EMLSAG00000012828, EMLSAG00000012828-695594 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000012828
Unique NameEMLSAG00000012828-695594
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
R F124 UN32_g22197 female
  1. PreAdult2
Normal
no visible phenotype
21.08.2014 - 10:23
01.10.2014 (All day)
Homology
BLAST of EMLSAG00000012828 vs. C. finmarchicus
Match: gi|592754097|gb|GAXK01200316.1| (TSA: Calanus finmarchicus comp306414_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 50.447 bits (119), Expect = 6.372e-6
Identity = 36/107 (33.64%), Postives = 50/107 (46.73%), Query Frame = 0
Query:  201 IHSLTARSVPRHFREGLKKGLTHFTDKNIKIPGSDSTIHSRNYGNXXXXXXXXXXXXXHVIYDXXXXXXXXXXXXXXXTMESTRTPSPEHVGIPASRVRLTPKKRSD 307
            +HSLTARSVPR FR+GLK       D  +K+P            N  E Y   ++   H++YD               +    R+ SPEH GIPA  V  T ++++D
Sbjct:  151 VHSLTARSVPRSFRDGLKSNKAPVKDNIVKVP----------LVNMMEPYPGLEDNQVHIVYD---------------SRSDYRSDSPEHSGIPAMPVVFTTRRQAD 396          
BLAST of EMLSAG00000012828 vs. C. finmarchicus
Match: gi|592754095|gb|GAXK01200318.1| (TSA: Calanus finmarchicus comp306414_c1_seq3 transcribed RNA sequence)

HSP 1 Score: 48.9062 bits (115), Expect = 8.959e-6
Identity = 36/107 (33.64%), Postives = 50/107 (46.73%), Query Frame = 0
Query:  201 IHSLTARSVPRHFREGLKKGLTHFTDKNIKIPGSDSTIHSRNYGNXXXXXXXXXXXXXHVIYDXXXXXXXXXXXXXXXTMESTRTPSPEHVGIPASRVRLTPKKRSD 307
            +HSLTARSVPR FR+GLK       D  +K+P            N  E Y   ++   H++YD               +    R+ SPEH GIPA  V  T ++++D
Sbjct:  151 VHSLTARSVPRSFRDGLKSNKAPVKDNIVKVP----------LVNMMEPYPGLEDNQVHIVYD---------------SRSDYRSDSPEHSGIPAMPVVFTTRRQAD 396          
BLAST of EMLSAG00000012828 vs. C. finmarchicus
Match: gi|592754096|gb|GAXK01200317.1| (TSA: Calanus finmarchicus comp306414_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 49.6766 bits (117), Expect = 1.123e-5
Identity = 36/107 (33.64%), Postives = 50/107 (46.73%), Query Frame = 0
Query:  201 IHSLTARSVPRHFREGLKKGLTHFTDKNIKIPGSDSTIHSRNYGNXXXXXXXXXXXXXHVIYDXXXXXXXXXXXXXXXTMESTRTPSPEHVGIPASRVRLTPKKRSD 307
            +HSLTARSVPR FR+GLK       D  +K+P            N  E Y   ++   H++YD               +    R+ SPEH GIPA  V  T ++++D
Sbjct:  151 VHSLTARSVPRSFRDGLKSNKAPVKDNIVKVP----------LVNMMEPYPGLEDNQVHIVYD---------------SRSDYRSDSPEHSGIPAMPVVFTTRRQAD 396          
BLAST of EMLSAG00000012828 vs. C. finmarchicus
Match: gi|592756800|gb|GAXK01197613.1| (TSA: Calanus finmarchicus comp724885_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 44.2838 bits (103), Expect = 1.182e-4
Identity = 36/109 (33.03%), Postives = 47/109 (43.12%), Query Frame = 0
Query:  201 IHSLTARSVPRHFREGLKKGLTHFTDKNIKIP------GSDSTIHSRNYGNXXXXXXXXXXXXXHVIYDXXXXXXXXXXXXXXXTMESTRTPSPEHVGIPASRVRLTPK 303
