EMLSAG00000011525, EMLSAG00000011525-694291 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000011525
Unique NameEMLSAG00000011525-694291
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
J F75 UN4_g84 female
  1. PreAdult2
  2. Adult
-Missing-
no visible phenotype
27.02.2013 - 08:18
08.04.2013 (All day)
Homology
BLAST of EMLSAG00000011525 vs. GO
Match: - (symbol:CG31344 species:7227 "Drosophila melanogaster" [GO:0022008 "neurogenesis" evidence=IMP] EMBL:AE014297 GO:GO:0022008 InterPro:IPR018713 Pfam:PF09995 EMBL:AY058343 RefSeq:NP_650433.1 UniGene:Dm.4198 IntAct:Q95U32 STRING:7227.FBpp0082590 EnsemblMetazoa:FBtr0083136 GeneID:41835 KEGG:dme:Dmel_CG31344 UCSC:CG31344-RA FlyBase:FBgn0051344 eggNOG:NOG240248 InParanoid:Q95U32 OMA:LTQFGFI OrthoDB:EOG7B31NF GenomeRNAi:41835 NextBio:825794 PRO:PR:Q95U32 Uniprot:Q95U32)

HSP 1 Score: 78.5666 bits (192), Expect = 2.372e-15
Identity = 50/166 (30.12%), Postives = 87/166 (52.41%), Query Frame = 0
Query:   15 SRNSSTPDTAFARYLRTLNHTYAWFHSE-----SSLSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIIN 175
            +R SST  TA+ RY+RT+ HT AW++       S    S+  VR AH R+  + + +  GQ ++Q D+ +TQ+ F+G +        LK   +  LEA   +   +GY LG++D++N+C  +   ++     +   + +PA+ +     K   MT+ L+ G+  IN
Sbjct:  122 TRQSSTAFTAYRRYVRTIFHTQAWYNHNIADRGSRFWTSIAAVRRAHSRSSHACARQGAGQ-ITQKDLALTQFGFIGFITMGAHRIKLK--DQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDIVMRKVYEPALANTGEDFK--RMTEALINGLWHIN 282          
BLAST of EMLSAG00000011525 vs. C. finmarchicus
Match: gi|592808479|gb|GAXK01146089.1| (TSA: Calanus finmarchicus comp399183_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 137.117 bits (344), Expect = 5.808e-35
Identity = 84/234 (35.90%), Postives = 120/234 (51.28%), Query Frame = 0
Query:   15 SRNSSTPDTAFARYLRTLNHTYAWFHSESSLSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFVLPLAFGKCCFRALECNKKASKIRI-PFFSLSNILFWIQIFVTDFLMLSNLTRHFLVPCLNYLLRFNIYLS 247
            ++ S +P  +F RYL TL HT +W+   +SL +SL  VR  H  A   +S       M+QYDMV+TQWAF+G     P   G+   S+  LE L  +MY VG  LG+++  N+C G +E    YS  IS  +I       +SS    +M K LL G++I+NPF+   A+     R L       K  + PF   S+ LF  QI V + LM   +    +    N L++ NIYL+
Sbjct: 1887 TKKSGSPTLSFTRYLATLKHTLSWYKGVTSLEESLQTVRAKHRHAANLASGTNHS--MTQYDMVLTQWAFIGPALLYPQKLGISKTSEKDLEGLVYIMYLVGKNLGIDEDLNMCAGGLEPAVEYSDLISRQVISKNFGSHKSSKTCKDMAKHLLDGVNILNPFIDQTAYHLWSDRLLNPQNPHEKNGMQPF---SHFLFKTQILVLESLMHVRVLGSLIRMLANNLMKLNIYLA 2573          
BLAST of EMLSAG00000011525 vs. C. finmarchicus
Match: gi|592949056|gb|GAXK01009497.1| (TSA: Calanus finmarchicus comp1248572_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 129.028 bits (323), Expect = 2.110e-33
Identity = 80/233 (34.33%), Postives = 125/233 (53.65%), Query Frame = 0
Query:   18 SSTPDTAFARYLRTLNHTYAWFHSES--SLSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFVLPLAFGKCCFRALECNKKASKIRIPFFSLSNILFWIQIFVTDFLMLSNLTRHFLVPCLNYLLRFNIYLSN 248
            SS+P  A+ RYLRT+ HT  W+      ++++SL +V+  H  A K + SK  G  MSQYDMV+TQWAF+G     P++ GL  PS      L  +MY VG +LGV +  NLC G V     YS+ I +++++P I+    +  S EM+  L+KG++++ PF+   AF +C F  L    ++          S IL   Q+ + + ++   +    +   LN L+R  I L+ 
Sbjct:  338 SSSPTMAYQRYLRTMRHTSMWYTGPGVETMTRSLKEVKGKHRVAAKLAMSK--GHLMSQYDMVLTQWAFIGPALIFPASLGLPPPSA----GLVYIMYLVGRYLGVSEDLNLCSGGVARATEYSQLILKHVLQPEIKIENMNAVSKEMSGYLMKGVNMMIPFIDATAF-ECWFLRLLSPPQSPPPSQQMGIQSIILLNAQVIMLETVLHLPVVGSIIRIMLNMLMRLAILLNT 1015          
BLAST of EMLSAG00000011525 vs. C. finmarchicus
Match: gi|592949055|gb|GAXK01009498.1| (TSA: Calanus finmarchicus comp1248572_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 119.398 bits (298), Expect = 8.832e-31
Identity = 64/156 (41.03%), Postives = 93/156 (59.62%), Query Frame = 0
Query:   18 SSTPDTAFARYLRTLNHTYAWFHSES--SLSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGI 171
            SS+P  A+ RYLRT+ HT  W+      ++++SL +V+  H  A K + SK  G  MSQYDMV+TQWAF+G     P++ GL  PS      L  +MY VG +LGV +  NLC G V     YS+ I +++++PAI+    +  S EM+  L+KG+
Sbjct:  338 SSSPTMAYQRYLRTMRHTSMWYTGPGVETMTRSLKEVKGKHRVAAKLAMSK--GHLMSQYDMVLTQWAFIGPALIFPASLGLPPPSA----GLVYIMYLVGRYLGVSEDLNLCSGGVARATEYSQLILKHVLQPAIKIENMNTVSKEMSGHLMKGV 787          
BLAST of EMLSAG00000011525 vs. C. finmarchicus
Match: gi|592949054|gb|GAXK01009499.1| (TSA: Calanus finmarchicus comp1248572_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 108.997 bits (271), Expect = 3.848e-27
Identity = 59/137 (43.07%), Postives = 81/137 (59.12%), Query Frame = 0
Query:   18 SSTPDTAFARYLRTLNHTYAWFHSES--SLSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIE 152
            SS+P  A+ RYLRT+ HT  W+      ++++SL +V+  H  A K + SK  G  MSQYDMV+TQWAF+G     P++ GL  PS      L  +MY VG +LGV +  NLC G V     YS  I ++I +PAI+
Sbjct:  338 SSSPTMAYQRYLRTMRHTSMWYTGPGVETMTRSLKEVKGKHRVAAKLAMSK--GHLMSQYDMVLTQWAFIGPALIFPASLGLPPPSA----GLVYIMYLVGRYLGVSEDLNLCSGGVARATEYSHLILKHIFQPAIK 730          
BLAST of EMLSAG00000011525 vs. C. finmarchicus
Match: gi|592897400|gb|GAXK01060975.1| (TSA: Calanus finmarchicus comp172307_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 48.1358 bits (113), Expect = 1.325e-5
Identity = 28/107 (26.17%), Postives = 48/107 (44.86%), Query Frame = 0
Query:   45 LSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAI 151
            L + L ++R  +   D+  S     Q  SQ+DM + Q AF   +   P ++G  + S   LE    +    GY++G+ D  N     +E       ++ E I+KP +
Sbjct:  508 LKEELAELRITYAMPDEYISYINSKQAFSQFDMTLVQAAFFAAVIIYPEHYGSNTASAQELEGFIHVWRVFGYYMGISDSNNAAQFGLERDIVAGNEVMEKILKPCM 828          
BLAST of EMLSAG00000011525 vs. C. finmarchicus
Match: gi|592924017|gb|GAXK01034398.1| (TSA: Calanus finmarchicus comp359143_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 38.891 bits (89), Expect = 1.270e-2
Identity = 23/79 (29.11%), Postives = 37/79 (46.84%), Query Frame = 0
Query:   73 SQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAI 151
            SQ DM + Q AF G L   P ++G K  S    +         GY+LG+ D+ N      E T+  ++ + + I+ P +
Sbjct:  625 SQTDMTLVQGAFFGQLLLFPEHYGAKHVSVEETKNFLHFWRTNGYYLGISDENNAVLPDYEETKIMARIVLDKILIPCM 861          
BLAST of EMLSAG00000011525 vs. C. finmarchicus
Match: gi|592924019|gb|GAXK01034396.1| (TSA: Calanus finmarchicus comp359143_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 38.891 bits (89), Expect = 1.334e-2
Identity = 23/79 (29.11%), Postives = 37/79 (46.84%), Query Frame = 0
Query:   73 SQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAI 151
            SQ DM + Q AF G L   P ++G K  S    +         GY+LG+ D+ N      E T+  ++ + + I+ P +
Sbjct:  909 SQTDMTLVQGAFFGQLLLFPEHYGAKHVSVEETKNFLHFWRTNGYYLGISDENNAVLPDYEETKIMARIVLDKILIPCM 1145          
BLAST of EMLSAG00000011525 vs. C. finmarchicus
Match: gi|592924016|gb|GAXK01034399.1| (TSA: Calanus finmarchicus comp359143_c0_seq4 transcribed RNA sequence)

