EMLSAT00000009224, EMLSAT00000009224-705071 (mRNA) Lepeophtheirus salmonis

Overview
NameEMLSAT00000009224
Unique NameEMLSAT00000009224-705071
TypemRNA
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
Nauplia: Halloween genes unknown
  1. Nauplius1
None
-Missing-
15.02.2015 - 10:59
22.02.2015 (All day)
Shade shd unknown
  1. Nauplius1
-Missing-
-Missing-
04.04.2015 - 11:27
10.04.2015 (All day)
Halloween gene nvd,dib,shd unknown
  1. Nauplius1
Non
-Missing-
08.10.2015 - 12:55
14.10.2015 (All day)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s588supercontigLSalAtl2s588:244024..246336 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Properties
Property NameValue
Logic nameensemblgenomes
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this mRNA
DatabaseAccession
Ensembl Metazoa (transcript)EMLSAT00000009224 (primary cross-reference)
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
EMLSAG00000009224EMLSAG00000009224-691990Lepeophtheirus salmonisgene


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EMLSAE00000040938EMLSAE00000040938-749866Lepeophtheirus salmonisexon
EMLSAE00000040939EMLSAE00000040939-749867Lepeophtheirus salmonisexon


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
polypeptide-auto775179auto775179Lepeophtheirus salmonispolypeptide
EMLSAP00000009224EMLSAP00000009224Lepeophtheirus salmonispolypeptide


Sequences
The following sequences are available for this feature:

protein sequence of EMLSAP00000009224

>EMLSAP00000009224 ID=EMLSAP00000009224|Name=EMLSAP00000009224|organism=Lepeophtheirus salmonis|type=polypeptide|length=549bp
MKVLKVLMLTTTTTTVGVGEMDILNQFFMALISLFTPPLSKILILVNRLI
SKLSYFSKTPSIKNPLMNIPGPRAFPIFGSSWQYSDWWFGMYKMEKYHES
NEDKYARYGPVVRENVLWNFPLIHLFEKEEIEKVLNSKSKYPLRPPNEAD
VYYRNSRPELYNNIGMVNLNGPSWHTLRSTLTKPLTKSSTITNYVAHMNL
IADDLTSLIKRRQNEQGIIKDFQDIVYRAGLETVCTVALERRMGFLADTI
ALDTARILNAIQGYQSSSNESMYGXPWWXYVPETFSGXFTSLVKHKDYLF
GTFGAMIDENLVQNKDFCDEESIIHQLVSGNVDIKDVKASVVDYITAGVD
TIGNTVIFALLLLAKYPEKQKKLQAEIERVLGSENYITKENIQEMKYLKG
CVNESFRLYPTASQIARILDEEIITSNGHSLPPGSVVLCHQRIASLQEQN
FTRAKEFIPERWLEXEAVTEFGTTNYAHNKSLVMPFGFGKRICPGKKLAE
QEIYIMTAKLMKNFNLRLHDASDFDVEFRFLLMPSLDNLQIQATSRDLS
back to top

