probable cytochrome p450 303a1, maker-scaffold1571_size35388-snap-gene-0.6 (gene) Tigriopus kingsejongensis

Overview
Nameprobable cytochrome p450 303a1
Unique Namemaker-scaffold1571_size35388-snap-gene-0.6
Typegene
OrganismTigriopus kingsejongensis (Tigriopus kingsejongensis)
Associated RNAi Experiments

Nothing found

Homology
BLAST of probable cytochrome p450 303a1 vs. L. salmonis genes
Match: EMLSAG00000002359 (supercontig:LSalAtl2s:LSalAtl2s144:369128:376155:1 gene:EMLSAG00000002359 transcript:EMLSAT00000002359 description:"snap_masked-LSalAtl2s144-processed-gene-3.3")

HSP 1 Score: 250.366 bits (638), Expect = 8.172e-74
Identity = 145/441 (32.88%), Postives = 241/441 (54.65%), Query Frame = 0
Query:  330 MGKEPVLDDK-ARYGKIVGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHM-YRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEAN-QICDKMEASQGKP--LEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAI-DASVQGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESD-GDFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIKDGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHP-PPVDKYITGFILSPETFHV 762
            +G   + D K  +YG +    +G    V + +Y L K++F +++   R  T+  +  R  G   G++   GH WK  RRF+++NL+D GFGK +++  +  EA   I D ++ S+     L +   FNV ++NILW+++A  R+D D+    + +  + +   +G  I+         H  P    ++   K  D+++   K+  + +        + S+  DFI  Y K  +     +F+E  LM T +D F AG +T+A TL W+VLY+ L+PE Q K   EI+ VL  ++P  +    + Y  A + EIQR + + P  +PHVT+KD  I  Y IP+GT + G +  F ++P ++  P+SF+P+RFI++GK KK E    FG+GKR C+GE +A+N+LFI F+ ++Q+L I+ S  H  P  + Y  G    P+ F++
Sbjct:   45 IGSNALTDPKFGKYGDLYSLFIGNIHLVVINNYQLAKDLFAREDVSYRRETWWTLNVRGDGHPLGIINTSGHVWKEQRRFAVRNLKDFGFGKNTLDAVIQNEARFTIEDIIKESKNNNGVLRMESTFNVGIINILWQIIAGYRFDKDNEKTKEMMGHLHEVYSEGYSIL---------HYIPAARFFIKRDKRMDDML-RTKEFFRSQIREHMKDYDASNPRDFIDVYIKEMLDEDRENFHEEQLMTTCLDFFQAGGETSATTLLWSVLYISLYPEAQAKCVEEIEAVLGKEDPSQEVYKDMVYCNATLMEIQRMASVGPLTLPHVTIKDLFIDGYCIPRGTEIYGNIIAFHNNPKFFPSPKSFRPERFIENGKLKKLEAFAPFGVGKRICMGESMAKNQLFIFFVMMLQKLKISVSENHGVPDPEAYTMGITKIPKPFYI 475          

HSP 2 Score: 147.517 bits (371), Expect = 6.890e-38
Identity = 101/364 (27.75%), Postives = 175/364 (48.08%), Query Frame = 0
Query:   18 RKYSKPRNFPPGPPWVPFFGSMPFLPKIGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHM-YRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICD---KMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNISVITVMP----WLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVLMGKEPVLDDKARYGKIVGC-----------MLGP--FPSVTVYD 360
            + Y +   FPPGPP +P  G++P++  IGS      K    +YG +    +G    VV+ +Y L K++F +++   R+ T+  +  R  G   G++   G  WK  RRF ++NL+D GFGK +++  +  EA    +   K        L ++  FNV ++NILW+++A  R+D D+    + +  +   +  +  S++  +P    +++    +       ++F  ++  ++KD               +  DFI  Y K  +      F+E  LM+T +D F AG +T+A TL W+VLY+ L+PE   K   EI+ VL  ++P    +  Y  +V C            +GP   P VT+ D
Sbjct:   18 KSYRRKSKFPPGPPNLPIVGTLPYMNGIGSNALTDPK--FGKYGDLYSLFIGNIHLVVINNYQLAKDLFAREDVSYRRETWWTLNVRGDGHPLGIINTSGHVWKEQRRFAVRNLKDFGFGKNTLDAVIQNEARFTIEDIIKESKNNNGVLRMESTFNVGIINILWQIIAGYRFDKDNEKTKEMMGHLH-EVYSEGYSILHYIPAARFFIKRDKRMDDMLRTKEFFRSQIREHMKDY-----------DASNPRDFIDVYIKEMLDEDRENFHEEQLMTTCLDFFQAGGETSATTLLWSVLYISLYPEAQAKCVEEIEAVLGKEDP---SQEVYKDMVYCNATLMEIQRMASVGPLTLPHVTIKD 364          

HSP 3 Score: 58.151 bits (139), Expect = 7.723e-9
Identity = 34/121 (28.10%), Postives = 57/121 (47.11%), Query Frame = 0
Query:  823 PHLPYAANTLVDNGIAMWNKFPALREASTRRMASSVANYGKIVGSMMGSFPVVAVYDYNLIKEIFNKDEFCGRPGTFAHM-YRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSME 942
            P+LP        NGI            S          YG +    +G+  +V + +Y L K++F +++   R  T+  +  R  G   G++   GH WK  RRF+++NL+D GFGK +++
Sbjct:   31 PNLPIVGTLPYMNGIG-----------SNALTDPKFGKYGDLYSLFIGNIHLVVINNYQLAKDLFAREDVSYRRETWWTLNVRGDGHPLGIINTSGHVWKEQRRFAVRNLKDFGFGKNTLD 140          
BLAST of probable cytochrome p450 303a1 vs. L. salmonis genes
Match: EMLSAG00000005163 (supercontig:LSalAtl2s:LSalAtl2s272:555567:557147:-1 gene:EMLSAG00000005163 transcript:EMLSAT00000005163 description:"augustus_masked-LSalAtl2s272-processed-gene-5.4")

