EMLSAT00000007480, EMLSAT00000007480-703327 (mRNA) Lepeophtheirus salmonis

Overview
NameEMLSAT00000007480
Unique NameEMLSAT00000007480-703327
TypemRNA
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
NAE F172 LsFLVCR unknown
  1. Nauplius I
  2. Copepodid
no phenotype
no visible phenotype
12.06.2014 (All day)
20.06.2014 (All day)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s42supercontigLSalAtl2s42:493101..528434 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Properties
Property NameValue
Logic nameensemblgenomes
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this mRNA
DatabaseAccession
Ensembl Metazoa (transcript)EMLSAT00000007480 (primary cross-reference)
Relationships

The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EMLSAE00000032845EMLSAE00000032845-741773Lepeophtheirus salmonisexon
EMLSAE00000032846EMLSAE00000032846-741774Lepeophtheirus salmonisexon
EMLSAE00000032847EMLSAE00000032847-741775Lepeophtheirus salmonisexon
EMLSAE00000032848EMLSAE00000032848-741776Lepeophtheirus salmonisexon
EMLSAE00000032849EMLSAE00000032849-741777Lepeophtheirus salmonisexon
EMLSAE00000032850EMLSAE00000032850-741778Lepeophtheirus salmonisexon
EMLSAE00000032851EMLSAE00000032851-741779Lepeophtheirus salmonisexon
EMLSAE00000032852EMLSAE00000032852-741780Lepeophtheirus salmonisexon
EMLSAE00000032853EMLSAE00000032853-741781Lepeophtheirus salmonisexon


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
polypeptide-auto778305auto778305Lepeophtheirus salmonispolypeptide
EMLSAP00000007480EMLSAP00000007480Lepeophtheirus salmonispolypeptide


Sequences
The following sequences are available for this feature:

protein sequence of EMLSAP00000007480

>EMLSAP00000007480 ID=EMLSAP00000007480|Name=EMLSAP00000007480|organism=Lepeophtheirus salmonis|type=polypeptide|length=452bp
MEEEDGQQKSLPIEEFKVYKKRWIILALFVLYSASNAFQWTQLVIITSIL
EKHYNVGTLAISWTSIIFMATYIPLIFPASWILQKKGLRKSILLGSLGTC
LGSWIKVLATHPSSFNLLFSGQTIVAISQIFILGIPAXLAATWFPADQVS
SACAIGVFGNQLGVALGFVLPASFIRSSVGSNFVTTQNDLFAMFMAVAII
TTVLLIIIIFAFXDKPLNPPSPAQKAAVETLAEEDYLSSIKRLITNKNYI
LLLITYGLNVGVFYAVSTILNSVVVLYYKDAEVDAGRIGLVIVLCGMVGS
MVCGIILDKTHAYKATTFAVYILTAMGMTIFTFTVNLGHIEIVYFTAGVL
GFFMTGYLPIGFEFAAEITYPESEGTSSGLLNASAQIFGIICTLIAERLL
EFTHKAFIPNGVLIIVLILGCILTGIIKPDYRRQKAAKNQVSNSFTNETI
AP
back to top

mRNA from alignment at LSalAtl2s42:493101..528434+

Legend: exonpolypeptide
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAT00000007480-703327 ID=EMLSAT00000007480-703327|Name=EMLSAT00000007480|organism=Lepeophtheirus salmonis|type=mRNA|length=35334bp|location=Sequence derived from alignment at LSalAtl2s42:493101..528434+ (Lepeophtheirus salmonis)
TATGTAATCATTGTATAGATTGGATAAAGTGTAATGCAGAAATTATAGCC CGGATATTGGAGTAAATGAAAAAGGGAATCAAATCCTAGGCTCGTTCTAA ACTCTTTTCAACACAATCCATACTACAATGTATATACTCCAATTTATTTC ATCCTTGTCCGCGAAATACATTACATATACAGACATACTTAAATATATCA AAATCAAACTAAAAAGAAGAAGGGAGAGTGAACAGAAAAAAAATATCCAA GAATAACTATTGTCATTGTTTGTAGTGTCAAATAAGTTTCAATAGGTCAA TAGATAGATATAAAATATTCATAACTCCTGTTATATTATTTGAATGTCCT ACTTCATCACCTAACTACAAAAACCAATTTTTTCCATCGCTGAAGAGACG AACACAACCTCACGAAGAAAAAAAAACATTCTGCAAAGGTAAATAACTTT CTTAGAAATATACATATTATGTAGATAAGGCGTTATCACTATCTTTTTTC CGTCTTTTTTTTCGACTTTGATCTTTAAAGAATTATTTATTACATGTTTA ATTAGTGTTCTACTCATTTTCTTCTCCTCTCATCCCTTTCAAAAAATAGG ACAATAATGATTTAAGATGAAAAGTAAAGGATATATTATTACATATTATG TATTATGATATAACTTCTATAATTATTCAACATATTTATTTGCAGAGAAA TGATATAATAAGTTCCTTATTAGGTTGGGGAAAAAGTTATTTCCTATTTT TTTGGCTTTATTTCAATACTTATATAAGAAGTCTTACAATCATCCGGTTA AAGCTAAATATGCTCCGTTCTTATTGATAACTTGTTACAAACGAGAATCA AACTTCATAATGCCCTTTTCGTAGTCTGTATGCACACAAAACTTGAGCAA TAAATTTCCACAAGCCTCCATTGAGGGCAAATTTGTACACCCAAGTGCAT TGGCTATAGACAGGAACAGGTGGTAGGGACTTTGTTCCAGGTCCAGACTA TATATGCATAAGAACTTCCCATTCGAGCTCCCAGAGCTTCTCGGTTGTCA TCAAAGATGTGTGCGGCCTAGAGTTGCCTTGATGAAACACGATTCTTCTT CTATTCGGGTTTATTTTTGTAGCCAGCCTTCTGCAAGTGGTTCAAAACGG GTTTATGATCAAATTTCAGCTACTATTCGATGCTACGATTGCTAATGTGT CGCACTATCTCGATATTTTTCATGATTTTATCGACTTTTTCGACGATATG CCTCCCAGTGCATCATTCACTACACAAAAACAAAATCTGTCGAACCACAG TTGTACAGTATGAACCGAAAGAGTATCGGCCCCATATACATTTCAAATTT TAATTGTCTCTTTCAACATGTATTAATGTAAAATATGGCAATTTTTTTTC TTTGAGACCTTCATACCCGACGCACAATAATTCACGCCTGAACTGGACCA GTGTAATATTTTACAAAAAGCATATGTATTATAAATCCATACCTCTGGAA CATTATATATCGTAAATTAAGATGTGACCAAAAATTAACAAGATATACTT AGTAAAAAAAAGGATGGGAAATACGAAATTACTTTTTCCCCAAACTATTA TTTGATTATAAATCTGTCACTTTATTTTTTGTTTGAAAAAATGTATGTTG CTGTTTTGTTGCTTTATAACTCTCTGTACGTCTAAGATGTGTGTCAATTT GTTTCTGTATACTTAAATTTATATATATGTATATAAGTCAATCCTCCTTG TTTTATTTTAATCATCACAAATAAAATCAGTATTATTAAATACATACTCT ATAATATATTTGTGCAATATAACTCTTTGATCTAATAAAATCAAAGTACT TGAGGAGACTTATACACGATTTATCTTCTTTTGTTTTTACTCCATAGATA AGAGATCAACATTATTTATTCAATGATAAATGTATTAATGTTATTTTTAT TGACATATATATGTACTAAAGTTTCTCAATTTCCCGGGACATTGTCGTGA AGTGGGATTCCGTGAGGAAATAATAAATACTGCAAAGTATAAGTATTGCT TTTTTTATTTTTTAAAGAAAAAATCATTTATAAGCTAGTCCTACTAATGA ATTCTCATTTTCTTAATTGTATCATTATCACTAATTTTGCCTATGTTGGT