HSP 1 Score: 38.891 bits (89), Expect = 1.472e-2
Identity = 23/79 (29.11%), Postives = 37/79 (46.84%), Query Frame = 0
Query:   73 SQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAI 151
            SQ DM + Q AF G L   P ++G K  S    +         GY+LG+ D+ N      E T+  ++ + + I+ P +
Sbjct:  625 SQTDMTLVQGAFFGQLLLFPEHYGAKHVSVEETKNFLHFWRTNGYYLGISDENNAVLPDYEETKIMARIVLDKILIPCM 861          
BLAST of EMLSAG00000011525 vs. C. finmarchicus
Match: gi|592924018|gb|GAXK01034397.1| (TSA: Calanus finmarchicus comp359143_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 38.891 bits (89), Expect = 1.572e-2
Identity = 23/79 (29.11%), Postives = 37/79 (46.84%), Query Frame = 0
Query:   73 SQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAI 151
            SQ DM + Q AF G L   P ++G K  S    +         GY+LG+ D+ N      E T+  ++ + + I+ P +
Sbjct:  909 SQTDMTLVQGAFFGQLLLFPEHYGAKHVSVEETKNFLHFWRTNGYYLGISDENNAVLPDYEETKIMARIVLDKILIPCM 1145          
BLAST of EMLSAG00000011525 vs. C. finmarchicus
Match: gi|592923118|gb|GAXK01035271.1| (TSA: Calanus finmarchicus comp1516615_c0_seq6 transcribed RNA sequence)

HSP 1 Score: 30.8018 bits (68), Expect = 1.567e+0
Identity = 14/34 (41.18%), Postives = 19/34 (55.88%), Query Frame = 0
Query:  213 WIQIFVTDFLMLSNLTRHFLVPCLNYLLRFNIYL 246
            W+QIF     +LS   RHF  PCL + L F+  +
Sbjct:  185 WLQIFSIPLCVLSVCGRHFQEPCLLFCLIFSFLM 286          
BLAST of EMLSAG00000011525 vs. L. salmonis peptides
Match: EMLSAP00000011525 (pep:novel supercontig:LSalAtl2s:LSalAtl2s799:308831:309981:1 gene:EMLSAG00000011525 transcript:EMLSAT00000011525 description:"maker-LSalAtl2s799-snap-gene-3.68")