            +HS+TARSVPR FRE L+ G    TD   K+P      G   T+ ++N               + V+Y S                E  RT SPE+ GIPA    +T K
Sbjct:  134 VHSITARSVPREFRESLRLGKAEVTDTIFKLPEAKQNDGQPGTVRNKN------------NIMATVVYSSSNPCPLYPDG------EYNRTYSPEYSGIPALPAVITSK 406          
BLAST of EMLSAG00000012828 vs. C. finmarchicus
Match: gi|592756797|gb|GAXK01197616.1| (TSA: Calanus finmarchicus comp724885_c1_seq5 transcribed RNA sequence)

HSP 1 Score: 43.1282 bits (100), Expect = 1.383e-4
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 0
Query:  201 IHSLTARSVPRHFREGLKKGLTHFTDKNIKIP 232
            +HS+TARSVPR FRE LK G +  TD   K+P
Sbjct:  115 VHSITARSVPREFRESLKLGKSEVTDTIFKLP 210          
BLAST of EMLSAG00000012828 vs. C. finmarchicus
Match: gi|592756801|gb|GAXK01197612.1| (TSA: Calanus finmarchicus comp724885_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 44.2838 bits (103), Expect = 2.312e-4
Identity = 39/121 (32.23%), Postives = 51/121 (42.15%), Query Frame = 0
Query:  195 FKFKEP------IHSLTARSVPRHFREGLKKGLTHFTDKNIKIP------GSDSTIHSRNYGNXXXXXXXXXXXXXHVIYDXXXXXXXXXXXXXXXTMESTRTPSPEHVGIPASRVRLTPK 303
             K K+P      +HS+TARSVPR FRE L+ G    TD   K+P      G   T+ ++N               + V+Y S                E  RT SPE+ GIPA    +T K
Sbjct:  134 LKVKKPDGGYPQVHSITARSVPREFRESLRLGKAEVTDTIFKLPEAKQNDGQPGTVRNKN------------NIMATVVYSSSNPCPLYPDG------EYNRTYSPEYSGIPALPAVITSK 442          
BLAST of EMLSAG00000012828 vs. C. finmarchicus
Match: gi|592841952|gb|GAXK01115592.1| (TSA: Calanus finmarchicus comp1061570_c0_seq4 transcribed RNA sequence)

HSP 1 Score: 40.0466 bits (92), Expect = 9.671e-3
Identity = 18/42 (42.86%), Postives = 25/42 (59.52%), Query Frame = 0
Query:  201 IHSLTARSVPRHFREGLKKGLTHFTDKNIKIPGSDSTIHSRN 242
            +HS+TARSV R FRE LK G    TD   K+P +     +++
Sbjct:  190 VHSITARSVSRQFRESLKIGKPELTDDIFKLPEAKQNTRTKD 315          
BLAST of EMLSAG00000012828 vs. C. finmarchicus
Match: gi|592841954|gb|GAXK01115590.1| (TSA: Calanus finmarchicus comp1061570_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 40.0466 bits (92), Expect = 9.875e-3
Identity = 18/42 (42.86%), Postives = 25/42 (59.52%), Query Frame = 0
Query:  201 IHSLTARSVPRHFREGLKKGLTHFTDKNIKIPGSDSTIHSRN 242
            +HS+TARSV R FRE LK G    TD   K+P +     +++
Sbjct:  190 VHSITARSVSRQFRESLKIGKPELTDDIFKLPEAKQNTRTKD 315          
BLAST of EMLSAG00000012828 vs. C. finmarchicus
Match: gi|592841953|gb|GAXK01115591.1| (TSA: Calanus finmarchicus comp1061570_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 39.6614 bits (91), Expect = 1.140e-2
Identity = 18/32 (56.25%), Postives = 21/32 (65.62%), Query Frame = 0
