|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterproScan 5
Date Performed: 2014-05-02
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| None | No IPR available | COILS | Coil | Coil | coord: 158..179 |
| None | No IPR available | GENE3D | 1.20.1250.20 | | coord: 78..137
e-value: 5.0E-6
score: 25.4
coord: 208..239
e-value: 5.0E-6
score: 25.4 |
| None | No IPR available | PANTHER | PTHR24063:SF50 | SUBFAMILY NOT NAMED | coord: 78..203 |
| None | No IPR available | PANTHER | PTHR24063 | FAMILY NOT NAMED | coord: 78..203 |
| None | No IPR available | TMHMM | TMhelix | | coord: 115..137 |
| None | No IPR available | TMHMM | TMhelix | | coord: 205..227 |
| None | No IPR available | TMHMM | TMhelix | | coord: 31..53 |
| IPR005828 | General substrate transporter | PFAM | PF00083 | Sugar_tr | coord: 194..240
e-value: 6.2E-7
score: 28.2
coord: 88..125
e-value: 4.0E-5
score: 22.2
coord: 128..185
e-value: 2.0E-5
score: 23.2 |
| IPR016196 | Major facilitator superfamily domain, general substrate transporter | SUPERFAMILY | 103473 | MFS general substrate transporter | coord: 78..160 |
| IPR016196 | Major facilitator superfamily domain, general substrate transporter | SUPERFAMILY | 103473 | MFS general substrate transporter | coord: 194..239 |
Analyses
This polypeptide is derived from or has results from the following analyses
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EMLSAP00000005854 ID=EMLSAP00000005854|Name=EMLSAP00000005854|organism=Lepeophtheirus salmonis|type=polypeptide|length=255bp
MVIIVYEASIPRVDKPLEILRPFGNVRRQMAVGVVANIVSMTGAIALISS
SMILPQLQGESRDSINELTLTMEEGSWFGGHATSSSLASLPIYIGEISHP
HMRGTIAGMFGLLYYFGTLVVSIMGCVPIINFFGFIFCPESPTWLIRRNK
TAEAFKSLMFLRGERAQVLDAIKKIENNLNTEIEAHEFECKKTLLSPFML
QNFKMYGCFGIFACVSVSAVLIAYFFLPETKDQSLEDIENHYQNISGIKN
KENNI back to top
|