TTTCTAAAGCATGTGATTCCCGTTTTGGAATTCCAAAACCCTGAATCCAA CCCACATGCCAAACTAACTTAGAACGTAAGTTATGGTGTAGCTGCGAGTG TTACAAATGTGAAATACACAGCCCAGGTCTAAAATCCACCTTGTGGTTTA CTAGAATCCAAGCAATTCAAAGCACAAATCGTACAAACTTTAACCCAAGT GATAATTATTATTAACTCCGCCAACAAAGTGGAAGGGAAGTTATATATTT ACCTCTGTTTGCATGTTTATTGGTCACCAGGATTTTGACTAGAGTTACAG ATTGATTTTGATCAAACTTGCTAAAAAGAGTATATACAGACTCAGTAAAC GGCCATTAAATTTTGAGAGACAAGGTCAAATGTCAAGTTAAAACACAGCG TACAAAATGCATAATCGACCATAACTTTTGTACACATTGAGATATACATA ACTCAATTTAACTTTAGTCTTATTATAGTATTATATGTGTATTTAACATT TAGTTTCATTAATTATATATTTAACTCGTTACGTGCGAGGATCACTAGGT ACGTATCTTTAACGTGAGTTTAAAATGTCAATAGTCGTAAATATAGAAAT TATTGCCGTATTCATGGAATTTCGAAATATACTGATTGTTTTCATTCAGA TGTTAATCAATATGTTTCAAAAAATAAAGGTGATAAAATTTAAAAAAATA CGTTTGTACAATGTTTTTGAAGTTACTGAAATTTTTGAAATAACCCACCA GTGGGCCACTTGCACTGTATGTATCGGTCGGTCACTTTGGACACAACGTA TTAAATGAAGCTAATATTATTCAATAACAAAATACAGGATTTCTAGGGTG TAGAAAATATTTCCCAGAAAATTTTATTTAAATTAAAATTTCTTGACATC CCGGGAAAACAGTATATCTGGAGAGAAACTTCTATATAATAAATATTATA TAGACGTACACTAAGAGAAACAGAGAGATTTAAATTGAAATTTGATATAA AAAGCCATATTCTTAAGTTTATTATATTTCAATTGTGTACATATGTATAT TGTATAATACACATGTTTGTATATGTATATATTTGTTCATATTCCCGTCT TGGATTTATTTATTTTTCTGATTGCATTATTACATTTTTGTTACGTACAG TCAAAAAAACAATATCGATTAATATATCTCAAATCTTTTTGTCTTTTTTT GATATGATCCCAGTCATTTGAAAATAATTTAATAAAGGGAGACAGACACC TTCAAAAATTATATATATTTTGAGAGTAATTTGAAAAAATATTTACACAC TTTGAACATATATTCATCATCTTAAATAGTCTTAAAATAAAATGTACTCA ATAGCTCTTCATTGTTCAATTATGATATATTGAAGATATAGAACTTGACC GTTACGTTCATAGATTAGAAGATCAAGTTGACCAATTTTTAAGCAGTTTT ATATTTATTGTTAGATAATAGACGTACTCGATTATTCCCAATATTGTATT TTCCTAAAATAACGAAAACAAAACTGATAATATATTTTCCCTGTAAAAAA TGACATTAACCCTTTGTTAGTAAACTCGGATTTTCTGTACACCGCCTTCT ATAAAAGTGTTTTGAACTACATTTATCTATAAATATGTAGATATGCATCT AAAATGTCCAATAATAGTAAGTTCAACTTTATTCTTGTTGCAATAATGTC ATTTTAAGGAATTATTCAAATATTTTACAATCGATAATTAAGATTTGATG AATTCAATTAATTTGTTCCCTTTTAGATACTTATTTTATCTTTTTTTGAT GTGAGGAGTGTGCGTAATGTATGATGTTATTCTGTTTATTGCATTCAAGT AGTATCTACTTATTTCATAAGAATATGAATCAAAACATATTAATTAAAAA TGATAGTGTATTTTCCCTCAAAGTCTGGTGCTCATATATATTAAGCATTT TAATTCACATTTACAAAATGAGTGAAATAGCTTAGAAAATATTATAATTT CGATAATTTGTATTTACCATGTAATAATATTATTTTATTTTTTCACTAAC TACGCCACAGAAGGTGTTCACTCACATAGGGTTAAATGATTTTAATAGGT CATAAGCTTTCTTAACTTACAGCGATTCTTGTTTATTTAGTTTTTTCATC TTCAATTATTTTACTATTGAAAACCCAAGCGGGTCCAGTTCGGCCATTTC TGAAAGATCTTTTACTTTTAAGTAATATTTTTTACCAGCACAGTCAATTA AGGTAGTCCATTTAAAGTATATGACATCAGTTTTAACTATCAATTTTAAC TATTTTGTCAAACAATAAAAAATACTTGGAGTATCTATAAATTAAAACTG AATTCACCATTAAAAAATTATCAGATAAAGTATGGTACGATGTAATCCCT CAGAATATTAACATATGATTTGCATTGCTACTTAGATAACGAAAATTATA CGTACTATTACAAAAAAGNACCATACTTTCACATTTCTTGATTATTTTTA CTCAGATATTAAAGGTTAATTTCAATAAAAAAAACTTTGACCGATTAATC GGTCATCGGTTTTTGACCCCTAAATAATCGGTATCATTCCCCCTAAAAMA TTAATAGGGTTTGAGTCGTCATTAAGACTACAAAACTAAAGATCTGAATT TGACATTATGCATACGCATTTTAAAACGCACACAAATCATCTTTTTTATG TTCAAACTTTAGAAATATGGTTTTTTATCAGTCCAAGAATATAATAAAAT TACCAACAACACCAAAACCCTTTAACTTAATAAATTTGGAAATTTAAATA GAATATGATGATCATCCACTTGAATCATATTTTCTTTTAAATCTCATTTA TGTATATATATAAACTTTGTGTACTCCACATACTTAAGTGCATACATTTT TTTTTAAGTTACTATGAAATTTTTTTTGTCTTACGTACGTGATAGCAATT TGGTGATGAGGATTAGTTAGAATATTTAAAGTCTATATTTAGAAGCATGC TAAATTATATTTTTCCCTTACAAATGATCAAAACAGTACCTAAAACGATT AAACCTTTTGTCAAATCATAGAACTGAAGAATTATTTCTAAGAAATATTT ATTATTAACGTTTAACAAATAGATTCTAATCATTTGAGATAAAGTAAAAC AAAGGTCATCCATTTATCAAGACCACACACAAATTACATACCCACTAATT AGGAAGTGATATTATATTGACATTGTATAATGTATCTACTTAAAAGCAAA GTAGATGTGTTTTTCTGTTGTTTTCTTGATCCAAAAAAGAGCTTTTTAGA TACTGTAAGTTCTACATTGTATTGATTTTTTGTTTTGTTTCAATTTATAA CAGTTTATATTATAATTATAAAAAATATACTGCTCGCGTAATAAAATATA TGAAAAAGTACCGAGTTATTAAGGAGATTTATATATATATATACAGTTTC AGTAAAAGGAATGTTATTCCTATAATGCTACCATAGAAAGAAAATTAGCG TTAAAGAAATAAACGAAGATAATTTATCATAAAAAAAATAATAATAATAA TTTTCTTGAAAGAAACTGCTTTGTAAATATATTCCTATACAAAAAAAGAA AGAGTGGTTCTATCATTCATCTTACAGATTATTATATGTATACATTTTTT TTTTTTTAGTWTTTGTGTATCCTGATTGAAAGTGATTTCTTTTATAAACT CCCTCCCTCGTACATATAAATTTAATTAATGTATTTTAAAAATTGACAAC ATCAATTCAATACAAAAATTATACATAAATAAATTCCACTTTTGTGGAGG TTTTAAAATCAGAAAAGTATATATATATTGAAAGACTGTACCTGAACAAT TTTTTGGAGGATTCCCTTCTTGTTTATATGTTAATTTGTGTTATCATTAT GAGGAAATAGGCTAATCCAGATTATTTTGAGATTGCTTAAAAATAGAAAC CAAAATCAGCATGGTAACCCTGACAATTTGAAAAATGTTTTAGAGGAGAG CAGCTTAGTTATATGACTTTTTATTATAYCAGCCATAAGCAGTTGTGTGC AATAAAGAAAGACATAGGCAAGAATTACTTTGATATCAATCCTCAATTCT ACTCTGAGTCTGACAACATCTTACTCCACAAAAAATCCTTAAAGTTATTT TCCATTTTTAAATGGATACACAAATGTTCAATCAGGTTTTGAATGTAATT GAATGTAGTAGAGAAAGGAAGTTCACTCCTCAGGAGCTAAATAATAATGA CAACAGCTTAGGAAAATAAAATTCACTTTTCAGTTTTCCAACGGGTGAGC TAAAAATACACCGGATTTGTATCAATCATTATGACCTATCATGAAGAAAA CTCGAAATATGATGTTGAATACTTTTTCAATAAGTGCACACCTACATAGA TACAGCTTAGCCCAAAACTATTAAAAGCTTCACAAAATTCCAACAAAAAA ATTGTGTTGATCTCAGCATTGATCTCATACCATGTCGAAGATGATTCTGG ACATGGGCTGTTCTTTTGGATTTGGTGATGATGTACTGGACAGAGGAGGA TTTTGGGATGGAAAACTTGGTAGAAATGTCTTTGTAGCTATCACCTTGAT TATGGCAATTGACTACATGCTGGCGGRTGTCCTTACTGTAATCCTTGGTC TTGGTAATGTTGATTTTTTTAATAAGAAATTGGCTCATCACACTTTTTTT