EMLSAG00000006418, EMLSAG00000006418-689184 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000006418 vs. C. finmarchicus
Match: gi|592950801|gb|GAXK01007752.1| (TSA: Calanus finmarchicus comp9958917_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 9.909e-1 Identity = 12/45 (26.67%), Postives = 23/45 (51.11%), Query Frame = 0 Query: 24 RSLWRGRSLNTNCFAQIRGGTRLKKMSQKSYVVKDLLIQSLIFKI 68 +S+W + N NCF+ R +LK +S+ KD + +++ Sbjct: 124 QSIWNWKQCNCNCFSNKRAKPKLKSHKNESF-AKDNFTFPINYRV 255
BLAST of EMLSAG00000006418 vs. C. finmarchicus
Match: gi|592763112|gb|GAXK01191417.1| (TSA: Calanus finmarchicus comp712981_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 6.432e+0 Identity = 13/24 (54.17%), Postives = 17/24 (70.83%), Query Frame = 0 Query: 3 KEGISLKLSVEIINKTNVKLKRSL 26 KEGI L +E+I+KTN+K R L Sbjct: 403 KEGIVLNDHIEVISKTNIKSMRML 474
BLAST of EMLSAG00000006418 vs. C. finmarchicus
Match: gi|592927656|gb|GAXK01030814.1| (TSA: Calanus finmarchicus comp116215_c2_seq5 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 7.577e+0 Identity = 14/30 (46.67%), Postives = 18/30 (60.00%), Query Frame = 0 Query: 21 KLKRSLWRGRSLNTNCFAQIRGGTRLKKMS 50 +L+RS G SL +C Q+R G L KMS Sbjct: 58 RLQRSSGPGASLTQSCSLQVRVGGVLVKMS 147
BLAST of EMLSAG00000006418 vs. C. finmarchicus
Match: gi|592813463|gb|GAXK01141105.1| (TSA: Calanus finmarchicus comp3255868_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 7.654e+0 Identity = 10/30 (33.33%), Postives = 19/30 (63.33%), Query Frame = 0 Query: 35 NCFAQIRGGTRLKKMSQKSYVVKDLLIQSL 64 NC +RG R +++ QK V+++L++ L Sbjct: 633 NCMITLRGEERAEEVKQKCKVIENLMVTVL 722
BLAST of EMLSAG00000006418 vs. C. finmarchicus
Match: gi|592835512|gb|GAXK01122032.1| (TSA: Calanus finmarchicus comp107670_c7_seq19 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 7.761e+0 Identity = 10/18 (55.56%), Postives = 13/18 (72.22%), Query Frame = 0 Query: 31 SLNTNCFAQIRGGTRLKK 48 SL T CF + GGTRL++ Sbjct: 272 SLGTQCFTTLLGGTRLER 325
BLAST of EMLSAG00000006418 vs. L. salmonis peptides
Match: EMLSAP00000006418 (pep:novel supercontig:LSalAtl2s:LSalAtl2s3518:6066:6433:-1 gene:EMLSAG00000006418 transcript:EMLSAT00000006418 description:"maker-LSalAtl2s3518-snap-gene-0.0") HSP 1 Score: 134.806 bits (338), Expect = 1.150e-42 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0 Query: 1 MEKEGISLKLSVEIINKTNVKLKRSLWRGRSLNTNCFAQIRGGTRLKKMSQKSYVVKDLLIQSLIFKI 68 MEKEGISLKLSVEIINKTNVKLKRSLWRGRSLNTNCFAQIRGGTRLKKMSQKSYVVKDLLIQSLIFKI Sbjct: 1 MEKEGISLKLSVEIINKTNVKLKRSLWRGRSLNTNCFAQIRGGTRLKKMSQKSYVVKDLLIQSLIFKI 68 The following BLAST results are available for this feature:
BLAST of EMLSAG00000006418 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000006418 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 5
BLAST of EMLSAG00000006418 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000006418 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000006418 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000006418 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000006418 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s3518:6066..6433- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000006418-689184 ID=EMLSAG00000006418-689184|Name=EMLSAG00000006418|organism=Lepeophtheirus salmonis|type=gene|length=368bp|location=Sequence derived from alignment at LSalAtl2s3518:6066..6433- (Lepeophtheirus salmonis)back to top Add to Basket
|