HSP 1 Score: 226.483 bits (576), Expect = 9.645e-65
Identity = 150/442 (33.94%), Postives = 225/442 (50.90%), Query Frame = 0
Query:  358 VYDYNLIKEIFNKDEFCGRPGTFAH---------MYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEAN---QICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGEKI--MLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSGDPDFNEN----------ALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMG------KEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLK-DTTIGSYQIPKGTFVIGPLYFFMHDPDYWN-EPESFKPDRFIK---DG--KFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHV 762
            + D++++K+I   D+   R    AH         +Y+ +G   G L++ G  WK  RRF L  L++ GFG+ SMED L  EA       ++     G  + + ++FN+ +LN+LW++VA  R++  DP L K V  +  ++    +   +  + P+LR I P   G    ++ + ++    + L       E         DFI  Y      S +    EN           L  T++D+F AGS+TT++TLSW VL+MV HPE Q+KVQ E+D  L        ++   +D+  LPYTEA I EIQR+  I P G+PH T   D  +G Y +PKG  V   L     +P Y+   P+ F PDRF++   DG  KF K+E L  F IGKR C GE LAR E+F  F  I+QR ++ +     P  D +I+G    P+ F++
Sbjct:   82 ISDFDILKKILKTDDLNYR---LAHDFSIDYTKKLYQGIGV-DGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYP---GIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSIDGEIPSTD-FISGITSIPKPFNI 515          

HSP 2 Score: 149.828 bits (377), Expect = 2.362e-38
Identity = 102/356 (28.65%), Postives = 174/356 (48.88%), Query Frame = 0
Query:    1 MSIAVLALVGLLLVWVVR--KYSKPRNFPPGPPW-VPFFGSMPFLPKIGSPLSLSWKEMTERY---GKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAH---------MYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEAN---QICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNI--SVITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQSGDPEFNEN----------ALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREID 326
            MS+A++  V L+L  ++   K+  P N+PP PP+ +P FG   +L   G      +  + +R+   G +   +       ++ D++++K+I   D+   R    AH         +Y+ +G   G L++ G  WK  RRF L  L++ GFG+ SMED L  EA       ++     G  + + ++FN+ +LN+LW++VA  R++  DP L K V  +  ++   N+  ++  + P+LR I P   G    +  + ++    + L       +         DFI  Y      S +    EN           L  T++D+F AGS+TT++TL+W VL+M+ HPE  +KVQ E+D
Sbjct:    1 MSVALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYR---LAHDFSIDYTKKLYQGIGV-DGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYP---GIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELD 349          
BLAST of probable cytochrome p450 303a1 vs. L. salmonis genes
Match: EMLSAG00000007758 (supercontig:LSalAtl2s:LSalAtl2s453:376415:377986:-1 gene:EMLSAG00000007758 transcript:EMLSAT00000007758 description:"maker-LSalAtl2s453-augustus-gene-3.8")

HSP 1 Score: 207.994 bits (528), Expect = 1.366e-58
Identity = 134/418 (32.06%), Postives = 215/418 (51.44%), Query Frame = 0
Query:  356 VTVYDYNLIKEIFNKDEFCGRPGTFAHMYR--MLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEAN---QICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLM-----KQRGGIETAAKEESDGDFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIKDGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILS-PETFHV 762
            V + D+ + K++FN+++  GR     H +     G   G++ NEG  W+S RRF+L NL++LGFGKKS+E  +  E +   ++ D+M       L +  +F+V ++N+LW ++A+ R++      +     +D     + I +   +    +  P+          SDE + Y+K  +     + +  +E  A +    DFI  Y    ++S DP F++  L+  + D F AGS+TT+ TL W +L M LH + Q K  +EI   +    P  +D   LP+T A I+E+QR + I P+ + H  L+   +G Y IPKGT VI   + F  DP  +  P  F P RF    K  K E+   +G GKR C+G+ LA+ +LF  F+ I+Q   I    ++P P  K  T  I S P+ F+V
Sbjct:   76 VVLNDFGMAKDLFNREDVSGRYQGQWHRFTKGYDGIAYGIINNEGPMWQSQRRFALTNLKNLGFGKKSLESVIYNEVHHLFEVIDEMIDGCSDVL-IHDIFHVPIINVLWSIIASHRFEYSQAREIVEKLGLDLK---KGIHINIFISIFANYVPLNE--------SDEAMLYMKRFISKNXDEHKNNLEVNAPK----DFIDFYLIEMLKSQDPYFSKKQLIVMLFDFFLAGSETTSTTLLWIILLMCLHNDIQLKCYQEISQNIGNNFPREEDMKMLPFTLATISEVQRYANIAPASLVHKVLQTIRVGKYLIPKGTSVIANYHKFHMDPKVFPHPHEFNPYRFY---KVPKPEQFVPYGFGKRICMGKSLAKKQLFYFFVMIVQNYIIRVPKDNPRPDPKKCTMGITSVPDPFYV 474          