Query:  201 IHSLTARSVPRHFREGLKKGLTHFTDKNIKIP 232
            +HS+TARSV R FRE LK G    TD   K+P
Sbjct:  220 VHSITARSVSRQFRESLKIGKPELTDDIFKLP 315          
BLAST of EMLSAG00000012828 vs. C. finmarchicus
Match: gi|592841955|gb|GAXK01115589.1| (TSA: Calanus finmarchicus comp1061570_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 39.6614 bits (91), Expect = 1.163e-2
Identity = 18/32 (56.25%), Postives = 21/32 (65.62%), Query Frame = 0
Query:  201 IHSLTARSVPRHFREGLKKGLTHFTDKNIKIP 232
            +HS+TARSV R FRE LK G    TD   K+P
Sbjct:  220 VHSITARSVSRQFRESLKIGKPELTDDIFKLP 315          
BLAST of EMLSAG00000012828 vs. L. salmonis peptides
Match: EMLSAP00000012828 (pep:novel supercontig:LSalAtl2s:LSalAtl2s979:4:5108:1 gene:EMLSAG00000012828 transcript:EMLSAT00000012828 description:"maker-LSalAtl2s979-augustus-gene-0.3")

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 350/350 (100.00%), Postives = 350/350 (100.00%), Query Frame = 0
Query:    1 MDSTTKTMPHCPVKSKITLGEISVVHYESLDDEKEATSTTTHSTKTTTSIQQQQPFVSSVYLNCPDGYVRDASPTEDDEPYYYDVPSDLDKIRLINPKSKHSSVWSFVDVCLNNNNNEKDVPKEEIETTQGSEEEDHRLYLCPILIDDNTHSDSISSCSTNYNNNHYYYYIPLKEETMSAVIGIHDFENEPIPTFKFKEPIHSLTARSVPRHFREGLKKGLTHFTDKNIKIPGSDSTIHSRNYGNSEEDYYDDDEESSHVIYDSKKKYQSSSVSSNNNTMESTRTPSPEHVGIPASRVRLTPKKRSDVTTTYCYTSDESTNNELYEHKTHHPPPSARRKQIIQQRLQNQI 350
            MDSTTKTMPHCPVKSKITLGEISVVHYESLDDEKEATSTTTHSTKTTTSIQQQQPFVSSVYLNCPDGYVRDASPTEDDEPYYYDVPSDLDKIRLINPKSKHSSVWSFVDVCLNNNNNEKDVPKEEIETTQGSEEEDHRLYLCPILIDDNTHSDSISSCSTNYNNNHYYYYIPLKEETMSAVIGIHDFENEPIPTFKFKEPIHSLTARSVPRHFREGLKKGLTHFTDKNIKIPGSDSTIHSRNYGNSEEDYYDDDEESSHVIYDSKKKYQSSSVSSNNNTMESTRTPSPEHVGIPASRVRLTPKKRSDVTTTYCYTSDESTNNELYEHKTHHPPPSARRKQIIQQRLQNQI
Sbjct:    1 MDSTTKTMPHCPVKSKITLGEISVVHYESLDDEKEATSTTTHSTKTTTSIQQQQPFVSSVYLNCPDGYVRDASPTEDDEPYYYDVPSDLDKIRLINPKSKHSSVWSFVDVCLNNNNNEKDVPKEEIETTQGSEEEDHRLYLCPILIDDNTHSDSISSCSTNYNNNHYYYYIPLKEETMSAVIGIHDFENEPIPTFKFKEPIHSLTARSVPRHFREGLKKGLTHFTDKNIKIPGSDSTIHSRNYGNSEEDYYDDDEESSHVIYDSKKKYQSSSVSSNNNTMESTRTPSPEHVGIPASRVRLTPKKRSDVTTTYCYTSDESTNNELYEHKTHHPPPSARRKQIIQQRLQNQI 350          
BLAST of EMLSAG00000012828 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold186_size273091-snap-gene-1.41 (protein:Tk00926 transcript:maker-scaffold186_size273091-snap-gene-1.41-mRNA-1 annotation:"hypothetical protein L798_13876")

HSP 1 Score: 62.003 bits (149), Expect = 7.536e-12
Identity = 44/118 (37.29%), Postives = 56/118 (47.46%), Query Frame = 0
Query:  201 IHSLTARSVPRHFREGLKKGLTHFTDKNIK-----------IPGSDSTIHSRNYGNSEEDYYDDDEESS--HVIYDSKKKYQSSSVSSNNNTMESTRTPSPEHVGIPASRVRLTPKKR 305
            IHSLTARSVPR FREGLKKG+    D+NIK           +   + T  S              + ++  H+IYDS+ K             E  R+PSPEH GIPA  V +  + R
