EMLSAT00000003443, EMLSAT00000003443-699290 (mRNA) Lepeophtheirus salmonis

Overview
NameEMLSAT00000003443
Unique NameEMLSAT00000003443-699290
TypemRNA
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
D F32 NLG3408_TSC1 female
  1. PreAdult2
-Missing-
no visible phenotype
24.08.2012 - 13:42
03.10.2012 (All day)
Molecular characterization and functional... more
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: female reproduction, shorter eggstrings
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
D F32/F33 g18363_TSC2, NLG3408_TSC1 female
  1. PreAdult2
-Missing-
female reproduction, shorter eggstrings
24.08.2012 - 13:49
03.10.2012 (All day)
Molecular characterization and functional... more
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s188supercontigLSalAtl2s188:634817..638620 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Properties
Property NameValue
Logic nameensemblgenomes
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this mRNA
DatabaseAccession
Ensembl Metazoa (transcript)EMLSAT00000003443 (primary cross-reference)
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
EMLSAG00000003443EMLSAG00000003443-686209Lepeophtheirus salmonisgene


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EMLSAE00000014978EMLSAE00000014978-723906Lepeophtheirus salmonisexon
EMLSAE00000014979EMLSAE00000014979-723907Lepeophtheirus salmonisexon
EMLSAE00000014980EMLSAE00000014980-723908Lepeophtheirus salmonisexon
EMLSAE00000014981EMLSAE00000014981-723909Lepeophtheirus salmonisexon
EMLSAE00000014982EMLSAE00000014982-723910Lepeophtheirus salmonisexon
EMLSAE00000014983EMLSAE00000014983-723911Lepeophtheirus salmonisexon
EMLSAE00000014984EMLSAE00000014984-723912Lepeophtheirus salmonisexon


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
polypeptide-auto779027auto779027Lepeophtheirus salmonispolypeptide
EMLSAP00000003443EMLSAP00000003443Lepeophtheirus salmonispolypeptide


Sequences
The following sequences are available for this feature:

protein sequence of EMLSAP00000003443

>EMLSAP00000003443 ID=EMLSAP00000003443|Name=EMLSAP00000003443|organism=Lepeophtheirus salmonis|type=polypeptide|length=1042bp
MEVDEIFSHLESDHCEVVQEVRQVIYDQFAEVKEPWLINGLYDYCCSIAG
RVCSRHPCLELILGVREPHDKFLSDRLTESLIRGSSEQKVEALLILGHLI
RKSPSWLYKITQMPLLKELFRLLRTENEIQILLTALLDLICLLPAIPSYI
TPFIQDLFEIFSHLTAWRHHHLHNLHPVHQIHLQSILLSYFHRLYGMFPC
NFLHFLRSHYANQTAFFKSSIQPMLVTVRLHPLLVSHSREQEKSLSRWKR
MELHDVLTESSRYALIPQEFNNEDVLEEASLLLPEPLSSAVPSHVTPLDE
SWACSISSENTETAIEATPETTPFVTPSKDENIFRFNRPPTNVARTLRLX
LSIIKSPVSLVTSPTLGSNTLISSSPSSGGKTFINNNESTSLISSPVEQV
DETKRRDSLFDKLPGEASSSIALVKLNKINQERKVSPLKLMSTSSSSISL
STGVSFINSLVQRPEPDVSHISNFASENPQNALPDSDKVVDIVDEETTKV
VGTEEPAMNYLSAHPDYWRNGVDKHNPIEEIDSAFDTSLFQSSSCIQSSN
ENLFDFAKKVHGRMRYISFCDEKVGILSIGNCTNDLGESLNERRRKRYHS
CPDPSKLTQMNMKVSSNNHRKIKTAYNQIHRSSSRTSNVDEDITLLREGV
ENSTQTDLDYSAFTYEHLFPCISTIGNCHLERKEVENPYLLLDKYLESAC
DSTQKEHREDVYKSIISSLRSQLLYERHRREILGERNRRLLGKSKSSRIL
KEENTALRDQLQLVKSEIDDLHRQIEEIRREKHLIEEERSFTARNRDHEI
EKRSAEIRSLKISAQKSEEIIDELNHAVVEGRKELDTSRAQFFLMKAECE
VLHQKESARMMTELELVRLRKELVMMGELQSKYKERLDNPANNMESETMN
LFKQAYERDLQTMARALENKTFEVETFKCRITELDSLLSKKNAQILDHKK
LIKRIQDENDEVLRESKSTYESMVQLHLQTESHVLELRDQLAQNTRILGG
TLNNSSSLHSKKAPRPSGGLLDFHATRNVDIEQQPETFSSSD
back to top