HSP 2 Score: 147.902 bits (372), Expect = 5.345e-38
Identity = 97/317 (30.60%), Postives = 164/317 (51.74%), Query Frame = 0
Query:   27 PPGPPWVPFFGSMPFLPKIGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGR-QGTFAHMYRML-GKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLG--KPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNISVITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLM-KERGGIKTAAKEESDGDFITAYSKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVLMGKEPVLDD 338
            PPGP  +P  GS+PFL   GSP  L +  + E++G I    +     VV+ D+ + K++FN+++  GR QG +    +   G   G++ NEGP W+S RRF L NL++LGFGKKS+E  +  E + + + ++  +     + +  +F+V ++N+LW ++A+ R++       + V  +   L+ K I +   +    +  P+          SDE + Y+K  + K     K   +  +  DFI  Y    ++S DP F++  L+  + D F AGS+TT+ TL W +L M LH +   K  +EI   +    P  +D
Sbjct:   30 PPGPFSLPLVGSLPFLSSQGSPGILDFA-LGEKFGSIYTVDVIWSKIVVLNDFGMAKDLFNREDVSGRYQGQWHRFTKGYDGIAYGIINNEGPMWQSQRRFALTNLKNLGFGKKSLESVIYNEVHHLFEVIDEMIDGCSDVLIHDIFHVPIINVLWSIIASHRFEYSQAR--EIVEKLGLDLK-KGIHINIFISIFANYVPLNE--------SDEAMLYMKRFISKNXDEHKNNLEVNAPKDFIDFYLIEMLKSQDPYFSKKQLIVMLFDFFLAGSETTSTTLLWIILLMCLHNDIQLKCYQEISQNIGNNFPREED 334          

HSP 3 Score: 59.3066 bits (142), Expect = 2.738e-9
Identity = 29/71 (40.85%), Postives = 46/71 (64.79%), Query Frame = 0
Query:  874 VVAVYDYNLIKEIFNKDEFCGRPGTFAHMYR--MLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSME 942
            +V + D+ + K++FN+++  GR     H +     G   G++ NEG  W+S RRF+L NL++LGFGKKS+E
Sbjct:   75 IVVLNDFGMAKDLFNREDVSGRYQGQWHRFTKGYDGIAYGIINNEGPMWQSQRRFALTNLKNLGFGKKSLE 145          
BLAST of probable cytochrome p450 303a1 vs. L. salmonis genes
Match: EMLSAG00000006822 (supercontig:LSalAtl2s:LSalAtl2s383:99037:100275:-1 gene:EMLSAG00000006822 transcript:EMLSAT00000006822 description:"maker-LSalAtl2s383-augustus-gene-2.10")

HSP 1 Score: 201.83 bits (512), Expect = 2.052e-57
Identity = 126/381 (33.07%), Postives = 198/381 (51.97%), Query Frame = 0
Query:  388 GKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQG--KPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETA-AKEESDGDFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIKDGKFKK-DERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEH--PPPVDKYITGFILSPETFHV 762
            G   G+  +EG  W++ RRFSL  L++LGFGKKS+E  +  +   + + +E  +     L ++ +F + V+N+LWK+VA++ YD  +    K  +A++  V G        +   RH  P           +D+    ++ +M++     T    E S  DF+  Y     ++ D  F++  L +  ID+F AG++TT  TL WA+LYM L+   QEK   EI+ VL  + P  +D   LPYT A + EIQR     P+ +PH  LKD  IG Y +PKGT  +  L  F HDP+ +  P+ F PDR++    +K   ++   FG GKR C+G  LA+ EL+  F+ +++   I     H  P P +  ++    SP  F+V
Sbjct:   12 GIAYGIASSEGILWQNQRRFSLMKLKNLGFGKKSIEIIIYEQIINLFEMIETQKDSFNDLFIKDIFTIPVVNVLWKIVASKSYDWRNSGERKVXAAVN-EVFGAAYETNFFLEKFRHFLPY--------DIADKSTLKLRQIMEELIDEHTQNLDENSPNDFMDVYLIEMKKNVDSTFSKKQLASLCIDLFLAGAETTNTTLVWALLYMSLYEGVQEKCAEEINSVLGSRMPQEEDMKNLPYTIATLNEIQRLCNTAPASLPHKNLKDIKIGDYVVPKGTLFLANLIGFHHDPNIFENPQQFNPDRWL---HYKSCPQQFVPFGFGKRICMGVSLAKKELYYFFVMLIKMFIIRVPLYHKRPDPNETNVS-LTKSPSPFYV 379          

HSP 2 Score: 107.071 bits (266), Expect = 5.849e-25
Identity = 73/236 (30.93%), Postives = 118/236 (50.00%), Query Frame = 0
Query:  106 GKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLG--KPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNISVITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTA-AKEESDGDFITAYSKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVLMGKEPVLDD 338
            G   G+  +EG  W++ RRF+L  L++LGFGKKS+E  +  +   + + +E        L +K +F + V+N+LWK+VA++ YD  +    K  +A++    G        +   RH  P           +D+    ++ +M+E     T    E S  DF+  Y     ++ D  F++  L S  ID+F AG++TT  TL WA+LYM L+    EK   EI+ VL  + P  +D
Sbjct:   12 GIAYGIASSEGILWQNQRRFSLMKLKNLGFGKKSIEIIIYEQIINLFEMIETQKDSFNDLFIKDIFTIPVVNVLWKIVASKSYDWRNSGERKVXAAVNEVF-GAAYETNFFLEKFRHFLPYD--------IADKSTLKLRQIMEELIDEHTQNLDENSPNDFMDVYLIEMKKNVDSTFSKKQLASLCIDLFLAGAETTNTTLVWALLYMSLYEGVQEKCAEEINSVLGSRMPQEED 238          
BLAST of probable cytochrome p450 303a1 vs. L. salmonis genes
Match: EMLSAG00000007328 (supercontig:LSalAtl2s:LSalAtl2s412:195302:204629:-1 gene:EMLSAG00000007328 transcript:EMLSAT00000007328 description:"maker-LSalAtl2s412-snap-gene-2.12")