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 264/264 (100.00%), Postives = 264/264 (100.00%), Query Frame = 0
Query:    1 MTMSRIERLISEGKSRNSSTPDTAFARYLRTLNHTYAWFHSESSLSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFVLPLAFGKCCFRALECNKKASKIRIPFFSLSNILFWIQIFVTDFLMLSNLTRHFLVPCLNYLLRFNIYLSNLLNPSINKMKARLYAK 264
            MTMSRIERLISEGKSRNSSTPDTAFARYLRTLNHTYAWFHSESSLSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFVLPLAFGKCCFRALECNKKASKIRIPFFSLSNILFWIQIFVTDFLMLSNLTRHFLVPCLNYLLRFNIYLSNLLNPSINKMKARLYAK
Sbjct:    1 MTMSRIERLISEGKSRNSSTPDTAFARYLRTLNHTYAWFHSESSLSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFVLPLAFGKCCFRALECNKKASKIRIPFFSLSNILFWIQIFVTDFLMLSNLTRHFLVPCLNYLLRFNIYLSNLLNPSINKMKARLYAK 264          
BLAST of EMLSAG00000011525 vs. Select Arthropod Genomes
Match: AAN13634.1 (uncharacterized protein Dmel_CG31344 [Drosophila melanogaster])

HSP 1 Score: 78.5666 bits (192), Expect = 8.385e-16
Identity = 50/166 (30.12%), Postives = 87/166 (52.41%), Query Frame = 0
Query:   15 SRNSSTPDTAFARYLRTLNHTYAWFHSE-----SSLSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIIN 175
            +R SST  TA+ RY+RT+ HT AW++       S    S+  VR AH R+  + + +  GQ ++Q D+ +TQ+ F+G +        LK   +  LEA   +   +GY LG++D++N+C  +   ++     +   + +PA+ +     K   MT+ L+ G+  IN
Sbjct:  122 TRQSSTAFTAYRRYVRTIFHTQAWYNHNIADRGSRFWTSIAAVRRAHSRSSHACARQGAGQ-ITQKDLALTQFGFIGFITMGAHRIKLK--DQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDIVMRKVYEPALANTGEDFK--RMTEALINGLWHIN 282          
BLAST of EMLSAG00000011525 vs. Select Arthropod Genomes
Match: EAA10900.3 (AGAP005759-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 77.411 bits (189), Expect = 2.392e-15
Identity = 44/139 (31.65%), Postives = 73/139 (52.52%), Query Frame = 0
Query:   18 SSTPDTAFARYLRTLNHTYAWFHSE----SSLSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIE 152
            SST +TA  RY+ T  H   W+  E    S   KSL QVR  H+ A  +S+ KR   F+SQ +M +T + F+G    +P   G++  ++   EA       +G+ LGV D++N+C   +E+ +     +  Y+  P+++
Sbjct:   91 SSTTETARKRYVSTFIHMSDWYECELVPGSKSWKSLSQVRRMHLSA-SNSAKKRNLGFISQPEMALTTFGFMGFPLVRPHLLGIRYDNREDREAFVHFWAVIGFMLGVRDEYNMCLFRLEVVEMICHVVIRYVFVPSLQ 228          
BLAST of EMLSAG00000011525 vs. Select Arthropod Genomes
Match: gb|KPM04836.1| (hypothetical protein QR98_0032900 [Sarcoptes scabiei])

HSP 1 Score: 77.0258 bits (188), Expect = 2.746e-15
Identity = 44/131 (33.59%), Postives = 72/131 (54.96%), Query Frame = 0
Query:    9 LISEGKSRNSSTPDTAFARYLRTLNHTYAW-----FHSESSLSKSLIQVR-NAHIRADKSSSSK--RKGQ-FMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYG 130
            L+    S NS++P   F R L T+NH  +W     F S +   +SL +VR N H+   K  + K  RK + ++SQ+DM +TQW+ +G++  +P   G    ++   E        +G+ +G+ED+FN+CYG
Sbjct:   74 LVPVVASGNSASPSRVFFRILSTINHILSWYDDDPFDSRTKTHQSLTRVRRNCHMAVSKLMNEKYPRKNRLWLSQFDMAMTQWSLIGIVAIRPIECGFHGCTREEFEEFFYFWKVMGHCVGLEDRFNICYG 204          
BLAST of EMLSAG00000011525 vs. Select Arthropod Genomes
Match: gb|KPM11373.1| (hypothetical protein QR98_0099440 [Sarcoptes scabiei])

HSP 1 Score: 77.0258 bits (188), Expect = 3.320e-15
Identity = 58/194 (29.90%), Postives = 89/194 (45.88%), Query Frame = 0
Query:   17 NSSTPDTAFARYLRTLNHTYAWFHSE-----SSLSKSLIQVRNAHIRADKSSS-------------SKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFVLPLAFGKCCFRALE 192
            NSST    F RYL T+ H   WF ++     S   +SL  VR+ H +  K  +              + K  F+SQY M   Q++FVG +   P  FG  +  ++  EAL      +GY LG +D++NLC GS E T    + I      P+I + ++   S +M K +   +  ++P +   A  + C   LE
Sbjct:   91 NSSTVSKLFIRYLSTIKHVTNWFEADPFDPKSKSFRSLKIVRSMHSKTAKQLNRQAGHFDENDCIVDEAKFLFISQYGMCHAQFSFVGFMAIFPKQFGYHNFKRNDFEALFHFWRVIGYCLGTDDRYNLCSGSFEETMELCRQIYFEEWLPSIRNLKTDA-SIKMAKAICLAMSYVSPNIDYSALMRYCAPFLE 283          
BLAST of EMLSAG00000011525 vs. Select Arthropod Genomes
Match: gb|EEC19922.1| (conserved hypothetical protein [Ixodes scapularis])