mRNA from alignment at LSalAtl2s188:634817..638620-

Legend: polypeptideexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAT00000003443-699290 ID=EMLSAT00000003443-699290|Name=EMLSAT00000003443|organism=Lepeophtheirus salmonis|type=mRNA|length=3804bp|location=Sequence derived from alignment at LSalAtl2s188:634817..638620- (Lepeophtheirus salmonis)
ATGGAAGTGGATGAGATTTTCAGTCACTTGGAATCCGATCATTGCGAGGT TGTGCAGGAGGTTCGTCAAGTGATCTATGATCAATTTGCAGAAGTGAAGG AGCCCTGGCTCATCAACGGCCTCTATGATTATTGTTGTTCCATTGCTGGA AGGGTATGTTCCAGACATCCCTGTCTGGAGCTGATCCTGGGTGTTCGAGA GCCTCACGATAAATTCCTCTCAGATCGACTCACTGAGAGTCTCATTCGAG GCTCATCTGAGCAAAAAGTAGAAGCTCTTCTGATCCTGGGGCATCTCATT CGAAAGAGTCCCTCGTGGCTCTACAAGATCACACAAATGCCTCTTCTGAA AGAACTTTTTCGTCTCCTCCGAACAGAGAATGAGATTCAAATCCTTTTGA CTGCTCTTTTAGATCTCATTTGTCTCCTCCCGGCGATCCCATCCTATATC ACTCCCTTCATTCAAGATCTATTTGAAATATTCAGTCATTTAACTGCATG GCGCCACCATCACCTTCACAATCTACATCCAGTTCATCAAATCCATCTCC AATCAATTCTTCTCTCCTATTTCCACCGACTCTATGGCATGTTCCCATGT AATTTTCTACATTTTCTAAGATCCCACTATGCCAATCAAACTGCCTTCTT CAAATCTTCCATTCAACCCATGCTTGTGACCGTGCGTCTACATCCACTTC TTGTCTCTCATTCACGAGAACAGGAAAAGTCATTGTCCCGATGGAAGCGA ATGGAATTACATGATGTTCTCACAGAGTCATCCCGCTATGCTCTCATACC TCAAGAGTTTAACAATGAAGACGTCCTAGAGGAGGCTTCCCTCCTTCTAC CAGAACCTCTTTCATCTGCTGTACCATCACATGTAACGCCCTTGGATGAA TCATGGGCTTGTAGCATCTCTTCAGAAAATACTGAAACAGCAATTGAGGC CACTCCAGAAACGACTCCATTTGTAACGCCTTCCAAGGTATGTTGACTCT TTCAATTGCATTTTTACTGTACATGCATGTTAGAAAAATCTGCACGGTTC CATACATTTATTTTATGTCTCGGTGAGGGCTCTAATGATAGCTCAATTGT ACATTTGAGTAATTAAGTTAATTTGAGATATCATTTCTTTATTTTTATAC TTTTTCTTTGTTTCACTTCAACCTGGGAACGTTATAAACACATTTTTTCT AGGACGAAAATATATTTCGCTTCAATCGTCCTCCCACAAATGTGGCTAGA ACCTTACGTTTGGRTTTGAGTATTATAAAGTCCCCAGTTTCATTAGTTAC CTCCCCTACCTTAGGATCTAACACTCTTATCTCTTCTTCGCCCTCATCTG GAGGAAAAACATTTATCAATAATAACGAGAGTACTAGTTTGATTTCTTCG CCCGTGGAACAGGTGGATGAAACCAAACGAAGAGACTCACTTTTTGATAA ATTACCAGGAGAGGCCTCTTCATCAATTGCGCTAGTGAAATTGAATAAAA TCAACCAAGAACGTAAAGTTAGTCCGCTGAAGTTAATGTCTACATCTTCT TCCTCTATTTCTTTATCTACTGGAGTGAGCTTCATTAATAGTTTAGTTCA AAGACCAGAGCCTGATGTATCACATATCAGTAATTTTGCATCAGAAAATC CTCAAAATGCATTGCCTGATTCAGACAAAGTGGTGGTAAGTATTCTTTTC TTGTTCTTTTGTCTTCATCGTTTTTTGTGGTTTTTTCAGTTTTATTTTGT