HSP 1 Score: 191.815 bits (486), Expect = 2.743e-53
Identity = 134/440 (30.45%), Postives = 222/440 (50.45%), Query Frame = 0
Query:  338 DKARYGKIVGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHM-YRMLGKRQ-GLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKM--EASQ--GKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQ-GEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDG---DFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKE-PVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFI-KDG-KFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITA--SPEHPPPVDKYITGFILSPETFHV 762
            D  ++G +    +GP P + +  + L KE++ K+E   R  T+  +  R  GK+  G++   G  W++ RRF+L+ LR+ GFGK+S++  +  EA    D +  E+S+  GK L   + FNV+++N+LW++VA +R+D ++    + +  ++   + G  ++         H  P+   ++   +  D+++  +K+  ++   I    K++ D    DFI  Y K   +SG+                                Y  +    Q+K + EI D L G E P  D  + LPYT A + E+QR + + P  +P  T KD  +  Y IP+GT +      F  DPD++ EP  FKP+RF+ +DG + KKDE    FG+G+R C+GE LAR++L I FI I+Q L+I+     E P P   ++ G    P  FHV
Sbjct:   43 DYRKFGDLYTLFIGPIPLIVINSFQLTKELYVKEEISSRRDTWWTINVRGDGKQSLGIINTGGMKWQTQRRFALRQLREFGFGKRSLDSVIQEEAQASIDTILQESSKNDGKVLMASN-FNVSIINVLWQIVAGQRFDPEESSTKERMEHLNEVFRVGYSVL---------HYLPIARYFIKKDERRDKMLS-LKEFFREM--IREHIKDQDDDNPRDFIDVYLKEVHKSGE-----------------------------KPSYFHIEQLIQKKCKEEIKDKLQGDEKPTQDCISELPYTHATLMEVQRLASVGPMSLPRYTTKDIDVNGYSIPEGTEIYSNFMAFHRDPDFFPEPLEFKPERFLTEDGSRVKKDEHFLPFGLGRRICMGESLARHQLIIFFIMILQNLNISVPIGQEKPDPESCFM-GITRIPTPFHV 439          

HSP 2 Score: 109.383 bits (272), Expect = 1.928e-25
Identity = 80/272 (29.41%), Postives = 140/272 (51.47%), Query Frame = 0
Query:   15 WVVRKYSKPRNFPPGPPWVPFFGSMPFLPKIGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHM-YRMLGKRQ-GLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEA----NQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNISVITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDG---DFITAYSKHAVQSGD 277
            WV R       FPPGP  +P  GS+PF+  IG+   L+      ++G +    +GP P +V+  + L KE++ K+E   R+ T+  +  R  GK+  G++   G  W++ RRF L+ LR+ GFGK+S++  +  EA    + I  +     GK L   + FNV+++N+LW++VA +R+D ++       S+    ++  N  V  V   + H  P+   ++      D+++  +K+  +E   I+   K++ D    DFI  Y K   +SG+
Sbjct:   11 WVAR-------FPPGPRNLPLVGSIPFMNGIGTQGCLNPD--YRKFGDLYTLFIGPIPLIVINSFQLTKELYVKEEISSRRDTWWTINVRGDGKQSLGIINTGGMKWQTQRRFALRQLREFGFGKRSLDSVIQEEAQASIDTILQESSKNDGKVLMASN-FNVSIINVLWQIVAGQRFDPEE-------SSTKERMEHLN-EVFRVGYSVLHYLPIARYFIKKDERRDKMLS-LKEFFREM--IREHIKDQDDDNPRDFIDVYLKEVHKSGE 261          

HSP 3 Score: 55.4546 bits (132), Expect = 4.288e-8
Identity = 27/84 (32.14%), Postives = 50/84 (59.52%), Query Frame = 0
Query:  861 YGKIVGSMMGSFPVVAVYDYNLIKEIFNKDEFCGRPGTFAHM-YRMLGKRQ-GLLFNEGHSWKSHRRFSLKNLRDLGFGKKSME 942
            +G +    +G  P++ +  + L KE++ K+E   R  T+  +  R  GK+  G++   G  W++ RRF+L+ LR+ GFGK+S++
Sbjct:   47 FGDLYTLFIGPIPLIVINSFQLTKELYVKEEISSRRDTWWTINVRGDGKQSLGIINTGGMKWQTQRRFALRQLREFGFGKRSLD 130          
BLAST of probable cytochrome p450 303a1 vs. L. salmonis genes
Match: EMLSAG00000004688 (supercontig:LSalAtl2s:LSalAtl2s245:535864:537578:-1 gene:EMLSAG00000004688 transcript:EMLSAT00000004688 description:"maker-LSalAtl2s245-augustus-gene-5.13")