HSP 1 Score: 75.8702 bits (185), Expect = 5.636e-15
Identity = 65/237 (27.43%), Postives = 110/237 (46.41%), Query Frame = 0
Query:   17 NSSTPDTAFARYLRTLNHTYAWFHSE---------SSLSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFVLPLAFGKCCFRALECNKKASKIRIPFFSLSNILFWIQIFVTDFLMLSNLTRHFLVPCLNYLLRFNI 244
            +S++  + + RYL TL H  +W+  +         +S+SK     R+   + +  +      +++SQ DM +TQ+AF+GL    P   GL    +  LE +      VGY LG+ D +NLC G+ E T     ++ E +IKPA+ +P  S +   M+K ++  + ++  F+          R +  N  A+     ++S S  L W   F  + L+  N  R       N+LLR  I
Sbjct:  117 HSNSLASLYRRYLSTLRHVKSWYEGDIWKPGDPAHTSISKVRQMHRHVAGQLEGRTCPVTNARYLSQLDMAITQFAFMGLSVLYPRQLGLFLAERD-LECVIHFWRTVGYKLGIADCYNLCSGNYEETFQICFEMQETLIKPALVNP--SPQGATMSKNIICAVRVLVIFLSYEGMMAFWARQIGLNFNATLSLYDWWSYS--LIW---FTFNVLLRYNYWRGM----FNWLLRLAI 341          
BLAST of EMLSAG00000011525 vs. Select Arthropod Genomes
Match: gb|KPM10449.1| (hypothetical protein QR98_0090050 [Sarcoptes scabiei])

HSP 1 Score: 75.0998 bits (183), Expect = 1.005e-14
Identity = 54/196 (27.55%), Postives = 93/196 (47.45%), Query Frame = 0
Query:    1 MTMSRIERLISEGKSRNSSTPDTAFARYLRTLNHTYAW-----FHSESSLSKSLIQVRNAH----IRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKIL---LKGIHIINPFVLPLAFG 184
            + + + + LI    + N+S    +F RY  TL H   W     F   S   KSL  VR+ H     +     SS+ + ++++Q  +   Q+ F+G++   P + G +S +K    AL      +GY LG+ED+FNL  GS E +    + I      PA+  PQ  + S ++++ +    + I II  + L + +G
Sbjct:   82 LVVYQTDELIPLMLTGNTSNKCRSFRRYWSTLEHVLNWYRFDPFERNSPAQKSLQSVRSIHHYWTEKFHSECSSEDEIKWITQDRLCNGQFTFIGMVLLFPQDLGFQSWNKENFSALIHFWRTIGYCLGIEDRFNLFDGSDEESIELCRQIYLNDWLPALVSPQDPLNSSKLSREICETFQNISIILTYNLLMKYG 277          
BLAST of EMLSAG00000011525 vs. Select Arthropod Genomes
Match: XP_001119997.3 (PREDICTED: uncharacterized protein LOC724229, partial [Apis mellifera])

HSP 1 Score: 69.707 bits (169), Expect = 3.839e-13
Identity = 41/146 (28.08%), Postives = 73/146 (50.00%), Query Frame = 0
Query:   15 SRNSSTPDTAFARYLRTLNHTYAWFHSESSLSKSLIQVRNAH-IRADKSSSSKRKGQ----FMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQ 155
            S+N+ T   ++ RY++T+ H YA  H     S  L+  +  + IR   S++++++ Q     + Q DM +TQ+ F+G ++  P   G+ +  K  L         +GY LG+ D+ N+C  ++  T+   K I   II   + DP 
Sbjct:   81 SKNNITVPISYKRYMQTILHIYA-LHKTELFSPDLLWFKAINAIRWRHSNATRKRIQKGLNGIYQKDMAITQFGFIGYVFLVPEKLGMTNIEKY-LSGFNHYWQIIGYLLGISDRMNICRKTIAETRELCKKIQNEIIAKHLNDPH 224          
BLAST of EMLSAG00000011525 vs. Select Arthropod Genomes
Match: XP_392181.4 (PREDICTED: uncharacterized protein LOC408641 [Apis mellifera])

HSP 1 Score: 70.0922 bits (170), Expect = 5.340e-13
Identity = 41/148 (27.70%), Postives = 73/148 (49.32%), Query Frame = 0
Query:   15 SRNSSTPDTAFARYLRTLNHTYAWFHSESSLSKSLIQVRNAH-IRADKSSSSKRKGQ----FMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSS 157
            S+N+ T   ++ RY++T+ H YA  H     S  L+  +  + IR   S++++++ Q     + Q DM +TQ+ F+G ++  P   G+ +  K  L         +GY LG+ D+ N+C  ++  T+   K I   II   + DP   
Sbjct:   88 SKNNITVPISYKRYMQTILHIYA-LHKTELFSPDLLWFKAINAIRWRHSNATRKRIQKGLNGIYQKDMAITQFGFIGYVFLVPEKLGMTNIEKY-LSGFNHYWQIIGYLLGISDRMNICRKTIAETRELCKKIQNEIIAKHLNDPHPE 233          
BLAST of EMLSAG00000011525 vs. Select Arthropod Genomes
Match: gb|KPM07197.1| (hypothetical protein QR98_0056840, partial [Sarcoptes scabiei])

HSP 1 Score: 66.2402 bits (160), Expect = 7.046e-12
Identity = 45/149 (30.20%), Postives = 71/149 (47.65%), Query Frame = 0
Query:   25 FARYLRTLNHTYAWFHSESSLS-----KSLIQVRNAHIRADKSSSSKRKG---QFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTK 165
            F RY  TL H   W+ ++  +      +SL +V+  H R   S +   K    + +S  DM +TQ+AF+G +   P   G  S  K  LEA+       G  LG+ D++NLC G  +      + I +   +P +E  + S KS EM++
Sbjct:   85 FRRYFDTLMHVKKWYENDFWIENNPGYQSLQEVKEMHRRVSDSQNKNLKDGDVRSISLKDMALTQFAFIGFIILCPEQLGF-STKKKDLEAVAHFWAVCGSMLGIPDEYNLCLGEYDRINRRCRKILDEDFRPRME--EFSNKSSEMSE 230          
BLAST of EMLSAG00000011525 vs. Select Arthropod Genomes
Match: EFX71876.1 (hypothetical protein DAPPUDRAFT_308669 [Daphnia pulex])

