EMLSAG00000007880, EMLSAG00000007880-690646 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000007880 vs. C. finmarchicus
Match: gi|592935176|gb|GAXK01023377.1| (TSA: Calanus finmarchicus comp115547_c7_seq5 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 1.510e+0 Identity = 13/26 (50.00%), Postives = 17/26 (65.38%), Query Frame = 0 Query: 5 LYILAYNTSCVIEDENHGSSRNLDKK 30 L+IL NTSCV+ED + LD+K Sbjct: 147 LWILE-NTSCVVED*KRPKCKGLDQK 221
BLAST of EMLSAG00000007880 vs. C. finmarchicus
Match: gi|592935177|gb|GAXK01023376.1| (TSA: Calanus finmarchicus comp115547_c7_seq4 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 4.497e+0 Identity = 13/26 (50.00%), Postives = 17/26 (65.38%), Query Frame = 0 Query: 5 LYILAYNTSCVIEDENHGSSRNLDKK 30 L+IL NTSCV+ED + LD+K Sbjct: 147 LWILE-NTSCVVED*KRPKCKGLDQK 221
BLAST of EMLSAG00000007880 vs. C. finmarchicus
Match: gi|592935178|gb|GAXK01023375.1| (TSA: Calanus finmarchicus comp115547_c7_seq3 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 4.562e+0 Identity = 13/26 (50.00%), Postives = 17/26 (65.38%), Query Frame = 0 Query: 5 LYILAYNTSCVIEDENHGSSRNLDKK 30 L+IL NTSCV+ED + LD+K Sbjct: 147 LWILE-NTSCVVED*KRPKCKGLDQK 221
BLAST of EMLSAG00000007880 vs. C. finmarchicus
Match: gi|592935179|gb|GAXK01023374.1| (TSA: Calanus finmarchicus comp115547_c7_seq2 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 4.706e+0 Identity = 13/26 (50.00%), Postives = 17/26 (65.38%), Query Frame = 0 Query: 5 LYILAYNTSCVIEDENHGSSRNLDKK 30 L+IL NTSCV+ED + LD+K Sbjct: 147 LWILE-NTSCVVED*KRPKCKGLDQK 221
BLAST of EMLSAG00000007880 vs. C. finmarchicus
Match: gi|592935180|gb|GAXK01023373.1| (TSA: Calanus finmarchicus comp115547_c7_seq1 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 4.754e+0 Identity = 13/26 (50.00%), Postives = 17/26 (65.38%), Query Frame = 0 Query: 5 LYILAYNTSCVIEDENHGSSRNLDKK 30 L+IL NTSCV+ED + LD+K Sbjct: 147 LWILE-NTSCVVED*KRPKCKGLDQK 221
BLAST of EMLSAG00000007880 vs. L. salmonis peptides
Match: EMLSAP00000007880 (pep:novel supercontig:LSalAtl2s:LSalAtl2s4646:3320:4681:-1 gene:EMLSAG00000007880 transcript:EMLSAT00000007880 description:"maker-LSalAtl2s4646-snap-gene-0.1") HSP 1 Score: 85.8853 bits (211), Expect = 2.959e-24 Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 0 Query: 1 MVSVLYILAYNTSCVIEDENHGSSRNLDKKQIRTGLDMYIS 41 MVSVLYILAYNTSCVIEDENHGSSRNLDKKQIRTGLDMYIS Sbjct: 1 MVSVLYILAYNTSCVIEDENHGSSRNLDKKQIRTGLDMYIS 41 The following BLAST results are available for this feature:
BLAST of EMLSAG00000007880 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000007880 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 5
BLAST of EMLSAG00000007880 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000007880 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000007880 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000007880 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000007880 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s4646:3320..4681- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000007880-690646 ID=EMLSAG00000007880-690646|Name=EMLSAG00000007880|organism=Lepeophtheirus salmonis|type=gene|length=1362bp|location=Sequence derived from alignment at LSalAtl2s4646:3320..4681- (Lepeophtheirus salmonis)back to top Add to Basket
|