finmarchicus comp28971_c0_seq27 transcribed RNA sequence)

HSP 1 Score: 35.8094 bits (81), Expect = 8.953e-2
Identity = 22/52 (42.31%), Postives = 25/52 (48.08%), Query Frame = 0
Query:    9 LDPKINESAALASLMIVVTLEEGQQRFDCSLCHSRYKHHSSLFRHFKSAHHK 60
            LD K   S  L    I  T   G+ +F C LC  R+   S LFRH KS H K
Sbjct:   96 LDRKKKSSPILQKTCIAST--HGKIKFPCDLCPRRFLKKSHLFRHVKSVHDK 245          
BLAST of EMLSAG00000005923 vs. C. finmarchicus
Match: gi|592906707|gb|GAXK01051668.1| (TSA: Calanus finmarchicus comp28971_c0_seq30 transcribed RNA sequence)

HSP 1 Score: 35.4242 bits (80), Expect = 1.098e-1
Identity = 22/52 (42.31%), Postives = 25/52 (48.08%), Query Frame = 0
Query:    9 LDPKINESAALASLMIVVTLEEGQQRFDCSLCHSRYKHHSSLFRHFKSAHHK 60
            LD K   S  L    I  T   G+ +F C LC  R+   S LFRH KS H K
Sbjct:   96 LDRKKKSSPILQKTCIAST--HGKIKFPCDLCPRRFLKKSHLFRHVKSVHDK 245          
BLAST of EMLSAG00000005923 vs. C. finmarchicus
Match: gi|592762305|gb|GAXK01192108.1| (TSA: Calanus finmarchicus comp40839_c3_seq12 transcribed RNA sequence)

HSP 1 Score: 35.039 bits (79), Expect = 2.057e-1
Identity = 10/26 (38.46%), Postives = 19/26 (73.08%), Query Frame = 0
Query:   31 GQQRFDCSLCHSRYKHHSSLFRHFKS 56
            G+++++C  CH R+   SSL++H K+
Sbjct:  771 GEKKYECDNCHKRFTQSSSLYKHIKA 848          
BLAST of EMLSAG00000005923 vs. C. finmarchicus
Match: gi|592762314|gb|GAXK01192099.1| (TSA: Calanus finmarchicus comp40839_c3_seq3 transcribed RNA sequence)

HSP 1 Score: 35.039 bits (79), Expect = 2.292e-1
Identity = 10/26 (38.46%), Postives = 19/26 (73.08%), Query Frame = 0
Query:   31 GQQRFDCSLCHSRYKHHSSLFRHFKS 56
            G+++++C  CH R+   SSL++H K+
Sbjct: 3621 GEKKYECDNCHKRFTQSSSLYKHIKA 3698          
BLAST of EMLSAG00000005923 vs. C. finmarchicus
Match: gi|592910229|gb|GAXK01048146.1| (TSA: Calanus finmarchicus comp677378_c2_seq1 transcribed RNA sequence)