HSP 1 Score: 65.4698 bits (158), Expect = 2.744e-11
Identity = 34/109 (31.19%), Postives = 60/109 (55.05%), Query Frame = 0
Query:   71 FMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLC-YGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFV 178
            + +Q+DM  +Q+AFVG++   P  FG    S   L         +GY LG+ED+FN C   ++++T+   +   + +IKPA++D  +S + + M + + KG  +  P V
Sbjct:  213 YFNQFDMADSQFAFVGVIVLFPHKFGATYASDDELRGFIHFWRCIGYLLGIEDRFNFCDDDNLDLTRDLCRHYLDKMIKPALKD--ASAEFEHMARAVAKGASLYYPGV 319          
BLAST of EMLSAG00000011525 vs. nr
Match: gi|1058112181|gb|JAS59739.1| (hypothetical protein g.20903 [Cuerna arida])

HSP 1 Score: 110.538 bits (275), Expect = 8.259e-25
Identity = 76/239 (31.80%), Postives = 125/239 (52.30%), Query Frame = 0
Query:   17 NSSTPDTAFARYLRTLNHTYAWFHSE-----SSLSKSLIQVRNAHIRADKSSSSKRKG-QFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFVLPLAFGKCCFRALECNKKASKIRIPFFSLSNILFWIQIFVTDFLMLSNLTRHFLV-PCLNYLLRFNIYLSN 248
             SS P +AF RYL TL+H   W+  +     S  SKSL+ +R+ H  A + ++  R G   +SQ DM +TQ+ F+G    +P   GL + S+  LE        +G+ LG+++K+NLC G VE T++  +D+ + +    +  P +  +   M++ LL+G+  + P + P AF    F  L C     ++   F+  S  LF +Q+FV   L+  N    FLV P LN+ +   I+++ 
Sbjct:  103 QSSHPISAFRRYLDTLSHMLEWYEGDVMNPNSRASKSLLNIRSRHCHATRRAT--RAGYSNISQRDMALTQFGFMGFAVLRPKELGL-TGSQEDLEGFLHFWRVIGHLLGIKEKYNLCQGDVETTRAACQDMLDQVFNVGLRQPSADFQ--HMSRALLEGMWALVPLINPEAF--LSFTLLLCGINTFQLS-KFY--SRTLFHLQVFVQAVLL--NSVFGFLVRPILNFNMWLTIFITQ 329          
BLAST of EMLSAG00000011525 vs. nr
Match: gi|1058169242|gb|JAS88269.1| (hypothetical protein g.9614 [Homalodisca liturata])

HSP 1 Score: 105.531 bits (262), Expect = 7.342e-23
Identity = 69/239 (28.87%), Postives = 128/239 (53.56%), Query Frame = 0
Query:   17 NSSTPDTAFARYLRTLNHTYAWFHSE-----SSLSKSLIQVRNAHIRADKSSSSKRKGQF--MSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFVLPLAFGKCCFRALECNKKASKIRIPFFSLSNILFWIQIFVTDFLMLSNLTRHFLVPCLNYLLRFNIYLSN 248
             SS P +AF RYL T++H   W+  +     S  SKSL+ +R+ H  A + ++   K  F  +SQ DM +TQ+ F+G    +P   GL + S+  LE        +G+ LG+++++NLC G VE T++  + + + +    +  P +  +   M++ LL+G+  + PF+ P AF    F  L C     ++   F+S +  LF +Q+F+   ++L+++    + P LN+ +  +I+++ 
Sbjct:  103 QSSHPVSAFRRYLDTISHMLEWYEGDVMNPNSRASKSLLNIRSRHCHATRRAT---KAGFSNISQRDMALTQFGFMGFAVLRPKELGL-TGSQEDLEGFLHFWRVIGHLLGIKEQYNLCQGDVETTRAACQAMLDRVFNVGLRQPSADFQ--HMSRALLEGMWALVPFINPEAF--LSFTLLLCGIDTFQLS-KFYSRT--LFNLQVFIQA-VILNSVIGFIVRPILNFNMWLSIFITQ 329          
BLAST of EMLSAG00000011525 vs. nr
Match: gi|170048559|ref|XP_001853256.1| (conserved hypothetical protein [Culex quinquefasciatus] >gi|167870636|gb|EDS34019.1| conserved hypothetical protein [Culex quinquefasciatus])

HSP 1 Score: 104.76 bits (260), Expect = 1.015e-22
Identity = 57/173 (32.95%), Postives = 98/173 (56.65%), Query Frame = 0
Query:   15 SRNSSTPDTAFARYLRTLNHTYAWFHSE----SSLSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFVLPLAF 183
            ++ SST  TA+ RY+ T+ HT  W++ +    S+  +S+  VR  H    K SSSK  G+ ++Q DM VTQ+ FVG +       G++  S   +EA+      +GY +G++D++N+C  S+  T+   + I ++I++PA+E+       ++M K L+ G+   NPF+   AF
Sbjct:   88 TKQSSTAMTAYRRYVATIMHTLNWYYEDLTPGSTSWRSIAYVRRTHAATSKRSSSKLSGRIIAQKDMAVTQFGFVGYVVLGYKKLGIQY-SVEDMEAMVHFWRVIGYMIGIQDQYNICTDSLATTEQRMRQIQDHILRPALEERTEDF--EQMGKALITGMWSFNPFLNYDAF 257          
BLAST of EMLSAG00000011525 vs. nr
Match: gi|157114722|ref|XP_001652389.1| (AAEL001143-PA [Aedes aegypti] >gi|108883542|gb|EAT47767.1| AAEL001143-PA [Aedes aegypti])