Sbjct:   45 IHSLTARSVPRQFREGLKKGMPFLADRNIKTATDPPRTPWDVTTGEGTQSSPPISAPSTSQPRGSKPTTPLHIIYDSENKDLVPYPEG-----EFIRSPSPEHSGIPALPVTMRLRSR 157          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000012828 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000012828 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 11
Match NameE-valueIdentityDescription
gi|592754097|gb|GAXK01200316.1|6.372e-633.64TSA: Calanus finmarchicus comp306414_c1_seq1 trans... [more]
gi|592754095|gb|GAXK01200318.1|8.959e-633.64TSA: Calanus finmarchicus comp306414_c1_seq3 trans... [more]
gi|592754096|gb|GAXK01200317.1|1.123e-533.64TSA: Calanus finmarchicus comp306414_c1_seq2 trans... [more]
gi|592756800|gb|GAXK01197613.1|1.182e-433.03TSA: Calanus finmarchicus comp724885_c1_seq2 trans... [more]
gi|592756797|gb|GAXK01197616.1|1.383e-459.38TSA: Calanus finmarchicus comp724885_c1_seq5 trans... [more]
gi|592756801|gb|GAXK01197612.1|2.312e-432.23TSA: Calanus finmarchicus comp724885_c1_seq1 trans... [more]
gi|592841952|gb|GAXK01115592.1|9.671e-342.86TSA: Calanus finmarchicus comp1061570_c0_seq4 tran... [more]
gi|592841954|gb|GAXK01115590.1|9.875e-342.86TSA: Calanus finmarchicus comp1061570_c0_seq2 tran... [more]
gi|592841953|gb|GAXK01115591.1|1.140e-256.25TSA: Calanus finmarchicus comp1061570_c0_seq3 tran... [more]
gi|592841955|gb|GAXK01115589.1|1.163e-256.25TSA: Calanus finmarchicus comp1061570_c0_seq1 tran... [more]

Pages

back to top
BLAST of EMLSAG00000012828 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 1
Match NameE-valueIdentityDescription
EMLSAP000000128280.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s979:4:510... [more]
back to top
BLAST of EMLSAG00000012828 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000012828 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000012828 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000012828 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 1
Match NameE-valueIdentityDescription
maker-scaffold186_size273091-snap-gene-1.417.536e-1237.29protein:Tk00926 transcript:maker-scaffold186_size2... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s979supercontigLSalAtl2s979:4..5108 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s979-augustus-gene-0.3
Biotypeprotein_coding
EvidenceIEA
NoteHypothetical protein
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000012828 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000012828EMLSAT00000012828-708675Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s979:4..5108+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000012828-695594 ID=EMLSAG00000012828-695594|Name=EMLSAG00000012828|organism=Lepeophtheirus salmonis|type=gene|length=5105bp|location=Sequence derived from alignment at LSalAtl2s979:4..5108+ (Lepeophtheirus salmonis)