HSP 1 Score: 192.586 bits (488), Expect = 7.764e-53
Identity = 123/445 (27.64%), Postives = 224/445 (50.34%), Query Frame = 0
Query:  335 VLDDKARYGKIVGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSL------KNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKP-LEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGEKIM-LITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSGDPD--FN----ENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKE--PVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFI-KDGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHV 762
            + D   ++GKIV   +G    V + DY  IK+ F+   F  RP T   + ++LG   G++ +EG  WK+ R++ L      K+ +      + +E  +S E       +E       + +  +FN AV N++  ++ +RR+   DP   + +   D   +   +   +T +P+L+ +  +       ++  +E++ +V++++ +          ++  D I +Y    VQ   PD  F     E  L   ++D+F+A  +TT  +L WA+++M+ +P+   KV+ E++ V+ G++  P L D  +LPYT A + EI R+S +VP G  H T ++     + +P+ + VI  ++    +P  W  PE F+P+RFI K+G   K E    FG+G+R CLG++LA  E F+ F  ++   D+  +PE   P  +   G  ++P  F V
Sbjct:   62 LFDYAMKFGKIVSLKMGGETVVVLSDYQTIKKAFSCKYFSARPKT--ELSQLLGG-YGIVNSEGPLWKTQRKYLLNQKLGMKHWKSGAGSLEQIESVVSREVQSFLYTLENDYSNTFVNLTPLFNCAVSNVICSIIXSRRFRYQDPKFQRFMFLFDEGFRLFTMTGAMTFLPFLKVLPGISDTCTKLRQNREEMIAFVREIISEH---RQELDPQNPKDLIDSY---LVQESTPDQFFEDYDPEQQLEQIILDLFSASVETTRTSLLWAIVFMLHNPKILSKVRDELNSVV-GEDNLPQLSDMIKLPYTRATLYEIMRRSSVVPMGTTHATDREVQFEGFVLPQNSHVIPLIHAVHMNPKNWENPEEFRPERFINKEGVLFKPEHFMPFGVGQRKCLGDRLAEQEFFLFFTSLVHVFDLGNNPEQTMPSLRGTAGVTVTPSEFSV 496          

HSP 2 Score: 110.153 bits (274), Expect = 2.427e-25
Identity = 81/340 (23.82%), Postives = 164/340 (48.24%), Query Frame = 0
Query:    5 VLALVGLLLVWVVRKYSKP-RNFPPGPPWVPFFGSMPFLPKIGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTL------KNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKP-LEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNIS-VITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQSGDPE--FN----ENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVL 329
            ++ +  L L+++++   K  ++ PPGP   P  G +P + K      L   +   ++GKIV   +G    VV+ DY  IK+ F+   F  R  T   + ++LG   G++ +EGP WK+ R++ L      K+ +      + +E  +  E       +E       + +  +FN AV N++  ++ +RR+   DP   + +   D   +   ++  +T +P+L+ +  +       +   +E++ +V++++ E    +     ++  D I +Y    VQ   P+  F     E  L   I+D+F+A  +TT  +L WA+++M+ +P+   KV+ E++ V+
Sbjct:   16 IVLIAFLTLLYILKHLKKSFKDLPPGPIGYPIVGIIPLIKK---EFHLLLFDYAMKFGKIVSLKMGGETVVVLSDYQTIKKAFSCKYFSARPKT--ELSQLLGG-YGIVNSEGPLWKTQRKYLLNQKLGMKHWKSGAGSLEQIESVVSREVQSFLYTLENDYSNTFVNLTPLFNCAVSNVICSIIXSRRFRYQDPKFQRFMFLFDEGFRLFTMTGAMTFLPFLKVLPGISDTCTKLRQNREEMIAFVREIISEH---RQELDPQNPKDLIDSY---LVQESTPDQFFEDYDPEQQLEQIILDLFSASVETTRTSLLWAIVFMLHNPKILSKVRDELNSVV 343          
BLAST of probable cytochrome p450 303a1 vs. L. salmonis genes
Match: EMLSAG00000005721 (supercontig:LSalAtl2s:LSalAtl2s309:682709:688189:1 gene:EMLSAG00000005721 transcript:EMLSAT00000005721 description:"maker-LSalAtl2s309-augustus-gene-6.40")

HSP 1 Score: 144.05 bits (362), Expect = 1.501e-36
Identity = 107/387 (27.65%), Postives = 174/387 (44.96%), Query Frame = 0
Query:  388 GKRQGL-LFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEV-RHV---FNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSGD-PDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKEPVLD-DKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIKD-GKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITAS----PEHPPPVDKYITGFILSPETFHV 762
            GK  G+ L   G  WK  RRFS    + L  G   +  N   E ++I   +      P  + R+V   F++ +LNI+W LVA RRY   DP + K    +   ++   I  +T++P+  +I P+R  +   +   +     +  ++++R   +    +E  G FI  + K  +   D P  +   L+    D F AG++T++ TL   +LYMVL+P  QE    EI D +     +   D+  LPYT+AV+ E++R +   P      + KD  +  +  P    V   L   +     W  P+ F P RF+ + G  +       FG G+R C+GE +     F+I   ++     +AS      H P  D++  G I   E F V
Sbjct:  123 GKDLGMGLGTGGERWKFLRRFSSSAFKSLSGGASGLNQNFDLEVSEIVAXLRGKAKSPDPIIRNVNIYFDIPILNIIWWLVAGRRYKYGDPAIQKQFDYLKVLLEEPFIAPLTIIPFALYIPPLRKIYNRIRNAMNSFRILLSKIVEERR--KDNFTDEKRG-FIDLFLKAQLDDKDNPYLSNEDLIMCCQDFFLAGAETSSKTLCTFILYMVLYPNIQENAASEIRDAIQKDTQIKSKDRHLLPYTDAVLMEVRRYATPFPITPFRCSNKDIRVNGFDXPANVPVQVNLNGVLRSKYCWKAPDIFNPSRFLNEKGAVEIPNAFMPFGFGRRRCIGEDIGNISNFLIVSNLLHNFKFSASFSKNKNHLPSNDRF-GGIIQGYEPFDV 505          