HSP 1 Score: 104.375 bits (259), Expect = 1.392e-22
Identity = 58/173 (33.53%), Postives = 96/173 (55.49%), Query Frame = 0
Query:   15 SRNSSTPDTAFARYLRTLNHTYAWFHSE----SSLSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFVLPLAF 183
            +  SST  TA+ RY+ T+ HT  W++ +    ++  KS+  VR  H+ A K S++K  G+ +SQ DM VTQ+ FVG         G+   +K  +EAL      +G+ +G+ D++NLC  S+E T+   + + E+I++PA+         ++M K L+ G+   NPF+   AF
Sbjct:   88 TNQSSTAVTAYRRYVATIMHTLNWYYEDLLPGTAAWKSITYVRRGHVAASKRSNAKLAGRIVSQKDMAVTQFGFVGYTVLGCKKLGIVY-NKEDMEALVHFWRVIGHMIGIHDRYNLCTDSLESTEDRMRQVQEHILRPALLSRTDDF--EKMGKALIDGLWCFNPFLDYDAF 257          
BLAST of EMLSAG00000011525 vs. nr
Match: gi|998492591|ref|XP_015509989.1| (PREDICTED: uncharacterized protein LOC107217125 [Neodiprion lecontei])

HSP 1 Score: 103.219 bits (256), Expect = 3.754e-22
Identity = 62/179 (34.64%), Postives = 96/179 (53.63%), Query Frame = 0
Query:   15 SRNSSTPDTAFARYLRTLNHTYAWFHSESSLSK----SLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFVLPLAFGKCCFR 189
            ++ S TP TAF RY+ T+ HT+ W+  E    K    SL  VR  H  A K +S     + +SQ+DM VTQ+ F+G         G+ + S+  LE L  L   +G  LG+E++FN+C GSVE T++    I + +  P +   +     ++M +ILL+G+  I+P + P AF    +R
Sbjct:   87 TKQSGTPCTAFRRYVSTILHTFIWYEREPEKQKEFFASLKNVRRKHCVASKRASEAGINR-ISQFDMAVTQFGFIGFTILCGDELGV-AVSRKDLEGLIHLWRVIGSMLGIEERFNICTGSVEETKALCARILDEVFLPCLAAKRPEF--EKMRQILLEGVWSISPQIDPDAFTAITYR 261          
BLAST of EMLSAG00000011525 vs. nr
Match: gi|675364597|gb|KFM57499.1| (hypothetical protein X975_04622, partial [Stegodyphus mimosarum])

HSP 1 Score: 102.834 bits (255), Expect = 4.688e-22
Identity = 78/245 (31.84%), Postives = 122/245 (49.80%), Query Frame = 0
Query:    9 LISEGKSRNSSTPDTAFARYLRTLNHTYAWFHSE-----SSLSKSLIQVRNAHIR-ADK---SSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFVLPLAFGKCCFRALECNKKASKIRIPFFSLSNILFWIQIFVTDFLMLSNLTRHFLVPCLNYLLRFNI 244
            L+S G   NS+     F RYL TL H   W+  +         +S+  VR  H R ADK    S+ +R+   +SQYDM +TQ+AFVGL+   P + GL   SK  LE L      +GY LGVED++NLC G++E T +  KDI E  +KP++ +  +  +S  M++ ++K    +N F++ L++        E        ++  +  +   +W+  F   +L+       F     NYLLR  +
Sbjct:   81 LMSTG---NSANIICLFRRYLSTLVHIRRWYEGDIWNPDDPAHQSITMVRGMHKRVADKLNGPSTCRRRCPAVSQYDMALTQFAFVGLIILHPRHVGLHC-SKEDLECLIHFWRGIGYMLGVEDRYNLCNGNLEETIAICKDIMEAELKPSVRN--ACKESSSMSRGIIKA---MNSFIIFLSWEAMARFWFEQMGLPCDFQMGIYESTG--YWLMRFTFGWLLRLRFFHRF----FNYLLRIAV 310          
BLAST of EMLSAG00000011525 vs. nr
Match: gi|1121100056|ref|XP_019540271.1| (PREDICTED: uncharacterized protein LOC109411220 [Aedes albopictus])

HSP 1 Score: 102.834 bits (255), Expect = 6.547e-22
Identity = 55/168 (32.74%), Postives = 94/168 (55.95%), Query Frame = 0
Query:   15 SRNSSTPDTAFARYLRTLNHTYAWFHSE----SSLSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFV 178
            +  SST  TA+ RY+ T+ HT  W++ +    ++  KS+  VR  H+ A K SS+K  G+ +SQ DM VTQ+ FVG         G+   +K  +EAL      +GY +G+ D++NLC  ++  T+   + + E+I++PA+     +   ++M + L+ G+   NPF+
Sbjct:   88 TNQSSTAVTAYRRYIATIMHTLNWYYEDLLPGTAAWKSIAYVRRGHVAASKRSSAKLAGRIVSQKDMAVTQFGFVGYTVLCYKKLGIVY-NKEDMEALVHFWRVIGYMIGIHDRYNLCTDNLAATEDRMRQVQEHILRPALLTQTENF--EKMGRALIDGLWCFNPFL 252          
BLAST of EMLSAG00000011525 vs. nr
Match: gi|646694391|gb|KDR07972.1| (hypothetical protein L798_02399, partial [Zootermopsis nevadensis])

HSP 1 Score: 101.293 bits (251), Expect = 1.217e-21
Identity = 75/243 (30.86%), Postives = 117/243 (48.15%), Query Frame = 0
Query:   15 SRNSSTPDTAFARYLRTLNHTYAWFHSE-----SSLSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFVLPLAFGKCCFR--ALECNKKASKIRIPFFSLSNILFWIQIFVTDFLMLSNLTRHFLVPCLNYLLRFNIYLSNLL 250
            +R S+ P  AF RYL T+ H   W+  +     S   KSLI VR  H  A + +     G  +SQ DMV+TQ+ F+G     P   G+ S S    E        VG+ LG+ED+FN+C G V  T+   + I E +  PA+  P      + M+  LLK +  + PF+   AF     R   +E +   SK  + F   S ++   QI V + ++ + L    + P LN+ + F+++++  L
Sbjct:   72 TRQSNEPVAAFRRYLVTMIHMLDWYEGDLLEPTSRAHKSLIGVRTRHCSASRKARKAGLGP-ISQLDMVLTQFGFMGFGLLVPEKLGI-SGSPEEQEGFVHFWRTVGHLLGIEDRFNICKGDVLETKQLCQTILEQVFVPALRKPPKGF--EHMSLCLLKAMWSMVPFLDYDAFMSFTMRLAGVETSHN-SKETLTFH--SRVILAFQILVHEVVLRNWLLAWMVRPILNFGMWFSVFMTQRL 307          
BLAST of EMLSAG00000011525 vs. nr
Match: gi|939669487|ref|XP_014281627.1| (PREDICTED: uncharacterized protein LOC106684200 [Halyomorpha halys])