ATACCTTAGAAGATTGTTCAAAGAAATTCTTGATCTCTCGAGTACTTTAT TGAAGTCCCTTAATCTTTCCAGACTTCACCATGATAAAAAATACGTGTTT GTTATTTTGCCTTTTTTTGAGGTGTATGAATACTTTTGAGACAAGTAAAA ATTGTTTTCGAAGCATAAAAAATATTTATATAATAAGTTGATATTTTTAA ACAAACAATAGAAATTATTATCAAAAACATTTTTAAAAAGAATATTATCA GAAATAATGATTGTCAAAATTTCCGATATAGATATAGCAAATATTGAAAG GGTACGAATAATTTTTGGCTCAACTTTATGTACTCTGAGACTAAAAACTC AATTTATTCCAACTTCTAAAGTTGTTCATTATATTACATATTTATCTTAA CTCAGTCAATGCCATAAATAATTTAATGCATTAAATATTAACATAACTTA ATCAAAAAATAATCATTTTAATATTGAAATAATTTATTTGTTTGAAAATG AAATTTTATATTGACCTTAATCTTATAACCTCAAAATATTTTTGTTCTAA TTATACATAAGTATGAATGTAATTCATTCCATGAAAAAGTTGATCATACA TAAATCATACAGTATCAATCAGTATGAATAAAAAGCATTATAATGTTGCA TCTACACTATTCAGATTACACCTTCCAAATGTAATCTGATTGTGATATCT AACTGTTGTAGATGAGCTATTACTTATATTGAATATGCTTTCTATTAAAC ATTAACTAACCTATTCTTTGATTATATAACTTGTACTATGAAATGTTTCA AAATGTGATGGAATTATTATTTGTATATCTATCTCACCCTAAAAATTGAC TCTATGTTACTTTTTCAGTCATTTGTATCATTCTTTCCTGTCTGTGTATT GTCTCCACAAAAAAAAAATTGAGGAAAAGACCAAAATTATTTGTTATATA ACAACTGTTATTCAATCTCTTAAAGCAGAAAATGACTCACCAAATGAATA TAGATACCTGAGTAATAGTGTTGAGACAAGGACCGAGACCAAATTTCGGT CTAAACAAAAATTTTCTTTCTAAATACATAAAAAACTTTTATTTTTCAAC AAAAAAAGGTGTTTTTTTCTTCAAATTTATTTTCTAAAAAAAATAACGTG GGACCAGATCAAGACTGAATTTTACTACAAGACCGGTTTATATTTCATAA TTAAAAATAAGCACTAACAGAGTACCAGAGTTGCCACATGGCCATTCCAT CTCAAATCAGCCAATTTCTTTCAAATTTACAGATAGGTGTTTAAATTTAT TCATCTTTAGATATGTTTGACCTCTTATTGTAATAACTCCTATGGCAAAA TTGGAAATAGTTAACATCAGGTGTTCCCCAGTTATTGATATTTTTGTTAA ATCCCATTTTCCAAATATAGACTGGTTCATATAAGAATCGGAAAATTAAT TTAGGCAATATTTGGAGAAGTACTCATAGAAAATAAAATTGCCAAGTATG ATCATTTTTTGATGTAGAATTTAAAATTAAAAAAAAACACCGATAAATAA AGACATTACCTATAAAAATTACTATTTCTGTTTCCGTGACCGCACCCTCC TCTGCGGTCCATATCTCAAAGTAAGATCAGGGTGAAATCTAATTAAAAAA ATTCTTTTCTGAGACAAAATCAAGTAATTTCTGCAAGATTTTGAAGAAAA ACTTTCTGTTTGAAATAAATATTTAAGTTGCAACATTTGATAAAATTCGT TTGTCATTACACTAAAGTCACAGACATCAAAACTTTGAACAAAAAAAAAT ACATCCAATGAATGGCCAATGGAATTTTTTTGATGGACCTTTAGGGTATA AGGACTATACTTTTATGTTCATGTCTGAGTTGTTTTCCTCTAAAATAAAG CAGAGTCGCCTGCMCCTGTCGTACATAACTGCATCATAGGAGCCGACAGT CGACTACGTCCAAGCAGAATGTAACTTTAAAATCGTGAATACAAGCAAAC TCTTCATCATCACTACACCGTTTTGCACCAATTTGGTCAACCCATATTGG AATTAATTGGTGGTAAGATTTAATTCCAGGAACAGCATAATCAATTCCGT CGTAAAGATCTGAATGCAAAGTTCGCCATTCTTCCTCAATCATAGGTACA TACTAAAACACAATACTGGGAATTTTATCTTGACAAAATTCAAACATTTC TTCTGCAGATTGAATTTGGTTGATGTCGGGCCTGATTAAACTTTCTGCAG CGTTAGACAGTACCGCCCAACACATTGCATGGGATTCTCCATAAGAAGTA GAAAAGAAATTCTACTAAGCTTTGATGCTAAACTCACTTTTAAATTAGCA AAGGATGTAAAGCATCTTGCTATTTTGCATAACCATCAGTAAGCAAATAC AAATAACTGCTAACCAGGTAATCTTACTTTCAAATATTTCAAAATGACAT CGATGACTTTATAAACAAAGAGTACATCGTGAGTGTTGTCATTAGAAATA ATCTTTTAGGAAACATGATTAATAACATTGTCTGACATAAAGTAAAGGAC AACTGAATGGCAATAACACATAGAATTTTTCTTATGAAACCTCTGAACTT CATTTAGCACAAAAAAAAAATAGTTTTGTGTAAAATTAGCAAGAAAGATG ACATTTGAATCATCGAGATCACTTTTCAGATGGTTCAGGTAGCTAGACTG TATTTTGAAAGTAGGCATGAGGCCTGAATTGCTGCTATGATTCAATAAGC TTCTTGATGAAGCAAGGTAAATTTGAAACCATTTTGAAGAGCCTAGATCT ATCAGTGTTGGTCAATTGAGTAAAAACGACTCTTTGATCTTCACTATAAT CGCCAAAGAATGTTACAAAAAATCAGTTAACACCTATGAGTCTGGACAGC TTTCACATTTACCTGCTATCCATGTAACTCATTCAAACGCCATTCATTTA CTAATCTTGATTTATAGTGATTCACTTTACCAGTAGTTTATTCATACATA TTCTTCCCTCAATAGATTATTTTACTCCGAAACTTTTTTGAAATTAAACT GCCTAGACTAAAAAGCCGCACCCAGGAGAACTCGATGGGGTTAGAGCATT ATACTTCAAGAAAAATTTTAATTTTGGAATTTTAATTAAACGGGAGATAC TACTTACTTTCTAAGGAAAATGACAAAAATAGTAAGGAACTTGAATCTGA ATACTGCTTTGTAAATAGTAGCGTGTTATTATTCGCTACTATAAAAAAGT AATTGTTTAGAGTAACGCGTTACTAAGTAATGTGTTAGTGGCATCACTTC AGCGTACTATGCACCTACTGCTTAATTAAAATCCTTGAAGTTAACACCTT TATTTTTTTTCAATGTTTGCAAATTGTAAACTCAATACTTTTTTTCTTAA AAAACCCTTATTGTTTAATATAAGTTTATTGAAATGTCTACTTATAAATA GATATGATAAATTTCCAAGTATTACTTTTTTTCAAAGCAAAATAAGTACC TATATAATGATAATATTAAAACAACTTGAGTCGGAACTTAATTTTGAACT TTTTTCAATAACTTTTTGTTTTCAGTTTCTTTCTTTTTTTTTTTGCTCTA TTTTTTTAAATCATCAAAGGAATTTTCTCACAAGGTAATTTTTAATAAAA TAAAATAAATTATTTTTTCATTTTTAAGAGGCTATGAACTATTTTTATGT TTTTATTCCATTTCAAAGACATTTAAAAGATGTATGTGTCAAAAAACTAA AAAAAAAAAATAATAATAATATTATAACATGTCAATATTGACAAACTCCT TTGAACTTTATGATTTCTTCATTTTAATTTCTTGCTATATATAATGAAGA AAATTTATTAGTTTACTAAGAATTATTCATTGTTGTATTGCTTATTCAAA AAGTAAATCTACCTTAAACAGTTTACAAAAAAATGGTTTAGATGAACCTT CTAAAGAAATGAAAAACTCCAATGTATTTAAATTTTTAACAAGTTTCTAA AGTTTTAAATTTTAAAATAAGTTGAATAACAATTCAGTTTTTGGGGTTAC TTCTTCTTGTATTACTTATGTCACTATTGTCATTTCATCATAACAATAAA TAAAAGTTTAAACATCTTGAAAGCTTATTCTCTAACTTTAAAAAAATAAG TTATTTTGGTTACTGTGTTTGAACCCACTGAATATATCGTTACAATTTCA TTTATGTCGGAGAAAAAGTAATTTTGTCCTTTTTTTAAACTAAGATATAT CTTTTTTTTATTATTGGTCACATCAGATGATACGATAGAGCGTTTTAAAG GTGTGGGCGTATAGTGCAAACGCTTTTTGACAGTATTGAGCTTGGTCAGT TCAGTCGTGAATTATCATGCGTATAGTTTGGAGGTATCAAAGGAAAAAAA TTCGCCATNACTTTACATTTATACTTCCCGTTGAAAGCCACCAAGAAAAT TTACAATGTATATGGGGCTGATACTCTTTCGTTTTGAGTTACACAACTGT GGTTCAGCAATTTTTTTCCTTGCTCAATTCTACCCTCTACTGTGAACAAC TCGACTGTTTGAAGCTGGCCACAGAACAGAATCGGTGCATTGGTGAATAG GAGACAACAAGATATAATCAAGGCTGAGTCAGGTCGCACACATCTTTGAT GACGTACCAGAAGCTCCAGAAGCTTGGATGGGAATTTCTTATGCATGCAC CCTACAGTCTAGACCTGGTACCGAGTGACTACCACCTGTTCCGGTCTATA