HSP 1 Score: 33.113 bits (74), Expect = 2.832e-1
Identity = 13/31 (41.94%), Postives = 18/31 (58.06%), Query Frame = 0
Query:   32 QQRFDCSLCHSRYKHHSSLFRHFKSAHHKEY 62
            Q    C+LC  R+K  ++L  HFK  H+ EY
Sbjct:   16 QSHITCNLCPRRFKKETALATHFKKIHNSEY 108          
BLAST of EMLSAG00000005923 vs. C. finmarchicus
Match: gi|592958123|gb|GAXK01000433.1| (TSA: Calanus finmarchicus comp4329851_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 34.2686 bits (77), Expect = 3.579e-1
Identity = 19/68 (27.94%), Postives = 32/68 (47.06%), Query Frame = 0
Query:   26 VTLEEGQQRFDCSLCHSRYKHHSSLFRHFKSAHHKEYEERVALRVKLKAERDAAISRGE-PYLRRRNS 92
            +T+E G + F C++C  R+   S   RH    H K    +   + K + E D A   G+   ++ +NS
Sbjct:   80 ITIENGVKMFACNVCSDRFDQPSKAKRHITIKHLKPEATKADSKAKREREDDDAPPGGDLKKMKNQNS 283          
BLAST of EMLSAG00000005923 vs. C. finmarchicus
Match: gi|592917100|gb|GAXK01041275.1| (TSA: Calanus finmarchicus comp2652973_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 32.3426 bits (72), Expect = 4.314e-1
Identity = 14/33 (42.42%), Postives = 21/33 (63.64%), Query Frame = 0
Query:   27 TLEEGQQRFDCSLCHSRYKHHSSLFRHFKSAHH 59
            T++   +RF C  C S+  H  +LFRH K++HH
Sbjct:  155 TIDPTIKRFACLYCKSKSYHRRNLFRHVKNSHH 253          
BLAST of EMLSAG00000005923 vs. C. finmarchicus
Match: gi|592883937|gb|GAXK01074438.1| (TSA: Calanus finmarchicus comp501811_c2_seq1 transcribed RNA sequence)

HSP 1 Score: 33.4982 bits (75), Expect = 6.620e-1
Identity = 18/42 (42.86%), Postives = 25/42 (59.52%), Query Frame = 0
Query:   31 GQQRFDCSLCHSRYKHHSSLFRHFKSAHHKEYEERVALRVKL 72
            G++ F CS C +R+   +SL  HFK AHH+E E    +R  L
Sbjct:  461 GEKNFKCSKCDARFVQKASLLSHFK-AHHRETEINENMRSAL 583          
BLAST of EMLSAG00000005923 vs. L. salmonis peptides
Match: EMLSAP00000005923 (pep:novel supercontig:LSalAtl2s:LSalAtl2s31:790246:791300:-1 gene:EMLSAG00000005923 transcript:EMLSAT00000005923 description:"maker-LSalAtl2s31-snap-gene-8.28")

HSP 1 Score: 452.21 bits (1162), Expect = 9.762e-163
Identity = 224/224 (100.00%), Postives = 224/224 (100.00%), Query Frame = 0
Query:    1 MLKKRIEHLDPKINESAALASLMIVVTLEEGQQRFDCSLCHSRYKHHSSLFRHFKSAHHKEYEERVALRVKLKAERDAAISRGEPYLRRRNSKRGLRSVKKNKENTTSESVAKEAESPTKSTSKTSTVNVKHEFKSPKSPAKSQKKNIIHIKIQPKVEEPHISSLEEDTELLMKKLGESTNEQIIPNGTIQNITPSVVLIPIKKGELRVHSLRRINHVALKTMT 224
            MLKKRIEHLDPKINESAALASLMIVVTLEEGQQRFDCSLCHSRYKHHSSLFRHFKSAHHKEYEERVALRVKLKAERDAAISRGEPYLRRRNSKRGLRSVKKNKENTTSESVAKEAESPTKSTSKTSTVNVKHEFKSPKSPAKSQKKNIIHIKIQPKVEEPHISSLEEDTELLMKKLGESTNEQIIPNGTIQNITPSVVLIPIKKGELRVHSLRRINHVALKTMT
Sbjct:    1 MLKKRIEHLDPKINESAALASLMIVVTLEEGQQRFDCSLCHSRYKHHSSLFRHFKSAHHKEYEERVALRVKLKAERDAAISRGEPYLRRRNSKRGLRSVKKNKENTTSESVAKEAESPTKSTSKTSTVNVKHEFKSPKSPAKSQKKNIIHIKIQPKVEEPHISSLEEDTELLMKKLGESTNEQIIPNGTIQNITPSVVLIPIKKGELRVHSLRRINHVALKTMT 224          
BLAST of EMLSAG00000005923 vs. L. salmonis peptides
Match: EMLSAP00000011618 (pep:novel supercontig:LSalAtl2s:LSalAtl2s802:83392:84519:1 gene:EMLSAG00000011618 transcript:EMLSAT00000011618 description:"augustus_masked-LSalAtl2s802-processed-gene-0.2")