HSP 2 Score: 114.39 bits (285), Expect = 8.810e-27
Identity = 101/371 (27.22%), Postives = 165/371 (44.47%), Query Frame = 0
Query:    1 MSIAVLAL-VGLLLVWVVRKYSKPR--------NFPPGPPWVPFFGSMPFLPK--------IGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHMYRML------GKRQGL-LFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKP----LEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNISVITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQSGD-PEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVLMGKEPVLDDKARY 342
            MSI V  L +G+LL+   + Y   R        N PPGP   PF G++P L K        + SP+   + ++ + YG+      G   T+++   N I+E  N         +F    ++L      GK  G+ L   G  WK  RRF+    + L  G   +  N   E ++I   +      P      V   F++ +LNI+W LVA RRY   DP + K    +   L+   I+ +T++P+  +I P+R  +   +   +     +  +++ER   K    +E  G FI  + K  +   D P  +   L+    D F AG++T++ TL   +LYM+L+P   E    EI D +  K+  +  K R+
Sbjct:    1 MSILVSILAIGILLLCTYKSYXAIRINLMGPWSNAPPGPSTYPFLGAIPSLVKDFWGSDRALKSPIDF-FDKLHDIYGEDFRLHNGIEDTIILSSLNGIREFSNHP-----NASFRPFNKVLMDIYSDGKDLGMGLGTGGERWKFLRRFSSSAFKSLSGGASGLNQNFDLEVSEIVAXLRGKAKSPDPIIRNVNIYFDIPILNIIWWLVAGRRYKYGDPAIQKQFDYLKVLLEEPFIAPLTIIPFALYIPPLRKIYNRIRNAMNSFRILLSKIVEERR--KDNFTDEKRG-FIDLFLKAQLDDKDNPYLSNEDLIMCCQDFFLAGAETSSKTLCTFILYMVLYPNIQENAASEIRDAIQ-KDTQIKSKDRH 361          
BLAST of probable cytochrome p450 303a1 vs. L. salmonis genes
Match: EMLSAG00000012088 (supercontig:LSalAtl2s:LSalAtl2s865:171159:172708:-1 gene:EMLSAG00000012088 transcript:EMLSAT00000012088 description:"maker-LSalAtl2s865-snap-gene-0.12")

HSP 1 Score: 88.1965 bits (217), Expect = 2.209e-18
Identity = 103/407 (25.31%), Postives = 180/407 (44.23%), Query Frame = 0
Query:  351 GPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQG----LLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKME--ASQGKPLEVRHVFNVAVLNIL----WKLVANRRYDLDDPMLLKCVSAIDASVQGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSG-DPD--FNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPH--VTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIKDGKFK-KDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPE 741
            G  P++T  + ++IK+I  K         F H +R + K +     L  ++G  WK  R+  +  +   G  K+ ME  +S  ANQ    +E  +S+GK ++++  F    L+I+    + +  N   + D  +L      ++ S   + ++   L+        +      + K +DEL+     +++ R       K     DF+    +   +S  DP+   N+  + A  I  F AG  TT+ TL      +  HPE QEK+ +EI    +  E    D +   YT AVI E  R   + P    H  V  KDT +    I KGT +  P+Y   ++P+++  P  FKP+RF ++   +        FG G R C+  + A  E  +I  +++++ +I  + E
Sbjct:   86 GSLPTLTTMNPSIIKQITIKQ--------FNHFHRTMHKIKDKNLLLTLSDGSLWKLLRK-DITPVFTSGKLKEMMEP-VSDIANQFVAYIETQSSEGKSIKIQDKFQGLTLDIINACAYGIKTNSSEEPDHELLRHSKMLLNDSFITKNVITSVLILLFNSFPGMFKYVDMFGKANDELIKIANSIIETRESHNIEKK-----DFLNVLVQMRKKSHEDPNTLLNDEIITAQAIIFFIAGYSTTSTTLCCLTYMLATHPEIQEKLYKEI----VSSED--KDFSEHSYTSAVIKETLR---MYPPVALHLRVCAKDTEVEGIPIKKGTIIEMPIYASHYNPEFFPNPNEFKPERFFQENNLEIIPNTYRPFGNGNRSCIAYRFAMMEXQLILEKLVKKFEILPTHE 468          
BLAST of probable cytochrome p450 303a1 vs. L. salmonis genes
Match: EMLSAG00000005269 (supercontig:LSalAtl2s:LSalAtl2s281:237457:238966:1 gene:EMLSAG00000005269 transcript:EMLSAT00000005269 description:"maker-LSalAtl2s281-snap-gene-2.7")

HSP 1 Score: 87.4261 bits (215), Expect = 3.693e-18
Identity = 96/400 (24.00%), Postives = 172/400 (43.00%), Query Frame = 0
Query:  351 GPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKME--ASQGKPLEVRHVFNVAVLNIL----WKLVANRRYDLDDPMLLKCVSAIDASVQGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHV--TLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIKDGKFK-KDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPE 741
            G  PS+T  + ++IK++  K         F H +++  K   L  + G  WK  R+  +  +   G  K+ ME  +S  ANQ    +E  +S+GK ++++H F    L+I+    + +  N   + D  +L      ++ S   + ++   L+        +      + K +DEL+     ++K R   ET   E+ D                        +  ++ M      TT+ TL      +  HPE QEK+ +EI   +  ++    D +   YT AVI E  R   + P    H+   +KDT +    I  GT V  P+Y   ++P+++  P  FKP+RF ++   +        FG G R C+  + A  EL +I  +++++ +I  + E
Sbjct:   73 GSLPSLTTINPSIIKQVTIKQ--------FNHFHKVQDKNLLLSLSGGSLWKLLRK-DMTPVFTSGKLKEMMEP-VSEIANQFVAYIETQSSEGKSIKIKHKFQGLTLDIINACAYGIKTNSSEEPDHELLRHSKMLLNDSFIAKNVITSVLILLFNSFPGMFKYVDIFGKANDELIKIANSIIKTR---ETHNIEKKD-----------------------FLNVLVQMRKKSYSTTSMTLCCLTYILATHPEIQEKLYKEI---VSSQD---KDFSEHSYTSAVIKETLR---MYPPVTLHLRACVKDTEVEGILIKNGTIVEMPIYASHYNPEFFPTPNEFKPERFFQENNLEIIPNTYRPFGDGNRSCIAYRFAMMELQLILEKLVKKFEILPTHE 427          
BLAST of probable cytochrome p450 303a1 vs. L. salmonis genes
Match: EMLSAG00000009405 (supercontig:LSalAtl2s:LSalAtl2s5:994028:996076:1 gene:EMLSAG00000009405 transcript:EMLSAT00000009405 description:"augustus_masked-LSalAtl2s5-processed-gene-10.0")