TCCAAAGCGCTTGGGGTTACAATTTGGCCTCAATTGAGGCTTGTGAAAAT TGGTTGTCCAAGTTTTTTGCCAATAGGGACAAGGCTTCTACGATAAGAAT ATTATGAAGTTGCATTCTCATTGACAACAAGTTATCGATCAGAACGGGCA TATTTGGCTTAAATCGGATGATTGTAACACTTCCTATACAGCATTGAAAT AAATTGAGAAATACGAAATTAGTTTTACTCCTACCTTAAATAAACCTTAA GTAAATATTCATATTTGTTTTGAGCACAAAGTTACAAAAACTATAAATAT AACTTTCTAAGATTAAGCACATTCAATAATCCAAGATTGAAATATTTACA TAGTGTTTTTGTCACGTTAAAAAAGAAAATCTTCGACTTTTTTTTTTTCA AAGCAAATATACATGTTTTTCAATAAAATTGCAAAGATCTGTTCGTTGGA TCAATACAAAATACTCAAATCAAATATATCCGTTTTTGGAAAAAGTTGGG GTATCATTAGGGTTTTAAATCCAAAGTTAGTATGTTTTGTTGACATACTT AAGATTTTTTATATTATTTTGTAAAGCAGTTATCATTATTCTTTCATTCT TGAGGAGGTAACATCTAAGAATAAACTGTATCCACGAGTGTGCGCTCATG AAATTTTTTGAAGATTTGCTGGGGAGTTTTAGGTGTAAGTTTTTTGTTGG ACTCAGAGAATAATTGAGGATTGAAACGGAGTAATTCCTGACTTTGTCCT TGCTTGATATGGAATGTGACTTGTGTGTATTTCTCGCATCTCAGAGATAC CTTAATGACACGTTATGACAACAAAACTGATCTCCTCTCAAATATTCTTA TAAGCATCAGGATTATGATGCTTATTTTTCGTGGTTTTTTTAACCTCAGC TCCACTCTTTCTGATAAAATATCATTTTTGTTATACAGCTAAATAATATT TTGAGGGTTAAATGATTTTTGGAAAAGTATAATTTTATTGTCACATTAAA AAAAATTCAAGCTGTTATAATTATTTTTTGATTCTTGAGGTGACAGCATC TATGTTTTGAGCAATTAGGTATGCTCATGAAAATCGGAGAATAACAACGA GGCTTTCTTCGTGAGTTATCCTCTATATTATAAAATTGTCTGCTCATCGT GTGCCAACAGATTTAAAATATTGTTTTTTTGTTTTTGTTTTTTTCAATTG TCAAAACATAATGTTTAAAATGACTTATCTGGTTTTAAGCAACAAGGAAT CAAACTGAGTTTAATTTCATTCATAATTTATGTTATTAGATAACTTTCAA AAAGGATTTTAAGTTATACGTTTAATTTATGATCAAAGCTAAGATTCAAG ATGATATTTAGATATTAATTACTATAAACATTATATCAAAATGATCAAAA ATATAATTTTATGTCAAAGGTCACAATGAAACTATAATAATAACGGCCAA TTAATTATTAGATGTATTAATTATATATTACGAGTATGTGTATGTATAAT AACAAAAGTTGAAAACATACAAACAGTACTTATTCATTTATCAACAAAAT TAATTATCATTATATGGGAGTTGTGTTTTTAAATAAGTGATTTATTAATC AAATAATCATTGTTTGCAATTAAATTTGTGCTATAAGAAATGAAACGATA ACTGATTTGGATTTTGTGTGCCAGGATAAATGGATATAGCTGAAAATATT TTGTTGATCATTACACCAGTGAATGTGTATACCAAAATATAGAAAAGTTA GTAAAAATTAAATATTGAGACTGTAGACAGTAACATTATTGGCCTATTCT TCATTTATACCCCAGTAATGAAATAAAATTGGCCTTTGAAAATACTCTTC TAACATTTTTACAAATAAATAATTTCATTTTGAAACACTCAATGTTCAAA AATGTCTTGAAGACAAATGTTCTTGCACTAAACTTTTTATTTTTCTTCTT TGATCTTTTGTTTTATCCAATAAAATTATTTAAGAGCATGGAAGTTTTTG AAATTGTCTAAAACATTATTTTCATATTTCATAATGAGTTAAGCTATTTT ATTGATAGATACACATTAATTGTGAAAATTAGATTTCATAAAGAAATGCA ACTGACAAGCATTTATAAAACAACTTAACATTATAATTAATTTATTGTAT TATTAATATACATATCTTAAATAAAATGAATAAAATAGTCTATTTACACC ATTAAGTAGGCTTGATATCATATAAATTAAATATCAAACGTTTATGTATA CCACTATGATAAAATAAAGACCGTTATTTTCTAGTTATGAACTCAATTCT CATTGGATTTTCAAGTTTATTTTTTACTATGTTGGTACACATGTCCACAG CATGTCCTAGTATCTTGACTAAAGATTGAACCCACAATTAACTACAAATC GCCCTTCACGGTACGTGGTTTGGTACAGTCTAATAGTAAAATGTGTTGTT TTTTTTAATGGAATTAAAGTAGTTTTTAATTTTTTTTTATATTTGATTCT TTAATAATTTCTTTTCCCTCCAAAAATAAATTATTCTTAAAATGCTTAAC TCCTCTAAAAACAAAGGTAGAAATAAAATATACATGAGTTATACATATAA TACTATTACTTATTATTATTTTTTTGGCAAATAGATGGGCTTGTCTACAT TTTCCAGTAATGAACAAACCGATTAGCAGTCACAATATCGCCAGTTGAAG AAATTATTTATTTATTATTTATTAATTTGGAAGGATCGTGAAGGTAACTT GAAAACATTGGGAAAATTAGAATATATCTCTCTACACTACTGGGTTTTTG TCAACTGGGATGTATTTTATTATGATCTCTTTTTGTATAAACAAATACAT CAATTATTTATTTTTTTAAATAAAAGGATTCTTATGGATTAAAATTTTAC CTCATTATCTAAATTTATTCAAAAAATAAAACGAAAAAATAAACTATTTT AATATCAAAATTTTTAATAAGTAATAATATATACGTACCGAACTGAATTG CAGTACAACGCCGTTACCGTACCAGCAATATTAGCAATATCAGCGATTTT TCATTCTTAGTTTGTTTTTGAGAGATAATTAGAGTATACGTCTTTTTGTG TTCCCCGCAATTATCAACTAATGAAAAAAAAATTAAAAGAAAAAATCAAC TTATGAGAAAATTCTTTCAAAACTTCTTAAAGATTTTTTTCTTTTCCTAC AATAGTTTTTTTTAGACAATGCTAAACAACTCATATGATGGATACATAGT ATTCATTATATGATAGCTATTAATTTATGCAACAAAATCTTTTAATATTT TTTTATTCTATTATAAAAAGTATGGTTTTTTGATTGAATTAGCTGATTAA CTATAAGTAGTATAATTATATATATATATATATATTAATACAACAAATGG CTTAGTAGAAAAATTGGTTTTGGTAAGGGATTAATTCTACCTAAACCATT CATGACAATACAAATTAAACTTTAAATCTTTAGTTTACTACCATTTACTA TTTTTTATATTTTTAAAGAGCTAGTCTTTCATATCAATTCATTTTTGTGT TTCTTAAGAATAGGTTACTTGATCTGCCAAATTTTATTCAAATCAGATGA AGAAAAAGAATATAAGTTTTATAAGGAATGACCCATTGGCCCATATATAT ATAAACAAATTATAAATGTTTGAAATTTAATATTTAGTGTATTAATTATG TATTCAAACTTGGTTTTTTTGTAAGAGATGAACAGGGAGCACAGTTTTTT AAGAATTTATGGTTATACATATCCCTATTTATAGTTTGTTTATATAAAAA TAGATTCCCCTGTTGAATAAGAAAAAATATCAGCTCCATAACTCATTAAT AATGTATAAATATATACATTTATTTATAAAAGTTTGAAAATTCAATGACT TATGATGTCACTAATCTACATATTTTAATAGTTTTTCTTTTAGGCATAAC CTTAAAAAAAGATAGGTATTGTTAACAAAAAAAATATGATGATTAAGAAA ACTTTTTTTTATTTTTTAATCGAAAGTTTCTTTTCTATAACCATTGTATA AAAAGTAATTAATTATTCGATGTTCTTGCCAGTCAAATCATCTATGATAT TATCAATAAAAGTAACATTTTATGAAAAATTATAGGTCTTTCATTTCCAA TGCTTTGATATGATATTTTGTATAATTGTTATGTTGATACTTTTTCATAA CGATGTTGTGTAAGGTTTTTTTTCTCAATATATAGAGATCTTCAATAAGT ATTCATACCAATTAATTTCTTGGGAAACCTATAAGCTTAAGGAAAGGAAA ATCTACTTGTCTTTGTAAATGGTATATTCAAAGGAAAGCGATTAGCGTTT CTTATGAATGCCTATAAGATTATATATGTACATACATGATAAACTGTGTT GCCCCAATACATTAWYTATCCATATTAATAAAACAAAGTTTGTCTTTCCA TCTGTATGAATATATGGAAACGAGTTACCGGGTACACTGCATATAGTGTT CCATTATGTATATAATAAATATATTTGTGATATAAGAAATAATAATGTAG TCGTATTGCAGGTGTGTGCTTTTATTACAAGAGAACTTTTTCTGACTGTT TTTGTTATTGATTTCTTATGTATATGATTTATTTTCATATTCTGTATATG ATAAGATTTGAATAAAATAAAAACGATGGTATATTTACATGAATTTTGTT TGGTTTTATTAGTGACTAAAGTACTCATCAGTCATCCCAATATATTAAAT