HSP 1 Score: 101.679 bits (252), Expect = 1.469e-21
Identity = 68/237 (28.69%), Postives = 125/237 (52.74%), Query Frame = 0
Query:   14 KSRNSSTPDTAFARYLRTLNHTYAWFHSESSLSKSLIQVRNAHIRADKSSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFVLPLAFGKCCFRALECNKKASKIRIPFFSLSNILFWIQIFVTDFLMLSNLTRHFLVPCLNYLLRFNIYLSNLL 250
            ++  SS P  A+ RY+ T+ H   W+ S+     S  +   A +RA  +++SK  G  ++Q D+ +TQ+ FVG+        GL  P ++GL    R+   +G+ +G++++FNLC G++  T +  +++++      +++P      ++M+K LL+G+  +  F  PLAF +   R   C  K+  I      L  +  +IQI V   L +  L+  FL+P LN+ + F I++ N +
Sbjct:   98 QTNKSSKPTAAYKRYMGTIRHMILWYQSDLRNPNSKGRQSIATVRAQHAAASKLFGP-ITQKDLALTQFGFVGIAIMCAKQLGL-PPDQNGLIHFWRV---IGHLMGIQERFNLCRGNMRCTAAACEEMAKRYFVLNLDNPPEYF--EQMSKSLLQGMWPLVVFFHPLAFKEHTRRLCGCPPKSLPI------LPLLFLYIQILVHKMLQIQVLS-FFLLPFLNFQMWFTIFVQNTM 320          
BLAST of EMLSAG00000011525 vs. nr
Match: gi|1009593762|ref|XP_015925767.1| (PREDICTED: uncharacterized protein LOC107453449 [Parasteatoda tepidariorum] >gi|1009593764|ref|XP_015925768.1| PREDICTED: uncharacterized protein LOC107453449 [Parasteatoda tepidariorum] >gi|1009593766|ref|XP_015925770.1| PREDICTED: uncharacterized protein LOC107453449 [Parasteatoda tepidariorum])

HSP 1 Score: 100.908 bits (250), Expect = 2.061e-21
Identity = 79/251 (31.47%), Postives = 126/251 (50.20%), Query Frame = 0
Query:    4 SRIERLISEGKSRNSSTPDTAFARYLRTLNHTYAWFHSE-----SSLSKSLIQVRNAHIR-ADK-SSSSKRKGQFMSQYDMVVTQWAFVGLLYTKPSNFGLKSPSKSGLEALRRLMYKVGYFLGVEDKFNLCYGSVEMTQSYSKDISEYIIKPAIEDPQSSVKSDEMTKILLKGIHIINPFVLPLAFGKCCFRALECNKKASKIRIPFFSLSNILFWIQIFVTDFLMLSNLTRHFLVPCLNYLLRFNIYLS 247
            S  E L+S G   NSS     F RYL TL H   W+  +         +S+  VR  H R ADK +   +R+   +SQYDM +TQ+AF+GL+   P + GL   S+  LE L      +GY LGVED++NLC GSV+ T +  + I E  +KP++ +  S+ +S  M++ ++K    +N F++ L++        E    A   ++  +  +   +W+  F    L+   L   F     N+LLR  + ++
Sbjct:   78 SMTEPLMSTG---NSSNIVCLFRRYLSTLVHIRRWYEGDIFDPKDPAHQSITMVRGMHKRVADKLNGPCRRRCMAVSQYDMALTQFAFIGLIALHPKHVGLHC-SQYDLECLIHFWRGIGYMLGVEDRYNLCSGSVDDTVAICRKIMEAELKPSVRN--STKESTTMSQGIIKA---MNSFIIFLSWEAMARFWFEQMGLACNFKMGIYESTG--YWLMRFTFGGLLKFRLFHKF----FNFLLRIAVKVA 313          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000011525 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 1
Match NameE-valueIdentityDescription
-2.372e-1530.12symbol:CG31344 species:7227 "Drosophila melanogast... [more]
back to top
BLAST of EMLSAG00000011525 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 11
Match NameE-valueIdentityDescription
gi|592808479|gb|GAXK01146089.1|5.808e-3535.90TSA: Calanus finmarchicus comp399183_c0_seq1 trans... [more]
gi|592949056|gb|GAXK01009497.1|2.110e-3334.33TSA: Calanus finmarchicus comp1248572_c0_seq1 tran... [more]
gi|592949055|gb|GAXK01009498.1|8.832e-3141.03TSA: Calanus finmarchicus comp1248572_c0_seq2 tran... [more]
gi|592949054|gb|GAXK01009499.1|3.848e-2743.07TSA: Calanus finmarchicus comp1248572_c0_seq3 tran... [more]
gi|592897400|gb|GAXK01060975.1|1.325e-526.17TSA: Calanus finmarchicus comp172307_c0_seq1 trans... [more]
gi|592924017|gb|GAXK01034398.1|1.270e-229.11TSA: Calanus finmarchicus comp359143_c0_seq3 trans... [more]
gi|592924019|gb|GAXK01034396.1|1.334e-229.11TSA: Calanus finmarchicus comp359143_c0_seq1 trans... [more]
gi|592924016|gb|GAXK01034399.1|1.472e-229.11TSA: Calanus finmarchicus comp359143_c0_seq4 trans... [more]
gi|592924018|gb|GAXK01034397.1|1.572e-229.11TSA: Calanus finmarchicus comp359143_c0_seq2 trans... [more]
gi|592923118|gb|GAXK01035271.1|1.567e+041.18TSA: Calanus finmarchicus comp1516615_c0_seq6 tran... [more]

