EMLSAG00000006865, EMLSAG00000006865-689631 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000006865 vs. C. finmarchicus
Match: gi|592839946|gb|GAXK01117598.1| (TSA: Calanus finmarchicus comp3618961_c0_seq1 transcribed RNA sequence) HSP 1 Score: 31.187 bits (69), Expect = 2.084e-1 Identity = 12/22 (54.55%), Postives = 18/22 (81.82%), Query Frame = 0 Query: 63 LVSSGFNGSNSATPKPYMETDI 84 ++SS FN SNS +P+P +ET+I Sbjct: 215 VLSSSFNKSNSCSPQPILETNI 280
BLAST of EMLSAG00000006865 vs. L. salmonis peptides
Match: EMLSAP00000006865 (pep:novel supercontig:LSalAtl2s:LSalAtl2s388:465354:469199:1 gene:EMLSAG00000006865 transcript:EMLSAT00000006865 description:"snap_masked-LSalAtl2s388-processed-gene-3.4") HSP 1 Score: 168.318 bits (425), Expect = 1.905e-55 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0 Query: 1 MKTYDLDVFKFDQIYVLSMISENETTPPLIIVEKELTPKTKKKKPPLMPKPTLHKLGAIRKTLVSSGFNGSNSATPKPYMETDI 84 MKTYDLDVFKFDQIYVLSMISENETTPPLIIVEKELTPKTKKKKPPLMPKPTLHKLGAIRKTLVSSGFNGSNSATPKPYMETDI Sbjct: 1 MKTYDLDVFKFDQIYVLSMISENETTPPLIIVEKELTPKTKKKKPPLMPKPTLHKLGAIRKTLVSSGFNGSNSATPKPYMETDI 84 The following BLAST results are available for this feature:
BLAST of EMLSAG00000006865 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000006865 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 1
BLAST of EMLSAG00000006865 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000006865 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000006865 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000006865 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000006865 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s388:465354..469199+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000006865-689631 ID=EMLSAG00000006865-689631|Name=EMLSAG00000006865|organism=Lepeophtheirus salmonis|type=gene|length=3846bp|location=Sequence derived from alignment at LSalAtl2s388:465354..469199+ (Lepeophtheirus salmonis)back to top Add to Basket
|