TCTTTTTGTCAAACTCTTATTGTTATTCTTTCATTCTTGAGATATAATAC ACATGATTTATGAATTATTACATAGCTTCGCGTGAGTGTGCTTATGAAAA ATTTGGAGTAAAACTTAGGGGTTCTTAAGGATTTATATTCTATATTATTG AAGAAAAATGTGTATGTAAGCCGATGCCTAATTAATCCAGGCAATGCTGG GTACTACCTCTAGTATAATAATAAAGTTACTTGGAAAATAAATAATTATT TAATAAAAAACATTTATTTTGGAGTAATATTAATAGTATATACATATATG GTTATCCCGTCAAAGTATCCTATATGATGTGTGAAATCAATATTGAATAG GATATTTTATAATAGTTACAGATGTAAATCGTAATCAATCTCGCCATGAA AAAAGAAAGGAAAAATAACATGCTAACGATGACAGTTTGAAGTACTCTTC ATAGGAAGGCATCGTATCTGTCAAGAAATTTTATTAAATTAGCTGCGAGA GCTCTGAAATGAAGGAAATAAACACAAGTCCCACTCCTTATCAAGCAAAA AAATAGGTAGGAATTACACATTTTCTCATCCTCAATTTTTTTTTTTGAGT CCAACATGGACTTACACTAAAAAGTTTAAAGTTTATCTTCAAGTGTGTGT GATCACGAATGACGGAGAGTAAAACTGATAAATTATATTTTCTCTCCTTA AGAATAAAATTACAGATAGGGCATATAACTACGGAAAATCTTTGAAGGCT TAAAACGAAGAAACTAGATGGGGTAGAACCATAATTTTTTTTTTTGAAAG CTACATTTTATTACTTTCAAATAATGCATAATGAAATTTGCCTCTCTTGA TAACCCTGGTCACACGGCGCATGAAACTTTTGAAGACCCGGGTGACATTA TGTGTCTCCAGCTTTACCACTGTTAGTGTAATATACTTCTTCAGGGCCTC TAAATATGAATGATCTCTCCCCCGAAAATAGAAATCTTATCCAGGCTCCA AAAGTGAGAAAATTTTGTGGCCAAGACATCTGCCTTGTGAGCCGGAGTAA TTTTACTCCATTCATTCAGGGAATTTAAATTAAAAATGCAAAACCAGAAC CAGTACAATAGCAAAGCTGGATCCACATAAAATCGCTTAGGCCTGCCAAA TCTTCTGGTGACGTGTGGCTAAGGTAATCAAGAGAAGTGGATCTCATAAA AATAATTGAATGCCATTTAATGTAGCTTTCAAATTATATATAAATTATGT AGATGGTTATATCCAATCTAATTCATTTGTTTTAAGCATTTAGAGATTTA TATATATTACAATGATATCAGCTTAGAACGCACTGTTCAGGTTGCCAACA GTAACAACACTTGCACACTAGAAAAGGGTTAGGATTTACAAACCTTTTCA AACCTATTATGTCATTAATTACTGAACTAAACGTGCAGTAAATTATAAAT AGCAAGTTGACTTACTTATGGCAAGGAACTGCGATTTGGGGAAATTAGGA AAGTAATCATTTCATCAGCAGCAAAATATGCCRCTTTTTCTTTGCGAATT CTTAGTAGAAATTCCTTGGATTGGGAATTCACCTCCAATTTGGTTCAATA TTTTCCTTCTTGATTGGTTAGATATTATCCTAAACTAAAGACAATAATAG ATAGATTCTGGAAAAGTAACGAATGAAATGAAAAACGTCTTTTGGGTATT TTAATATTATTATTATGAACGTTCTTTTAATCTGGTTTTTAGCTGTGGAC GAGTTGCGAATGTTACTCGGTTATGTCTGTATTTTTGCTTTTAGAAACTG GTTATAATTATTAAGTGTTTGTTTTTACTCTCTCGATATTTACATTCTTT TTTTAAAAATTGTTTTTCAGTATTTTATGTTTCAAATTAATACAAATGGG ATAGTGGTCTATAATTGGGATTGGTAATTTCAAATTAGAATGTTTATTGA TGATTTTTATTTCCACATTCCCTCTTAATTTTTCTTTTATATTATTTGAT CTGTTATATATCTTAGGCCGTATAAGAGCTCGTTGTCCGCACAAAACCAC ATCNTTTTTAAAAGAAAATGGAAAAGTTTGACATAATTTATGACAACTAA GTAAAATTTGGCCATGCTTAGGTACTTTTGTGCATTAACTTCCTATTGAA TTCATACATACTTCCAGTCCAGTCATTTAAATCAGAAATGTCAACTGACM AAAAAACTCACAAAGATATATATATATATATTTTTTAATTTTGTGGATAA ATAAAAAAAGCCCATTTATGACTATCATGTACATTTTAAAGAACTTAACT TTTGAATTGAAGATAGAATATCTTTTAAAAAGAATGCATTGAAATTGATT GATTCTGGATATAACTAACGAGTTCATAAATTATTTTTTAAAAGACACAT GATACAAAAAGGATTTATGCATGTACTATAAAACGTATTTTTCCAAAGTT GTATCTTGTCATAAGATAGTTTATAGTCAATTAAAAAGTTAAAAGGTTCT ATACCTGATTCTATATAGTAGTACTTTACATACATATTTTTTATGAAGGT ACAAATAACTTGAGTTTAAATGCTAAAATCTATAAAAAAACATCCATGAA TATGTATAGTATTTCATAAAAATTCTAAATTAACTACATATTATAACATA TAAAATGTTGAATTTTTATATAATATTCAAAATATAAACTTTGACAGATT TCTGTTAAGAGAATAATTTTTATGGTAATGTCCAAAAATAAGAAGAACTA TTGAGGCTACTGTTTCTGCCCTAAATACCCTTCCAATTGTGAAGCTGAGA AACAAGATTTGGGCATGTTTGGGAAGCATAAGATATAAATTGAATATACA CTTTAAAAAATAAGCCAAGTTATGCTTGCAATGAACACTTTGGTTTTTAA GGAAGTCTTCCAATGCTATATTGTATTTATTTCTTGGTTTGTATCTTTTA TTAATTTTTTTGGCAATTGTTGTCTAGTGGTCAATATTTTTATAACTATT TATTAATTGATTTTGATTTTTTGAACAAAATCATTATTTTGAATAATAAA GATTATATTCAGACTCATAAAAAGCACATTATATCTTAGGATTTTTTGTT TGGAGACACACAAAATAACTTTATAAAGTTGCATATGCATACTATTTAAT TAGTTGAATCCACTCTACTCCTCTTAATTCCACATTTACTTACAGTTCTG ATATATGAATCAAAATATTTAGGTATCTATGAAAGTACATCAATCTTAGG TAGCTTTGTTCCACTTTATAGATTTCCAAAAAAAATAACAAGAATATGAA TTACAATAAATTGTCAACAAGTATTTTTATTGTCAGCCAACTAGGTAAAA AAAAAATACAATATAAACAGAGAGCTTTCTATTTCATATACCATTACATT CCAAGTATTTTCTCAACTATGTATGTATGTGAAACGATACAGTGAAGGAA CTTTAATATGAGTACAAGTGAATTTAAATCTTGGGGAATCGTTTTGTGTA TGTATTAATATTTTTTCTTCATATGTACATATTTCGTTACTTTTCACCTC TGTGTACAATATATGTATTTCTCGATTTTCTCTTTCAACAACAGCAATAA TAAAAATAAAAAAAGTAACAGCCAACACCTGCTAATGACAAGAAGTCTTT CTTCTTCTTCTTCTCTGAAAAGAACTTCAACCACAGGATTTGTCATTAAG AAACAAGGAAGAAAGGAAAAGAAGGAGAGCTATATTAGATGAAGAAAAAA ACTAAATGTAAAAAAAAGCAAGCAATACATATAATTGTGCCATTTCAATA ATAATAAGAAAATTGCTTTCTACATATTTATTTATTCGTTTGGGCAGAAG GGGCTGGGCATGTAGGGAACAGCTGCTAACTAATATGTATGTACTTACAT ACATGTATTGTATTTGATAAATGAAAAACAAAAAATAAATCCAATGAGGC TTTTTCACTGAATTTGACGGGTATCAACAGGTATTTAAGTACTCTATTTA TTTAACAGTAAATGGTTGTCAGTTACAAAGTTTTTATTTATTTATGAGCT GTTGTTGTTGTTTTTTCACTCCTGAGCCACGTACAAACAGCTATTATTAT TATTTGATCCGCATTAACTCTTTCTACTCTTTTATAATTATATTTTCTTC CTTTTTTCTATCTTCCTTTTTATACAGGCCTAGGCCCTAATTATTCCACC ATGGAGGAAGAAGACGGGCAACAAAAATCCCTTCCCATCGAAGAATTCAA GGTTTACAAAAAAAGATGGATAATTCTTGCTCTATTTGTCCTTTATTCAG CCTCAAATGCTTTTCAATGGACACAACTCGTCATTATCACAAGTATCCTT GAGAAACACTACAATGTAGGGACACTCGCTATTTCATGGACCTCCATCAT CTTTATGGCCACTTATATACCACTCATATTCCCTGCGTCTTGGATTCTAC AAAAGAAGGTTTGTTCATCTACTTTTTCTCTTTGTAAATTATCCCTCTCT TCCTTTTTTATTCAGCTGTTGGCATTTCTTTTTATTATTTGCTTTCTTTC ACGGGATGGCGCTTTTATTTGTTTCTTACTGAAAACGTTCTACTTTTTTC TTTTTAACTTTTAAGTAATAGCATTCAATAAAATAAAAAAAGAAGGGGGA CGCATTTTTCAAAGTGAAAGTTGTTGAACTTTTTTTCCTTCTCTTTTGCT