GTAATTTTCATTTTTGAATAATTCCCTTCGTCATCTCTTTCACTCCATAT TTTTTGTAATCATAAAAAAGATACTAACTCTAACCATAACGTCCTCGACC ATGGATTCAACTACAAAAACGATGCCTCATTGCCCTGTAAAGTCAAAAAT AACTTTGGGAGAGATCTCTGTCGTACACTACGAATCCTTGGACGATGAAA AAGAAGCCACCTCCACAACAACTCACTCTACTAAAACAACAACTTCCATA CAACAGCAACAGCCCTTTGTAAGCTCAGTCTATTTGAACTGTCCGGATGG ATACGTCCGCGACGCTAGTCCTACTGAAGATGATGAACCCTACTATTATG ATGTTCCATCTGATTTAGATAAAATACGACTCATCAATCCCAAGTCAAAA CATTCCAGTGTTTGGAGTTTTGTGGATGTGTGCCTTAATAATAATAATAA TGAGAAAGATGTACCTAAAGAAGAGATTGAGACGACTCAAGGATCTGAAG AAGAGGACCATCGTCTCTATCTCTGTCCAATACTAATCGATGATAATACT CACTCAGATTCCATTTCTTCTTGTTCCACTAATTATAACAATAATCATTA TTATTACTATATTCCATTAAAGGAGGAGACGATGTCGGCCGTGATAGGGA TTCATGACTTTGAAAATGAACCGGTACACATAACATTGTACTCTCTAATT TGAACTCAGTATAAGGGAGCACAAAAAATTCCCAACAAATTCATATCATC TTTGTAGGTAAGTTTTTACATCCATTGGACGTGTGATCACTAAACCCGTT TGATTTTCAACTTTTTTTGAATTTGGATTCGAGTAGTTCGGAAAAGTTGT GATATAGTATGAAAATTACATATGCAAAATTGCATTTATCTATGATGTCA TCTTTAGAAGTAGTACATCTTGTTTTGTTCAAAGTTTGAAAGTAGACATA AGTTCTTTATTTCGCTAATAAGGATTAAAATAAAGCATGAATCATTATTT TGTATTGATTATTTATGATAGACATTATTCTACTATATAAAAAACTTAAA TAAAGTTTTTATTCTAAAGCTACACTATGGAGCAAAAAGATGTAGAAAAA AGAGGCGGGCTATGCGTGGATCATCTAATTTTCTGGGTTGTTTTTTTTTT GCTCCATAGGACAATTTTAGAAAAAAAAACACTTTATATAGGTTAAAAAA ATGTCTATCAAAATTATTTATTATGAAATAATGAAAAATTTCCTTTTAGT ATCTATATTGAGGAATTAAAGAGTTCTTGCCTTTTTTTCATAATTTGATC GAGATGTGCTACCTAAAGATGACCACGTAGGACACTGCAATTTTGAAAAG GTCATTTTCATACAATATGACAACATTTCCGCACTAGCAATAATCAAAAT TCGAAAATAGTTGAAAATCAAACCGGTCTAGTGTACAGGTCTGAACGACC TGTATACTTTTGAAATGAAGCAATGGACGCCTTATTGCTAAGAACTCTGC TTACCTTGTATTATAATCTTCAAACTTTAACAATTATACTCCTTTTTAAT ATAAAGAGGTTATATTATAAGTTTAAAAAATGTGTTAAATGCCATGAAAT CATGTAAACACGTTAGTCTCATCAAATTTGAAAAAAAACAAACATATTCT CTATTGTTCTGTTTGCCAACTGTTAATGATTATTGAAAGAATCGACATTA ATTATCCTATACATACATTTAAATGATAATCTTATCAATGACTGAGTATG AAATGACTCAGTTTCTAATCGAAGTTCCTATATTTATATAAATCAAATTG AATACATATACAAATCTTATCTCGTACACTTTTTTAGCTCATTGAGCTCA TACAAAATACCATTCATGAAAATAAACTAAAACAGCGGAAAGGAAAATAC ATTACATCTCTGTTTAATTTCAAAAAGCTGATTGTGAGTAACTCACGAAG TTAGCTTTTTTGGACTATACAAAGATATTTGTATTTTCCCTTCAGTTATT TTTGTTTGTTAACTCTTTTTGATTAAAAGTACTTACATAATTATGAATTT AGAAGAATATTAATTCATCTCAACTTGCCCGAATATACCTTAACAGGTCA CGTACAAAGTATGTACGTATTTTTTTGGCATATTTTGTCCCTCTATCATA TTTGCATTCAGTAGAATTAATCTATTTACTTGATTAATTCTTGTGTTAAA TGTTGTTCAGCCCTTATTTAGGACTGAATACTGCAGTCCTGTTCAGTTTA TGTCCTTTCCAGTTCAGTCCTGCATTTCTTCTTTTTTAAACAGCTTTAGT ATTGACAGTCCAAAGGATCAGTACCAAGGACTGATAGGGCCGGTCATAAG ACTTGACTGGACCGAATAAACAAGAAACGAYACAACCCTACTTATGTTCG CAATTTTTCCTCATCTTTTTGAAAAGAAAGATTGGGAGTGGAGAAAAAAA GCTCGTTGTAAATTATCCCAAAGATATCATTCATCGTGACATTTTTACTC