Pages

back to top
BLAST of EMLSAG00000011525 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 1
Match NameE-valueIdentityDescription
EMLSAP000000115250.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s799:30883... [more]
back to top
BLAST of EMLSAG00000011525 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000011525 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 21
Match NameE-valueIdentityDescription
AAN13634.18.385e-1630.12uncharacterized protein Dmel_CG31344 [Drosophila m... [more]
EAA10900.32.392e-1531.65AGAP005759-PA [Anopheles gambiae str. PEST][more]
gb|KPM04836.1|2.746e-1533.59hypothetical protein QR98_0032900 [Sarcoptes scabi... [more]
gb|KPM11373.1|3.320e-1529.90hypothetical protein QR98_0099440 [Sarcoptes scabi... [more]
gb|EEC19922.1|5.636e-1527.43conserved hypothetical protein [Ixodes scapularis][more]
gb|KPM10449.1|1.005e-1427.55hypothetical protein QR98_0090050 [Sarcoptes scabi... [more]
XP_001119997.33.839e-1328.08PREDICTED: uncharacterized protein LOC724229, part... [more]
XP_392181.45.340e-1327.70PREDICTED: uncharacterized protein LOC408641 [Apis... [more]
gb|KPM07197.1|7.046e-1230.20hypothetical protein QR98_0056840, partial [Sarcop... [more]
EFX71876.12.744e-1131.19hypothetical protein DAPPUDRAFT_308669 [Daphnia pu... [more]

Pages

back to top
BLAST of EMLSAG00000011525 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|1058112181|gb|JAS59739.1|8.259e-2531.80hypothetical protein g.20903 [Cuerna arida][more]
gi|1058169242|gb|JAS88269.1|7.342e-2328.87hypothetical protein g.9614 [Homalodisca liturata][more]
gi|170048559|ref|XP_001853256.1|1.015e-2232.95conserved hypothetical protein [Culex quinquefasci... [more]
gi|157114722|ref|XP_001652389.1|1.392e-2233.53AAEL001143-PA [Aedes aegypti] >gi|108883542|gb|EAT... [more]
gi|998492591|ref|XP_015509989.1|3.754e-2234.64PREDICTED: uncharacterized protein LOC107217125 [N... [more]
gi|675364597|gb|KFM57499.1|4.688e-2231.84hypothetical protein X975_04622, partial [Stegodyp... [more]
gi|1121100056|ref|XP_019540271.1|6.547e-2232.74PREDICTED: uncharacterized protein LOC109411220 [A... [more]
gi|646694391|gb|KDR07972.1|1.217e-2130.86hypothetical protein L798_02399, partial [Zootermo... [more]
gi|939669487|ref|XP_014281627.1|1.469e-2128.69PREDICTED: uncharacterized protein LOC106684200 [H... [more]
gi|1009593762|ref|XP_015925767.1|2.061e-2131.47PREDICTED: uncharacterized protein LOC107453449 [P... [more]

Pages

back to top
BLAST of EMLSAG00000011525 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s799supercontigLSalAtl2s799:308831..309981 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s799-snap-gene-3.68
Biotypeprotein_coding
EvidenceIEA
Notehypothetical protein g.20903 [Cuerna arida]
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000011525 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000011525EMLSAT00000011525-707372Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s799:308831..309981+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000011525-694291 ID=EMLSAG00000011525-694291|Name=EMLSAG00000011525|organism=Lepeophtheirus salmonis|type=gene|length=1151bp|location=Sequence derived from alignment at LSalAtl2s799:308831..309981+ (Lepeophtheirus salmonis)
GAAGAGGGCAGGACTGTATATTATTTACCTGTAATTTTTTTAAAGCTATA ATAGTTTTTAAACATTTCATCATCATCATGACGATGTCTCGGATTGAAAG ACTCATTTCCGAAGGAAAATCCCGTAAACATATAACTCAAGAACGAATAG ATGAATTAGAGGAGGATGAAGACTATTTGAAAGAAGATATCAATTGTGTG AGAGCATTTCTTTTAGGAAATTTTTTTTCATGCTTTCTAGCAATGCTTAC TGGCCTTATATCCCTTCTCTATATTCCATCTATTCTGGAGGTTCTTATCA TCACAGGAAATTCATCTACACCAGATACAGCCTTTGCAAGATATTTACGA ACATTGAACCATACCTATGCATGGTTCCATAGTGAATCTTCTCTAAGTAA ATCATTGATTCAAGTACGGAACGCTCATATCCGTGCTGATAAATCATCAA GTTCCAAAAGGAAAGGACAATTCATGAGTCAATATGATATGGTTGTGACT CAATGGGCATTTGTAGGCCTATTATATACTAAACCATCAAATTTTGGATT AAAAAGTCCCTCTAAATCGGGTTTAGAGGCTCTAAGACGTCTTATGTACA AAGTTGGTTATTTCCTGGGTGTAGAAGATAAATTTAACCTCTGCTATGGC TCAGTGGAAATGACTCAGTCCTATTCCAAAGACATTAGTGAATACATTAT CAAACCGGCTATAGAGGATCCTCAGTCATCCGTCAAATCTGATGAAATGA CCAAAATATTATTGAAAGGGATTCACATCATCAATCCATTTGTACTTCCT CTCGCATTTGGCAAGTGCTGCTTCCGTGCTCTAGAGTGTAATAAAAAGGC ATCAAAAATTAGGATCCCCTTTTTCTCATTGAGTAATATCTTATTCTGGA TTCAAATTTTTGTGACGGACTTTTTAATGCTTTCAAATTTGACTCGACAT TTCCTTGTGCCCTGTCTTAACTACCTTTTACGATTCAACATCTACTTGTC AAACCTTCTAAATCCATCAATTAACAAAATGAAGGCTCGACTCTATGCAA AATAGCAAATTATTTAGTTATATAATAATTAATACATCCAGTTTATCTTT CTAGCGTCTTATTAAGCATGACAAAGTTACTTTATGCAGCATCATCAAGT A
back to top
Add to Basket