GGAAAAAACAGCACCTGTTAAACAAGACATTTATTCCAGATGTGAAAACT TAGTAATAAAGAACCATCTATTCAGGTCAAAACATGTACACATAATCTAA AGCAATATTTTTATATGTGCGTATTTATCACAATATTATATTAAGGCTCG TTTCTACCCAGTTAAGTAAACTGTTCATAAACTAAGTATGTAACAAAAAC GAAAACACATCAGTAAGTGATGAATTTCAGTAGTTTATTTTTTAAATATA TAATCCATTATATATTTTTCTAACGAACCTCCAACTCCATTTTTTTTATA AGAGAGAACAAACTGATAAATCCACAACACATAAGCCTTCCGCATACTTT TTTATCAGCTGTTGATCTACAACGTAATAGTATTCTGAGCGTTAATAAAG AAGTCAAAATCCCTAATATTAACCAAAGAGAGTTCCACAGTTGGAAAGAG TGACGTAATGTGTTCAGTACCCCTCATAATTTAGGGCCTTTTTTATATAT ATTTTTGAAGGAAAGGTTGAGATGATGCCATGAATATTTCTATGTGAGAA ATGTCTCATTTGCGAGGTCAAAATATTTTTCGAAATTATTTCTCAAGAAG AGTTACAAAAGTAGTTTGTAACTTTTCAAAAACTTCTTAAAGTATCATGT CGTTACCTATATTGTCCCTCCCAACTTTTTGTAAAAGAAAAAGAAAAAAA GTCCAAAATCAGTAGGTAATAGTTAACCAATTATTCTCAACTATGAAATT GTTGAAAACGTAACCAGAGCACTTATAACGGGAAAAGAAATAGAAAAATA GAAAGTTGACTAATAAGTATAGCCAATGCCAAAGTATGAGTAATTTGATA AATCTCATTGCTAAAAATAAAGAATTGGTATAGTATTTCTGATTTTAATT ACGTCAAAAAGGCAAATAAATATAATCATATATATCAAATGAAAACATGG ACTTGAATTCTAGTTTGTTTTAGTAGTATTCATAGCTGTGTTGTACGGAG AGTACAATAATTTCTAATTTCCAGGGAAATTGTCTATATTGGGTCCCCGG GAAATAAATTTTGAATTAGGGGATCCCGGGAACCATATGTTAAATAATAC ATACTGTTAAATTATATTTTATCTTTATTATTCTGATTATTTTAAGAATA AAAGATGTATTTTAAACTAGTCCTTTTATCACTAACACTGATAGTTTTTT TGTTTTTTCTAGAAACCATAAGTTCTGGGGTTCTTTTAATAGCTCGATCG ATACTTAAATAGTAAATGGCTAACGAAATAATTTTTAGTGGGGCTGGGGG TTGGATAATTGTGAAATACACAGTTCGACCCATGGTGCCAAAAATTCACT TCTGCATAACTAAAATATATTGAAATCTTAAATTTTTTTTAAATATGAGA CCTCTGAAATGCAACATCTCATACTGCTTCAAAAACATGTAATAATAATT GTTATTATAACATACTATACAGGGGTTTACCATTATTTAACAACCAACGC GACTTTTTGTAAATGATTTTTCTCCTAAACTATCCCATTTTAACAAAAAC TACTACTACATGAAAGCTAGATAAAAAAATATTATTACTCATATAATAGC CCTTTCGGATCAATAACAGCCTCAAATCGACCTCGGAAAARGGAAGCTAG TCTTGATGATAGTGTATTGGCAGGMTCCAAGCATGGAGGYCAAACACTGT GTCCATCAAACTCAAAAAGAAATCCAACATCCAGGTCAARGTTTTCTTTA CAATGTGGCATAGAGCAGAGTCTACTTGACAAAATAATGGTGTCCCAGCT ATAGCTTCCTGAGTCCATGACGTGATTTGATCTTCCAATAAATCCCTACC AATTTAATCGATTTGGGTGGCTCATCATCAATGATTTTTGCAAATATACA ATGAACTGCTTATCCCTTTAGTCTGACCTCAACTTGTGATCAGCACGTTT TTCTGTTGATTCATAATCACATCTAGACTCTTTTGGCTCCATTCTGACTC TCCAGACAAAGAACCTTTCCAGGCTTAAGAATTTGCAATCTCAGCATTGT TTCGTCTTGCGAGGATCGCAACTTTATTAACCAATGCCATACACATCTGK CTCACCGCCAAAACAACAAACATCTTCCTGCATGCACTGCCGTCAATTGT GGTAATAGTTGTTGTTAAACAATGGCCGCCCTCTTTATACATATATAATT CAATAAGCTTTACATTATGAAATAATTGAATGCAAGATCTCCCAAGAATT TCCCATAGGTATAAAACCCTGAGAAATCCTGGGATCCCGTGAGAGAAACC CTAGTATATAAACTGTACATATATATATTCATATGTATATTTTTTTCTTA ATTTCAAATGCTCTATAAATATTTTCCACTAAAAATATTGGTATTAAAAA GTAATTTAAAATTAAAGTTATGTTTATTTAGAAAAGATATGTATATCATA TTTTTCCCCTAATATTTCTTCTCTCATATTATTAGATTATTTTTAATTAA GGAGCAAGTTCCACAAACTTTTTATTAAAATTTTTTCAACATACAAATAC ACATAATAATTTCATCAAATCCGTCTATTAGGGCCTTCGTAAATCAATTC TACTGGGTTCTCTTGGAACGTGTCTCGGCAGTTGGATCAAAGTCCTTGCC ACTCATCCCTCGAGCTTTAATCTTCTTTTTTCTGGCCAAACAATAGTGGC CATTTCTCAAATATTTATACTAGGGATTCCAGCTCAWTTAGCCGCTACTT GGTTCCCTGCAGATCAAGTTTCTTCAGCCTGTGCAATAGGGGTTTTCGGA AATCAGGTATGATGTTCTTTCATTTCTACTTATATATAAAAAAATTAATC ATTTATCATCTGAGGCATTTATTATTTTACTTATTTATGTTTTGATGACT TTAACCTGACTGTCAAAAATTTTGATACACCATATAATGCAAAGATGAAA AATAAGTTGAAATGAAAGAGACAGGTTTTTTTTTATATAAATGAATTTTA GTTTTGTTTAAAAAACTTTTTCTTCTTTATATTCTAATATTTAATAATCA TTTTATTACAGTTGGGTGTTGCTCTAGGCTTTGTTCTTCCGGCATCCTTT ATAAGATCTTCTGTGGGATCTAATTTTGTAACAACTCAGAATGACTTATT TGCAATGTTTATGGCAGTCGCTATCATCACAACAGTTCTCCTTATTATCA TTATATTTGGTATGTATCTTGTTTCCATTTTTTTAAATATCTTAAAAACA TCCATTTTTATATACGTATATCTATTCATTACTCATGTATATTACATTTA GAGTTGACATGGTAATGGAAAGTTTTATAATTACTTTTCCTCCAGAGCAA TTATTGTAAATAGATTTGATAAAAAACCCGAATATTTATTATTCATGATG TTTTTTATAAAATTCTCTTGTAAATTTATGAAATCAAAATTACTCAAGCC CACTATTTTCACAGAGTAATTAATTATATACTAATTAAATTTCAATAAAA CATGTGGGGATTTTGTGCAAGTCGTTTTTCCATTAAAATACAGCAATAGC TCGAATAGCCTGGGTAATTAGTTCCACGGATATACATGACTAATAAAGAC ACCATTTATTATTTTCTCACGTAAAGTTTTGCTTTTATTAGTCTTAAAAT AAACATTTGTACTATAACAAAACCGGGATTGATTGAACCAAGGCTCAATT GGGGTAGCTGTACTTGTAAAATACGCGTTAAAATTTTAAATTTAAGAAAC GGGTTTTAACTTTCTCATCTTTTATACCAAAGTTATGTATTTTCAAATTC CAAATTTTCATCATATTTATAAATGGGCAGCACGTAAAGAAAAATGACAT TAAATAATAAAATAAATCGTCATGGTACATCTCCCTCTCTCTCTCTCCCA ATGATGAAATCCCCACGTTTTTCGTAATTAAGTCATGCTACTCCAACTTT TGGTTCCCCACTCTGTAAGATCACAAAAACTACTTATCTATCAGTAAATG TGTCAAATTGAATAAATTTTCAGTAAGTTTCAACAGCAATTAGATGTTAA TCTTTTTTTGTACAAGCCTTGTGTACAAGTTGTAATTTGTACAATCATAC TGTACAATTTATAAATTGACTTATATCAAGAATATATACCTAATTGTAAA AGTACCAGTTATTTTGATTAGCAATACTATCTTTCCATTTTGATCTATTC AAACTACTTGGTTGTAACTTGTATAGTGTACATGGCATAAAGTATGAGTG TTTTTTTTTTTAAAGTTATACGATACAAGGCTCACAGTAATTTCCAATTT AAACTCAATAAACTACATCATTTATTATTAATAAAAAACTAAATGCATGT CTATTAAAAATTATGAAAGATACTTTATATTTCACTCAAAGGATCATAGA AGCGTAAATGATGAGAAAATCGATGTTACTTACTAGCTCGCACCCCCCCC CCCCTCCCCTTGGGGATCATACCTTTCATCTTTTTTGGTTACATATTATA TGAATAAAGAAAGAGAGCAGTGTGCATCTTTTATGAACCCCCTTGTCCAA CCTACTCTATGTATATAGTAGAAATATTGTGATAATATGAGCATGTTTGT AACAAAATCGATTTTTCCCTTTATGTAGTCACTTTTTTCTTGTTGTTCAT ATCTATCTACACTCATATATAAAGTACATGTTAGTTAACGACGAAGGTTT CGTGATTTCTATTCTTTCTTTTTTTTTTTTTTAGCATTCTRTGACAAACC