HSP 1 Score: 85.8853 bits (211), Expect = 1.084e-17
Identity = 94/407 (23.10%), Postives = 182/407 (44.72%), Query Frame = 0
Query:  351 GPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICD-KMEASQGKPLEVRHVFNVAVLNIL----WKLVANRRYDLDDPMLLKCVSAIDASVQGEK------IMLITLMP-WLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDG-DFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPH--VTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIKDGKFK-KDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPE 741
            G  P+++  D  +IK++  K +F     TF    +   K + L  + G  WK  R+  L  +   G  K  ME  L    + +   + + + GK ++++  F+   L+++    + +  N   D D  +L      ++ +V  +       I+L+ L P  +++I    + +       +EL+     ++  R   ET   ++ D  + +    K+  +  +   N   + A  +  F AG  TT+++L   +  +  +PE Q+++ +EI   L  ++   D+ +   YT AVI E  R   + P    H  V   DT +    I  GT +  P+Y   + P+++  PE FKP+RF K+   +   +    FG G R C+  + A  EL I+  +++++ +I  + E
Sbjct:   73 GSIPTISTIDPKIIKQVTIK-QFNNFHMTFTENVK--DKNKSLDISHGPLWKLLRK-ELTPVFTSGKLKGMMEPLLEITNDFLFHIESQTTSGKSIKIKQKFHGLTLDVINSCAYGIKTNSSQDSDHELLKHAKKLLEDAVVTKNLPTSMFILLLNLFPGMIKYIDIFGNAY-------EELIKIANSIIANR---ETENIKKKDFINVLVEMRKNNNECPNELLNNEIITAQAVIFFVAGYVTTSHSLCCLIYVLATNPEIQDQLYQEI---LSSEDQGFDEHS---YTSAVIKEALR---LYPPATMHTRVCTHDTEVEGIFIKNGTIIEMPIYASHYYPEFFPNPEEFKPERFFKENNSEIIPDTFRPFGDGNRICIAYRFAMMELQIVIEKLVKKFEIIPTHE 456          
BLAST of probable cytochrome p450 303a1 vs. SwissProt
Match: gi|122142141|sp|Q0IIF9.1|CP2U1_BOVIN (RecName: Full=Cytochrome P450 2U1)

HSP 1 Score: 238.81 bits (608), Expect = 1.349e-67
Identity = 144/448 (32.14%), Postives = 238/448 (53.12%), Query Frame = 0
Query:  331 GKEPVLDDKAR-YGKIVGCMLGPFPSVTVYDYNLIKE--IFNKDEFCGRPGTFAHMYRMLGKRQGLLF-NEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQ---GEKIMLITLMPWLRHI--APVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQ----SGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVL-MGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIKD-GKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHVV 763
            G + +L D  R YG I   ++G +  V + D++ ++E  +   + F  RP     +  ++ K +G++F + G  W+  R+FS   LR  G GK S+E  +  E   + ++M+     P     + N AV NI+  L   RR+D  +    + ++ +  +++     +++L+ +  WL ++   P +      ++   +L  ++K ++K       +   E+  DFI  Y  H  +    + +  F+E+ L   + D+F AG+DTT N+L W +LYM LHP  QEK+  EI  V+   + P L DKA++PYTEA I E+QR S +VP  IPH+T + T +  + IPKGT ++  L+    DP  W +P  F PDRF+ D G+  K E    FGIGKR C+GEQLA+ ELF++F+ +MQ       P+   P+     G  L+P  F+++
Sbjct:  102 GVQLLLADLGRVYGNIFSFLIGHYLVVVLNDFHSVREALVQQAEVFSDRPR--VPLTSIMTKGKGIVFAHYGPVWRQQRKFSHSTLRHFGLGKLSLEPKIIEEFRYVKEEMQKHGDAPFNPFPIVNNAVSNIICSLCFGRRFDYTNSEFKQMLNFMSRALEVCLNTQLLLVNICSWLYYLPFGPFKE----LRQIEKDLTLFLKKIIKDH---RESLDVENPQDFIDMYLLHVEEEKKNNSNSGFDEDYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLHPNIQEKIHEEIARVIGADRAPSLTDKAQMPYTEATIMEVQRLSTVVPLSIPHMTSEKTVLQGFTIPKGTIILPNLWSVHRDPAIWEKPNDFYPDRFLDDQGQLIKKETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSFTFVL-PKDSKPILTGKYGLTLAPHPFNII 539          