HSP 1 Score: 121.324 bits (303), Expect = 7.646e-33
Identity = 60/134 (44.78%), Postives = 83/134 (61.94%), Query Frame = 0
Query:    6 IEHLDPKINESAALASLMIVVTLEEGQQRFDCSLCHSRYKHHSSLFRHFKSAHHKEYEERVALRVKLKAERDAAISRGEPYLRRRNSKRGLRSVKKNKENTTSESVAKEAESPTKSTSKTSTVNVKHEFKSPKS 139
            + + D KI    +L+S+MIV  L+ G  RFDCS+C SRYKHH SLFRHFK AH ++YE++VALR  LKAER+     G PY+RR+N KR  +  K NKEN +          PT+ ++  + V +  ++  P S
Sbjct:    7 VVYFDKKICXDVSLSSMMIVSELQNGDIRFDCSICRSRYKHHPSLFRHFKCAHKEQYEQKVALREHLKAEREVLKMLGLPYMRRKNQKRNTKGRKVNKENISPLPEKPNDSIPTQLSNLGTLVPLDQKYMLPVS 140          
BLAST of EMLSAG00000005923 vs. L. salmonis peptides
Match: EMLSAP00000011617 (pep:novel supercontig:LSalAtl2s:LSalAtl2s802:54552:64646:-1 gene:EMLSAG00000011617 transcript:EMLSAT00000011617 description:"maker-LSalAtl2s802-snap-gene-0.20")

HSP 1 Score: 101.293 bits (251), Expect = 8.496e-26
Identity = 56/138 (40.58%), Postives = 91/138 (65.94%), Query Frame = 0
Query:    1 MLKKRIEHLDPKINESAALASLMIVVTLEEGQQRFDCSLCHSRYKHHSSLFRHFKSAHHKEYEERVALRVKLKAERDAAISRGEPYLRRRNSKRGLRSVKKNKEN--------TTSESVAKEAESPTKSTSKTSTVNV 130
            M KK + +LD K+ E + L+S+M+++ L++G+ RFDC++C  RYKHH SLFRHF+SAH ++Y + ++LR ++++ER AA   G  Y RR+N KR +R ++ NKEN        TT + ++ E  S   +  + +T+ V
Sbjct:    1 MGKKSVRYLDQKLTEDSTLSSMMVIIPLQDGEVRFDCNMCRRRYKHHPSLFRHFRSAHKEQYAKCLSLRNRIQSERAAAKLMGVAYPRRKNRKRNIRILQDNKENSLLPDDAHTTPQIISLEESSVETTHVQATTIQV 138          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000005923 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000005923 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592799004|gb|GAXK01155564.1|3.158e-246.67TSA: Calanus finmarchicus comp105190_c0_seq1 trans... [more]
gi|592815746|gb|GAXK01138822.1|5.799e-238.46TSA: Calanus finmarchicus comp1079525_c0_seq1 tran... [more]
gi|592906710|gb|GAXK01051665.1|8.953e-242.31TSA: Calanus finmarchicus comp28971_c0_seq27 trans... [more]
gi|592906707|gb|GAXK01051668.1|1.098e-142.31TSA: Calanus finmarchicus comp28971_c0_seq30 trans... [more]
gi|592762305|gb|GAXK01192108.1|2.057e-138.46TSA: Calanus finmarchicus comp40839_c3_seq12 trans... [more]
gi|592762314|gb|GAXK01192099.1|2.292e-138.46TSA: Calanus finmarchicus comp40839_c3_seq3 transc... [more]
gi|592910229|gb|GAXK01048146.1|2.832e-141.94TSA: Calanus finmarchicus comp677378_c2_seq1 trans... [more]
gi|592958123|gb|GAXK01000433.1|3.579e-127.94TSA: Calanus finmarchicus comp4329851_c0_seq1 tran... [more]
gi|592917100|gb|GAXK01041275.1|4.314e-142.42TSA: Calanus finmarchicus comp2652973_c0_seq1 tran... [more]
gi|592883937|gb|GAXK01074438.1|6.620e-142.86TSA: Calanus finmarchicus comp501811_c2_seq1 trans... [more]