CTTAAATCCTCCATCTCCTGCACAAAAGGCAGCAGTTGAGACTCTTGCCG AAGAAGATTACTTAAGCTCTATTAAACGACTTATTACAAATAAAAACTAC ATACTCCTTCTCATCACTTATGGTCTCAATGTTGGCGTGTTCTATGCTGT GTCAACCATATTAAATTCTGTTGTTGTTTTGTACTATAAGGTAATTATTT TACATATATTTCAAGCAAGTAGGTACATCAAGCATATAAAAATGTTTGTT GTCTTCAGAGTTGTAACACACCCTTTTTTAGGGCAGGGATATTCAAGCCC TGCAAAATGTTTTATTATATATATTTATTAAACCACTATTAAATAACCAA AAAAACTTTTTTTTAAATTAATTTTCTCCTAAACTAATCATCCAATTTTA ATAAAAACCAATGCCAAATGAAAGCTAAATAAAAAGGAAATTATTATAAT TTAATATTAATTTTTTTGCCGTCCAGTAACTTCACCTTGTTACTCTCACG CTCAAGGATACTCTGCCCTTTCGCAGGCGCTCAAAGTTCGTTGTTAAACA ACGTCCGTATGCTGTATATATATATAAATAATGAAGCTATTTATATTTTG ATAATTTTTGGTACTTTTTTTGGTTGTCTGTGATTATTTACATCAAGGGA AAATATCGAAAAACTTAAATACATGTTCATATCTTTATTTATTTTTATGT AGGATGCAGAAGTAGACGCTGGTAGAATTGGATTAGTTATCGTTCTATGT GGAATGGTTGGTTCAATGGTTTGTGGCATCATTTTAGACAAAACTCATGC TTACAAGTAAGTTTATATGACATACCTAAGTATGTAAATATGATACAGAG TTAATTCAAAAAGGGTAGGCCTCATTCTTTTTCGAATGTTCAATTAAAGG TTTCAATTATATCTTCATACCATTGATGCCAAAGGATTTCCTATTTTCTT TGCAGAATTCATCCTGTGAGTTCAATTAACGGGGGGGGGGGGYATTTWTG GTAATTGTAAATTTATAAAAATAAAAATTCATGGTATACTTAGCCCTTAT ATTAGATAAAAAAGTATTATCGCTAATAAGAATTAAAGTTGAATACCTGG TCGCTTTGGTAAAGAGTAAAGCAAGTTAGATTGGACAGGTTGGATCAACC AAACAGAGCAGGCAGGACTAGTACGGTGATAAAATTCCCTGGTCATTTAT AGACATGTTCAACGATGAAAAAATGGAAAAAATACTATAAAGGGCCAAAC CCAAACATTTTCTCGCAAAAAGTAATCAATAAATGTTATTTTTCTCAAAA ACATCAAATATATGTTGTTGCTTTTTGACCAAAATCAAAAAATGTGAAAT ATATTATCAGGTATATTTCCCAACCTAATAATTACAATATATTTTTTTGC TCTTAGACGAGTCGTTTTTTTAGTGATATAATTTTTAAACCTGAATTTAG TTTACACCGTCTATAAGTCCATCAAAAAATTGTAAAATAAATCCTTTTAT GTCAAGGCTTAGTGTTTAAAATCTTTGTTCTCAAAGATAAAAATCATAGA TTATAGTAAGTAAAGAATGATAACTTTACTTTAAAGAGAAAAATAATAAT TTAGGAATAAAAGGTTGTGTACCTGCTCAAGGTTGGGAGATTTATATTTA AAATATTGTTACATAAAAAAGTCCATGTTTCATGAAGGTGTGTAATGATA CGTAAATGAAGATATATATATTCAACTATATTCACTTTGAAAGAGAGAAC AATTATCTTCCTTTCCTTACGCGGCTCGTTTTTTGAAATAAATAAAGATT TATTTTATTTACCTTTCAGCTGCATTAATTAATTTTCATATGTTTATACT CTTGTATGATTAAAAGCAGCTGATTTTACATATTATAAGCTCCAAAAAGG TACTACATAGCATTTGGATATTTATATTAATCAAGGGCCTCCGTTTAGAA TTCGTGTCACTTCGTAGTCAGTCATTGCTAGTTGTTCTGATAAAGTTATT AATTAAATGTATATAATAATTAATAACTATTCTAGAAATAATAATTAACA TTTGCCTAGAAGTGAACTTAACTATGATATGCAAAATTTGAAAATTTAAC ACTCATTTTTTACAATCTTTCGATGAACAATGTTCTAGAATACATAATTT GCTGTCAATTGCTACGAAAAACATTATCATAGTCGCCACCATGAGCACAC AGTACGTTAAGAGGATTTAGATCGGAGTGCTCCTCCATGCTGGATTGTTC CAGAAGGCCATTTGGGAGCAAGCACAGTTTCGAAGATATGGTGTGCAGGG CTCTAATAAAGGTAGGAGGAAAGTAGCTGTGGCCTATTCCTCGGCCTTTC TTGACGGAACAGCAGAGAAAAATCCGTGTGGAACATACAATAAAGATCCT GACCATCTCAAGGGAACCTGTGGACTCATTGTGATCTTTTCTGATGAGAA GGCCTTTACTATTGAACCTGTCATCAACAGGCAGAATGATCGCGTAGTGA CATTTGGGGATGTAGTAGAGGAGCACAGATATATATGTCTCCATTACCCT GCTTCAGTGATGGTGTTAGGCCTGGTTGCATCCAATGGGAAGGACATGAA TCCCTTAAGGATACAGGCTGAAAGCTTATGAGTAAGTCAAAATTCTGAAG ACCAAAGTTCTCCCATGGATCAAATCCATCGTTGGTAAATATACCTGGAT GTTCCAACAAGATAGAGAACCAGCCCATAGCTCCAGGCTAACATGCGTTT CTGAGCAAAGGACTTCTCGCCACCTAAATCCCGTAGAATATTCCATCTAA GCTCACGTAGAGTCCAAGGCCTACAGGAGATGCCACAACAGCATCCTTGC TCTAAATCCTCTGTTAACAAAACCTGGTCCTCCATGAGCGCCGAGTACAT CCAGAGGTAATACAGCAGATTCCACCAACACCTGGAGCTCACCATCAATT CTAAGGGTGAATACATTGACTACAACATCTTCTTTGGATTTCAATTAATA ATTAAGAGTTGGTAAACATTTTTTCCAATTCACCCAGGATCTTACCATGG ACTTCAATACTTTGTTTGTTAAAATCAGTAAATAATAATGGTTGGCCAGG TACAGGATATTCATAAGTTTGAATTGTATTAAATACGCGATAATATATCA GACAAAATTATATTTAGAAAATATTTAAAACGAATGTTCTAGACTATATA ACCTAATATATTTTTATAAATTACTTTAACAATCCAATGAACGAGAGTGG AAAGAGTTGTATGCTCTAGGTATGTATTCTTTCCAGAAGTTCCACTGATG CTACTTCGAGTTCATTAAGGAAATATACCCCATTCTAACTGGAATTACAT TAGCCTTTTACTCTAGATAACTCTATAAAAATAATTGGGGTTGAGATCTA AATTCGAGGGAGGGAATTCCTGAGAATTTCGACCATTATATATTGGAGCT TTATTTTTCTGAAAAATGATTTTCTGGTTATCAGAAGAATGTTCTTTAAT CCTTCGGTAGTGAACTGGGATATTATACACCACAAGATTTATAAAAATAC TTCCTATTCCTTTAAATCTACAATAATCGTCAATATTTTTTTTGATAAAG TAATGAATATTTCATAGAAATTTGTATCAAAAGTTTAATATTTTTAATAT AAGAACAACAAATTATATCTTTTAAAAAACACCAAACTCATTTTGTTATT ATTTTTTAAATAAGGATTTGTCGATGTCTTATATTTATACAAGTAAGTAT TTTGATTGGTTAATTTACGAGCGCAAAATGGATGGACTACTTAAAAAAAT GATAGAAAATTAAAATTAAATAATTATTATTACTTTGTTATTAAGGAGGG GTTAAACAAAGGAAAGATAAAAGGTTAAATTTGTTATCATATCTCATGTT TTTGAGTCACTAAAACATTGCTGAGCTTTTGCGTACAAATTTCCTACAAT TTCACGGACCTCTTTATTTTTTGTCTCGTTAACACTCTGTGAGTTTCTTA ACCTAACGAAAATTAAAAGGTTTCATTTTCAAGTGCTTCAAAACCAGCCT GCGAAATTCCAACTTATTACGACATTTTGGATATTTTTTACGTTAAATAT TTCATTGTGTCTTTTCTGTTCCTCCTGGTTCTTCTTGAATTTAGACTGCC ACTTATGGCCTTTTTATCACAGCTACTAGTGTTATGAAGCTTCTGGATAG TATATTCAATGATACTACATATGTCTTATCGAGTCACCTAGTCTCCTGTA AATTTAAGACGAATTTTGGTTAATCCTTTTTTATTTATTTTGTCGTGGTT GATTTAGTATTGAGTTTAAGCTAATCAGATTGCAAATTCATTTATTAAAT GCTGAAATTTTTTGCAGCAATTCTAGAACCTTTAAAACTTATGAATAGCC TTGTATACACTTGTATAGTAGAGTGTTCCTTTTTGGAAGTTAAATTAATA TTTTCAGCTGCACTAAAGTTTTTTTCTACTAGAGCGACCATAAAAAATTC AATGTACAAAATGTTCTATATGTACCTGTTTTATGTTATTATATTATTTT TATCAAATTAGCAGGATTGGTTTACTGAAAGGAGCAAAATAAATAAAAAA ATTAGATGTACGAATGTAAGACAACTTAGATATTAAAAGATTTAGGATGT TAAATGTCGTCAAGAAAATGACGTATATTTTTCTGAACTAAGTCTTATAG GTAGTCGTAGAGAACTTCTACAGGGAAGACCATGTGTAACTTATAGTATA