TTACTAACGAAAAACCTTTTTTAAAGGATTGAACCTAATGGTTGATCCGT CTAAAAAATGAAAAGACACGAAGTCCTATCAGGCTGGTCCTAGTAAAATT TATCAGTCCTAATACCGCTCCTTCTTGATCTTTTGTGGTAACTACAACAA CTAAAATGACAGCTGTCATTAGCTGTAGAAGTTATTTTATTATCTCTTTC AAAAAATAAAAAGGATGGCTAGAACCGTGACCGACTAATTGGACACTGGC GGCTTTTTGAAATAAACAAAGACATACTGTATTTTCACTTCAGCTGTTTT CATCAAAGTTGACTCTGGTATGATTAAAAGCAGTTGGCGCTAAGTTTATG AACTCAAAAAAAGTTTATAAATAGGATTAGGATTTATATCAATCAAGGAC CTCCATTTAGATTGATGTCATTTCATACTCTGGCATTGATACTTATTTTG ACAATTAATCAATTCATTTTATCTAACAGCTAATAGCTAACAGTTGGTAA CAATAAAAATACAGAATTCTAGCTACCATGTGCACATATTTTTGAATAAA ATAGGAGAAAAAGACCAACTCGTTTTTCAGCTGTTGACTAATACATAAAT ACTTCAATCTACTTGGTTTATTTATTACATAGGTATAAGATAAAATATCA GCTGACAGTTGACTCTCCCTTTCTTTTCCTATTGAGTATCCAGTTATTAT ACAGGTCGGTAGTCTTCACAAACGTTAAAAATTGAATCATAATTGAAGGC AACACCATCTTGGGAGCTATGAATAAGGAATAATTATTGTTGAAGGTCCG ACGGATCGGTCCTTAGGACTGTTGAATGGTAAAAAAGATCTTACCGATAA AAAAGACTGAAAGGGAGGGGGAATGATTTCCTAGGCCGATCCAACACTAG TTCAACCTCTTCATATTAAAAAAGGATCTTTATTGAGGTTTGAAGATTAT ACATAATATTCAGAGTTCTTTTACATAAATGGTCCATTCCACAGTCATAC GCGTATTGACGTTCTGTACACGTGCAAAAGATGTAGAAATTTACTTTATC TCCCAAAAATTCCATAAACAATGATGTATTACGAATCCAAACTATGTACT TCAATTCAATACATGTCAACCTATATAAATCTCTCTCTATCTCCTTATAA ATACTTATCTTCTATTTTAGATACCGACGTTTAAATTCAAAGAACCAGTA CGTTTATTCGTCTAATTCACTATTTACTTTTATTTACCTCTTTTTTGAAC TATCATTACTTACTTACACAATTTTTCTTCATTTTCTGTTCTATATTTTG TTTCGTTTTTCACTTACACTGAATGTGTAGAGTGCCCATGGTGTAGGGTC TCTATTTGGTAGTTTTAACCCTTTTAACAAATTATATGGGCTATGGTTGC ACCATATTGTATGTGTTCAAAAAATAAAAACTGAACATTATTTTATATTA ATATAACATCAACAACATTTTTATTTTTTGAATTTATTTTTTTTAATGCA AGGTGTATTACTACAAAACCTGAACCAAATGTAAAGATGTTTTTCCATAG ATTTTTTTATTATGTTTTTTTTGTGGCTAMTTTTYATKATGCTCNTTTTC TTATTTTTTTTAGATTCACAGTTTGACGGCACGCAGTGTTCCAAGGCACT TCAGAGAGGTAAATATATACGATATTTTTACAACGACCGGGGTTCTAGAA CCAATTATCATGTGGGTTATATATTGATGAAACCATAATAACGCCACTTT TTATAATATTTTTCGAAAAGTTCCGGTTCTTATGACGACAGAACTTCTCA AACTGTGGGAGACGTCAAAGGCGGCACTGAAAGATTTTGAGCAAGTATCG TTTTTACTGAAAGTGAAAATACTATTCAGTATAAATAGCACGATATACAG CGAACAAAAAGATTTTTTTAATATGACTACAGTGTTATTTCTTATATCAA AGTTCGAATATCTATATTTTTTTAAATCCAAAAATCACAAAAAAAAGTAA ATATGGAAGATTTTTCATAAATTAAAAGGATCATTTCTAATTTCAGGGCT TAAAAAAAGGTCTAACTCACTTTACTGACAAGAACATAAAGATTCCCGGC TCTGATTCCACTATCCATAGTAGAAACTACGGCAACTCCGAGGAGGACTA CTATGACGACGATGAAGAGTCATCCCATGTCATATACGACTCCAAGAAGA AGTATCAGAGTAGCAGTGTGAGTAGTAATAACAACACTATGGAGAGTACA CGCACACCCAGTCCTGAGCACGTAGGTATTCCAGCATCTCGAGTCCGACT CACGCCGAAGAAGCGATCAGACGTAACGACCACATACTGCTACACTTCAG ATGAAAGTACGAACAATGAATTATATGAGCATAAAACCCATCATCCTCCT CCATCAGCTCGCCGGAAGCAAATTATTCAACAACGACTTCAAAATCAGAT TTGAAATCATTTTTTATCATTACTAAAGTTTATCATTAATTGTTTCATCT TTTTTTAATTACTATTATAATTTTAGAATTGTTTTAAAAATATTATTATT TTTGTAATATTTTATAAGTCATACTTTATGTTTTAGTTCTTATGTATAAA ATTTA
back to top
Add to Basket