Pages

back to top
BLAST of EMLSAG00000005923 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 3
Match NameE-valueIdentityDescription
EMLSAP000000059239.762e-163100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s31:790246... [more]
EMLSAP000000116187.646e-3344.78pep:novel supercontig:LSalAtl2s:LSalAtl2s802:83392... [more]
EMLSAP000000116178.496e-2640.58pep:novel supercontig:LSalAtl2s:LSalAtl2s802:54552... [more]
back to top
BLAST of EMLSAG00000005923 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000005923 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000005923 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000005923 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s31supercontigLSalAtl2s31:790246..791300 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteHypothetical protein
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s31-snap-gene-8.28
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000005923 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000005923EMLSAT00000005923-701770Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s31:790246..791300-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000005923-688689 ID=EMLSAG00000005923-688689|Name=EMLSAG00000005923|organism=Lepeophtheirus salmonis|type=gene|length=1055bp|location=Sequence derived from alignment at LSalAtl2s31:790246..791300- (Lepeophtheirus salmonis)
ATGTTGAAAAAGCGTATTGAACACTTGGATCCCAAAATAAACGAAAGTGC AGCATTGGCATCCCTAATGATTGTTGTCACGTTAGAAGAAGGACAACAAA GATTCGATTGCAGCTTGTGTCACAGTCGTTATAAACATCATTCTTCCCTA TTTCGACATTTTAAATCCGCCCATCACAAAGAATATGAAGAAAGAGTAGC TTTGAGGGTAAAATTAAAGGCTGAAAGGGATGCTGCGATATCCCGGGGGG AACCTTATTTACGTAGACGTAATAGTAAGCGGGGCTTACGAAGTGTTAAA AAGAACAAGGAGAATACTACCTCAGAATCTGTTGCGAAGGAAGCAGAATC TCCTACAAAATCAACAAGTAAGACATCGACAGTTAATGTTAAACACGAGT TTAAATCTCCAAAATCACCAGCCAAGAGTCAGAAAAAAAACATCATTCAT ATAAAAATTCAACCCAAAGTTGAGGAACCTCACATTTCGTCTTTAGAAGA GGACACTGAGCTTCTTATGAAAAAGCTTGGAGAATCCACTAATGAACAAA TAATACCTAATGGGACTATACAAAATATTACTCCATCTGTTGTACTTATC CCTATTAAAAAGGTGCCTTTSCAGCCACAGAATATTAAAGAKCAGCCTAT CTATGATCCATCCCTTCCACTTGACCTGAGTTTGAAGGATGTAAAGGAAG ATCATTCTGCTTCAACATTGAATCACTGATTCGAAAAGAATATTAAAAAA AACTTTGTTTTGAAACCTATAGAATGCATGTTATTTTAGCATTTTCCCTG TTTTACTTGTGATCTATTAATTTAATTTCATTTACGAAATTATATGGTTG TTAATAAATAATTTGAATTTATTTACTTAAAATGTACTTGTTTTGACAAT CATTCGAGACTATTGAAATATATTAAATGTGGTTAGAATGAGATTGCGTC TTAATCAAATTCTTCTATTTTAAAATCTTCTTCATCTTCAAGGGTGAGCT GAGAGTCCATAGTTTGAGACGGATTAATCACGTTGCATTGAAAACGATGA CTTGA
back to top
Add to Basket