CTTCTAAAGAAAATATAAATATAGTTCTTTGTTACAAAAATTTGGTATCC TGTATTTTCTCTAGGAAATATATGTCAGATCTTCTTTCAATTGGGTACCC CTTATTTTTTTAATCTTTCAGAAGATATAATGTGGGGGCCATTTTTCGAC TTATTTTAAGGGATGAAAGTAATATTTTTAAACGGTTTTTTTAATTAAAG TTATGCATATTTCATTAAATGACGTTTTTTAAAGAATATTTTTGTATTAT TTTTAAATAATCTTTTTTTCAAAAAGGTTTATGGATCTTTTTATTTCTAT GGCCTTTTCCATTTATAAATTTCTTGATTATATTTTTTAAACATAGTTTT TTATTCCAACCATAGAAAAAACAATAGATAGTGACGACAATTTAATTTTT ATGGCAGMTAGGMATTACAAAGCAAAAGTCTTTTTTAATATAAAGCTCGA GTAAACGAATTCACCTGCTATAAGAAGAGAACTGGGTATGAATGTCCTTA GTAGCATCTCTAATTCTCTACTACATCCATTTTTGCCAACAACTGAAATT TAGATCAAGATATTTTCCATTTTGTTGCCTCTATCAGGGCGTTACCTCGC TAACACAAAAATACCCTATACATCAAAGTCACCTTCCTATGTATTTTGTT GTCATCTGTCAATTCACTTCACTCGCTTGATGATACGTCATGGCTATTTC ATAATGTATTATTTTTGATCAATAAACAAATTAATAAGTTATGCTATACT TAGGCTCTATTTCCAAAATAACAGGACTACAATTTCTTGTTGATACTTCG TCATAAAATGGCTAATATACATATTAGCCATTTTATTTAACAAGATGAAG AAATTTTGGTTATCATATTTATAAACACTTTTTATAGTATATTACTAAGC AATATTATAAAACAGTATCGAATAAAATACTATATAGATTTTATATTACG AATATATATATATGTGTAATTCATTTTAATAATGATGAAGAAATAATATG ACGGTAATAGAAGGGAAGTACGTACATAGGATATATACATATAGTAGTTG GATGATTTCGGGCCTTTTTTCTATTTCTTTTTGGAGGAAAGGTTGTGTGA GACAATAAAGGTAGCGACGTACATTAAATATATTTCTGTAATGGTTCCAA CAGTTGTGAAACATTGGTTAAAAAAGGGAATTTGTCAAATATTTACATAA TTAGGAGGAAAGGTTGCAAAATMCAATAAAGATCACATCACAATCACNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATA TATTTGAATTTCACAAAAATGACTGAATAAGTTTTATCAAATAAATAAAG AAGAAATTTTAATTTAAATGATCTTTTTAATATTTAATCATTAAAAATCT ACAAAATATATAATACTTATTGTTAGGCTCTTGCCAAATAATAAATAAAC AAATTTATAACATAAATATAAATAAATACTTTTGGTCTTATTTACGTATT TAAAATGTTTTATTAAGTTCAATATTAAAAAATATTAATAAAACGGAGGA GAGTAAATTGTTATATACATAGGCATATTTCATTTTTTTTATGTATATGT ACGTGTATATTTATATATTTGTTTATATAAATATTGTTTTTATATCAAAT TATGTAATTATGATATATTTGATTTTCTAATTCATATAAATATTTCATTC TAGAGCAACTACTTTTGCGGTCTATATCCTTACTGCTATGGGAATGACAA TTTTTACATTTACAGTTAATTTGGGACACATAGAAATCGTGTATTTCACA GCAGGAGTTCTTGGGTAAGGCATTGATAATGAAATAGCTCAAATTAACAT TTTTACATGTACTCAAACAAGGTTTTTTATGACGGGCTATCTTCCTATTG GATTCGAATTTGCAGCAGAAATTACTTATCCTGAGTCAGAGGGTACATCC AGTGGTCTTCTTAATGCCTCGGCACAAATATTTGGCATCATATGCACTCT CATAGCGGAGCGGCTTTTGGAATTCACACACAAGGCTTTCATTCCTAATG GTGTTCTGATTATTGTACTTATTTTGGGATGTATCCTGACAGGAATCATC AAACCAGATTACAGAAGACAAAAAGCGGCTAAAAATCAAGTGTCAAACTC ATTTACAAATGAAACAATAGCGCCTTAAGAAAAATGGCTTTCAAACAAGA GGAATTAATGAAAACATGTAATTTCCCACTTCTTCCTTCATCAAACGCTT TCAATGTTTGTGTTATTAACTAAATTAATATATTTTTGTAACTGAATATT CTAGCTTTTAGAAAAGTAGAGTATACAGAATTACTTTGGAATATTTTTTA TATAGTTGTTACGAGCTTTCAATCCATTTGATTTTGTCATATTTTGTTTC AATGATTAATTCATTATTACTCATTATATCTAAGTTTATCATAGCATGAT CATATTATTCATTTATTTAAAATCCTTCAAATGTGCCAAAGTTTATAATT TGATTAAGACATGATGTGCCTTAATATGACTAATATTGCTTTCAATTATT GTGCATTTTATCTTATTCATAAATAATAATTGATTGTTCTATTATTTCAA AATAGAAGAAATGGAGATACTTCCTATTAGAAATAATAATGTATTTTCTG AACTCACTAAGCTACTCACTAGATTCAATAGCAATATTAAATATAGAACA GAATATTATAAAGTTTATTTACATATATACAGTATGCGTCTTAAAGCACC TTATTTAATTACAACATCAGCTATTTTGATTATCAATTATTATTTGATGT CATCATTCTATTTTAATCGATTATAATAACTTTTTTACTATTTATTTATA AATAATATAGCTGTGGACATTTGAACTTTATGATGTACAACAAAATACTT ATAAATTAGTTATTTTCATCAACATGGTAAAAAATTACCCCATTAATATA TCTAACATCTGGTTTAAAGGAATATTCAATTATTACATTGTGTTCATTAC AAGTACTGTTAATTCATCATTTCAAATTATTCGTATCAATTTTTGTTTGC AATTTGTACTAATTATTTATTTAAACAGATTGAATTTTATTATTTACTTA ATTTTATCAAATTAGGAAATTGGCGGAATATTAGTGACTAAACACTCACG AAACTTATTTTTCATTTTATTGATTATGATGATGTTAAACTGTGTTTCTT TAACTTTTTCCCCGTTAAGTGTGAGCTATATATTATAATTACAGCTGTAA TTACTCTTAGAATTATTATCAATATTTGGAAGGAAATATATCGAAAATAT TTATGGATGTTTCTATAAATAAAAATGTATATTCAATGGAAATGATCATG ATGTATATCATTGTTTTTATAGAAGTAATATTTCCAAAATAGATTTCTGT AAATTTCATGTGTTTAATCAACGATTCAACTTATTTATTGTTGTATACTG TATATTATATATAGTTCCATTCCCCATACTAAAGTATATGTGATAAATAC TTTTTGTTCTTTGACTTAAATGAGGTCACATGCCGAGAATATGAATGACG CTATTGTTTCCGTAATCATTCATAACTATTCCATATATTTCTCAAATATT GATGTCAAAGGATTATAAATGGTATGCTTAGAGTGGGGGGTATCTAATCT GCATATAGTTAAAAAATAGAATTTTCTTAGTACCACTCATACTATTCAAT AGGAAAATACTATAGAGATAGTGTCATTTCCGTACTGAGATAATTATGGA GAAAACTGCCTCTTCTTGACATTCATGAAGGTTAATAACTTAAACTGTAC ATTTTTACTTCCTTACTGTAAAAAGAGTAAACGAATCACAACCAAACACG ACAATGAAGTATTAAAAAATATTTATATAGTAATCTACATATTAATATTA TAATGTTGAGGGTGAAACTATGTAGATTATTTTATAGTTTGAAGGCCATT AAACATTTAAAATTTAATTTAATTATTTGAAAATCTAAGTGTGTGCAGGA ACCCATATTTATAGGGTTTTGTAATTGAAGAGTGGGAGTGCATTCCGGTC GGTCCGGTAAATTTTGTTTATAACGATCTCAAACTTCTCAGAAGTTTTTA TTAATAATTTCAAAATTATTCTAATCATATTTTTAATAAATAAAAATTTG AAGCAAATTTAAATTTATTTGAATCATTCCTTAACCTTAAAAGCAATAAC TTCCCCATTCTAAGTCCAAAGATCTTTTAATAAGATAAGGGTTTTTTTAT TCCCCTAAAAACAATATTCAAAATTATATTATAGACAATATTTCACTTGT CAATATCTTTCAGATTGTAATTATAAAATAAAATAGTAACATATGGAAAG AGAAAAAATTTAATTTGATCTTGAAAATTACTTTGTTGATCGATATATCA GAGGTGTGGACTCGAGGGATTCATTTTATTACTTGAGATTGAATATGAGA AATAAGGTTGAAAGACTTTAATTTTGACTTGCCAAGATTTGCCAAAAAAG TCCTCTGATTCATGGAATATCTGTTTATAATAAAAGGAAAATATTTTATA AAACTTGAATTTTAAAAAAGTTAAGAGTTTTCTGTACTATTCATAATTAA ATACCTAATATTTCTATTTCAGATATATGAAAGGATCTCTTCAATAACTT TTCATCAAGTACACTCTTCTTTTAATAATAGCAA
back to top
Add to Basket