ACCATAGATGTGTTGTAGTTGTAGAAATTGTTTGTAAATGTCTTGAAGAC TTAGTTACACTATATCTCTTATACCATTATCATGTGTTACAGGTTTTATA ATATCGGTAAAAAACTCATCCTTTCATTCATTTCATTAGGATATCGTTGA TGAGGAGACAACCAAAGTTGTTGGGACGGAGGAGCCAGCCATGAACTATT TATCAGCCCATCCAGATTATTGGAGGGTGAGGAACAATTTATTTTGTCCT AATACGTTTCAATGTTCTCTATATATCTTTCATTTTCCTTTTTCATAGAA TGGAGTTGACAAACATAATCCAATCGAAGAAATCGACAGTGCATTTGATA CATCCCTTTTTCAGTCTAGTTCATGCATTCAATCTTCAAACGAAAACTTG TTTGATTTTGCTAAGAAAGTGCATGGTAGAATGCGCTACATTTCATTTTG CGACGAAAAAGTTGGTATACTTAGTATAGGAAACTGCACAAATGATCTTG GAGAATCACTGAATGAAAGGAGAAGGAAAAGATATCACTCTTGTCCAGAT CCCTCTAAGTTAACTCAGATGAATATGAAGGTTTCATCAAATAATCATAG GAAAATCAAAACAGCATATAATCAAATTCATAGATCCTCTTCAAGGACCA GCAATGTAGATGAGGACATTACTCTATTACGTGAGGGAGTTGAAAATTCG ACTCAAACAGACCTAGATTACAGTGCTTTCACATATGAGCATCTCTTCCC ATGTATAAGTACGATTGGGAATTGTCATTTAGAGAGAAAGGAAGTTGAGA ATCCATATCTTCTTCTCGACAAGTATTTAGAATCTGCCTGTGACTCAACT CAAAAAGAGCATAGAGAAGATGTGTATAAAAGTATAATTTCATCTCTTCG GAGTCAACTTTTATACGAAAGACATCGTCGAGAGATTCTAGGAGAAAGAA ATAGACGTCTTTTAGGTAAATCTAAGTCTTCTAGAATCCTCAAAGAAGAA AATACTGCTCTGGTAATATTCGGGAATGTTAAATAAATGTTGAATTTATC ATTATAACTTATCTTCTTTTTTTTTTTACAGAGAGATCAACTCCAGCTTG TCAAATCAGAAATTGATGATTTACACCGTCAAATTGAGGAAATAAGAAGG GAAAAACATCTGATAGAGGAAGAAAGGTCATTTACTGCAAGAAATAGAGA TCATGAAATCGAAAAAAGGTCTGCTGAGATTAGATCTTTAAAAATCAGTG CACAAAAATCTGAAGAAATAATTGATGAGCTCAACCATGCTGTAGTAGAA GGAAGGAAGGAGTTGGATACCTCCAGGGCTCAATTTTTCCTAATGAAAGC TGAAGTAATTGATTATCTTTTCTTACATCAAAATGTATTCATTTGTTAAT TTCTAGTGCGAGGTTTTACATCAAAAAGAAAGCGCAAGAATGATGACGGA ATTGGAATTGGTTCGACTGAGAAAGGAACTTGTCATGATGGGTGAGCTTC AGTCAAAATATAAGGAGCGATTGGATAATCCTGCTAACAACATGGAATCT GAGACCATGAATCTCTTTAAGCAGGCTTATGAAAGGGATCTACAGAGTAA TTTGGAAAATGAATGACTTAGTTTTAATTATTCACATGATCCCGTTTTAA TAATTTTTTTAGCTATGGCCAGAGCTCTGGAGAACAAAACATTTGAAGTA GAGACATTCAAGTGTCGTATCACCGAGTTGGACTCCTTGCTCTCAAAGAA GAATGCTCAGATCCTTGACCACAAGAAACTGATAAAGCGGATTCAGGATG AAAACGATGAGGTTCTACGAGAGTCCAAATCTACATATGAATCTATGGTG CAATTACATCTCCAAACGGAGAGTCATGTGTTAGAACTAAGGGACCAATT GGCACAAAACACTCGTATCCTCGGTGGAACCCTAAATAATTCTTCCTCCT TGCATTCCAAAAAAGCTCCTAGGCCTTCAGGTGGACTTCTTGATTTTCAT GCTACGAGAAATGTTGATATTGAGCAGCAACCAGAAACGTTCAGTTCTTC TGAT
back to top
Add to Basket