mRNA from alignment at LSalAtl2s588:244024..246336+

Legend: polypeptideexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAT00000009224-705071 ID=EMLSAT00000009224-705071|Name=EMLSAT00000009224|organism=Lepeophtheirus salmonis|type=mRNA|length=2313bp|location=Sequence derived from alignment at LSalAtl2s588:244024..246336+ (Lepeophtheirus salmonis)
ATGAAGGTACTCAAAGTGCTCATGCTAACTACTACTACTACTACTGTTGG TGTAGGTGGTGAGTGACTGTTGGTGGTGGTGGTGGTGGTGGTGGTGGKAA CAGGAGAGKAGKCTTTAGGTTAAAAAGTGCGTGGCTCGCCGGCATAAGGG GGGTGAATAAGAGCAGGCGATTCACACACAAAAAGCAGGCGCTTCACGGG TCTGTTTGGTCCGTTCGATGTTGAAAAGTACGAAATTCATAGACATATAA AATTTGGATCACATTAAGACGAAAATCATTCGAGGAAGCACATCCGAGAA AGTACCACTCAAGAAAAATAATATTCCGTCCATTCATTTAGTTCATTGTT ATTATTCAATATATATTAATATAGTTATTAATTTGAAGCAACAAGAATTA TTTAAAAAACACTCTTAATAGCTGCTTACTAAAAAATAAAGACTTGGAAG GGGTTTACGATATCCACTATCCAAAGAGCAAACCATCTTCTTATTATTGA TCAACATCCTTCTTTTACGGTAAAGACCTTTTTATGTAGCTGTTGTTGTC CCTCATGCTCTATTAAACACTCACTGCAAACCAATGTGGGTGTACTTTTG AATCATCTACTCTTGTCAAATATAAATCCATGTTACAAATTTGAAATCCC CCACTCTTTCTCTCTCTATGTCAGAGCTCTTCCAGCTTTCTAATGTTCTT ATATTTTTTTCTTATTTTCAGAGATGGATATATTAAATCAATTTTTCATG GCTTTAATTAGTTTATTTACACCACCTCTATCAAAAATCCTCATCTTGGT TAATAGACTCATAAGTAAACTAAGTTACTTTTCCAAAACACCAAGTATAA AAAATCCTTTGATGAACATTCCAGGACCAAGAGCCTTTCCTATATTTGGA TCTAGTTGGCAATACTCTGATTGGTGGTTTGGAATGTACAAAATGGAAAA ATATCATGAGTCAAATGAAGACAAATATGCTCGCTATGGGCCTGTAGTGA GGGAAAACGTTCTTTGGAACTTTCCATTAATTCATTTGTTTGAAAAAGAA GAAATAGAAAAAGTACTTAACTCTAAATCAAAGTATCCTCTTCGTCCTCC GAATGAGGCGGATGTTTACTACCGTAATTCTAGACCAGAATTATATAATA ACATTGGTATGGTCAATTTAAATGGGCCATCCTGGCATACTCTTCGATCC ACATTGACCAAACCTCTCACAAAATCCAGCACAATTACCAATTACGTTGC ACATATGAATCTCATTGCTGACGATTTGACGAGTTTAATCAAAAGAAGAC AAAATGAACAGGGGATCATTAAAGATTTTCAAGACATTGTATACCGAGCG GGATTAGAAACAGTCTGCACTGTGGCTCTGGAAAGGAGGATGGGATTCCT TGCCGACACTATTGCCTTGGACACTGCTCGCATTTTGAATGCAATTCAAG GCTATCAGTCATCCTCTAATGAATCTATGTATGGCTTKCCTTGGTGGRAA TACGTTCCTGAAACATTTTCAGGGGKATTTACGTCTTTGGTGAAACATAA AGACTATCTTTTCGGTACATTTGGTGCTATGATTGATGAAAATCTTGTGC AAAATAAGGATTTTTGCGACGAGGAAAGTATTATTCACCAACTTGTTAGC GGTAATGTCGATATTAAAGATGTTAAAGCATCAGTTGTGGACTATATCAC AGCAGGAGTAGACACCATAGGGAACACCGTCATTTTCGCCCTTCTACTCC TTGCTAAATATCCTGAAAAGCAAAAAAAGCTTCAAGCCGAAATTGAAAGG GTCCTCGGAAGTGAGAATTATATTACAAAAGAAAATATTCAAGAAATGAA ATATTTGAAAGGCTGTGTCAATGAAAGTTTTAGACTCTACCCCACTGCCT CCCAAATTGCTCGAATTTTAGACGAAGAGATCATTACAAGCAATGGACAC TCACTTCCTCCAGGCTCAGTTGTACTTTGCCATCAACGCATTGCTTCTCT CCAAGAGCAAAATTTTACACGAGCTAAAGAATTCATACCAGAGCGGTGGT TAGAGKCCGAAGCTGTAACTGAATTTGGCACAACCAACTACGCACACAAC AAGAGCCTTGTCATGCCCTTTGGCTTTGGAAAAAGGATTTGTCCAGGAAA GAAATTAGCGGAGCAAGAAATTTATATCATGACGGCCAAGCTTATGAAAA ATTTCAATCTAAGGCTACATGATGCTTCGGACTTTGATGTTGAATTTCGA TTTTTACTCATGCCTTCTTTGGACAATTTACAAATCCAAGCGACATCCAG GGATTTATCATGA
back to top
Add to Basket