HSP 2 Score: 122.094 bits (305), Expect = 1.064e-27
Identity = 103/420 (24.52%), Postives = 181/420 (43.10%), Query Frame = 0
Query:   24 RNFPPGP-PWVPFFGSMPF--LPKI-------------------GSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHMYRMLGKRQGLLF-NEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQ---GKNISVITVMPWLRHI--APVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQ----SGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVL-MGKEPVLDDKARYGKIVGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEG-----HSWKSHR 405
            R  PPGP PW P  G+  F  LP+                    G  + L   ++   YG I   ++G +  VV+ D++ ++E   +            +  ++ K +G++F + GP W+  R+F+   LR  G GK S+E  +  E   + ++M+     P     + N AV NI+  L   RR+D  +    + ++ +  +L+      + ++ +  WL ++   P +      +    +L  ++K ++K+    + +   E+  DFI  Y  H  +    + +  F+E+ L   I D+F AG+DTT N+L W +LYM LHP   EK+  EI  V+   + P L DKA+          P+   T+ +   +  +         P +  HM       QG    +G     + W  HR
Sbjct:   57 RGIPPGPAPW-PVVGNFGFVLLPRFLRRKSWPYRRARNGGMNASGQGVQLLLADLGRVYGNIFSFLIGHYLVVVLNDFHSVREALVQQAEVFSDRPRVPLTSIMTKGKGIVFAHYGPVWRQQRKFSHSTLRHFGLGKLSLEPKIIEEFRYVKEEMQKHGDAPFNPFPIVNNAVSNIICSLCFGRRFDYTNSEFKQMLNFMSRALEVCLNTQLLLVNICSWLYYLPFGPFKE----LRQIEKDLTLFLKKIIKDH---RESLDVENPQDFIDMYLLHVEEEKKNNSNSGFDEDYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLHPNIQEKIHEEIARVIGADRAPSLTDKAQM---------PYTEATIMEVQRLSTVV--------PLSIPHMTSEKTVLQGFTIPKGTIILPNLWSVHR 451          
BLAST of probable cytochrome p450 303a1 vs. SwissProt
Match: gi|10719967|sp|Q9QYG5.1|CP2DK_MESAU (RecName: Full=Cytochrome P450 2D20; AltName: Full=CYPIID20)

HSP 1 Score: 236.498 bits (602), Expect = 3.666e-67
Identity = 142/435 (32.64%), Postives = 219/435 (50.34%), Query Frame = 0
Query:  339 KARYGKIVGCMLGPFPSVTVYDYNLIKEIFNK--DEFCGRPGT--FAHM-YRMLGKRQGLLFNE-GHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASV---QGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVL-MGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFI-KDGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHV 762
            + RYG +    +   P V +     ++E+     ++   RP    F H+ YR   K QG++F   G  W+  RRFS+  +RD G GKKS+E  ++ EA  +CD      G P     + N +V N++  L+   R+D +DP   K +  +  S     G    ++  +P L  I  +     A+ K +  +    K L++ +   + A       D   A  + A    +  FN+  L   V D+F AG  TT+ TLSWA+L M+LHP+ Q +VQ+EIDDV+   + P + D+AR+PYT AVI E+QR   I P  +PH+T +D  +  + IPKGT +I  L   + D   W +P  F P+ F+   G+F K E    F  G+R CLGE LAR ELF+ F  ++QR   +     P P D+ +    ++P  + +
Sbjct:   65 QQRYGDVFSLQMAWKPVVVINGLKAVREVLVNCGEDTADRPPVPIFNHLGYR--PKSQGVVFARYGPQWREQRRFSVSTMRDFGVGKKSLEQWVTEEAGHLCDAFTQEAGHPFNPITLLNKSVCNVISSLIYAHRFDYEDPFFNKLLKTLQESFGEDSGFIAEVLNAVPVLLRIPGLPGK--AFPKLTAFMDSLYKMLIEHKTTWDPAQPPRGLTDAFLAEVEKAKGRPESSFNDENLHVVVADLFIAGMVTTSTTLSWALLLMILHPDVQSRVQQEIDDVIGQVRRPEMADQARMPYTNAVIHEVQRFGDIAPVNVPHMTSRDVEVQGFLIPKGTTLIPNLSSVLKDETVWEKPLHFHPEHFLDAQGRFVKQEAFMPFSAGRRACLGEPLARMELFLFFTCLLQRFSFSVPAGQPRPSDQGVFALPVTPTPYEL 495          

HSP 2 Score: 134.035 bits (336), Expect = 1.039e-31
Identity = 90/306 (29.41%), Postives = 142/306 (46.41%), Query Frame = 0
Query:   49 LSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGT-------FAHM-YRMLGKRQGLLFNE-GPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASL---QGKNISVITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVL-MGKEPVLDDKAR 341
            +  S  +  +RYG +    +   P VV+     ++E+      CG           F H+ YR   K QG++F   GP W+  RRF++  +RD G GKKS+E  +  EA  +CD      G P     + N +V N++  L+   R+D +DP   K +  +  S     G    V+  +P L  I  +     A+   +  +    K L++ +     A       D   A  + A    +  FN+  L   + D+F AG  TT+ TL+WA+L MILHP+   +VQ+EIDDV+   + P + D+AR
Sbjct:   57 MPYSLYKFQQRYGDVFSLQMAWKPVVVINGLKAVREVLVN---CGEDTADRPPVPIFNHLGYR--PKSQGVVFARYGPQWREQRRFSVSTMRDFGVGKKSLEQWVTEEAGHLCDAFTQEAGHPFNPITLLNKSVCNVISSLIYAHRFDYEDPFFNKLLKTLQESFGEDSGFIAEVLNAVPVLLRIPGLPGK--AFPKLTAFMDSLYKMLIEHKTTWDPAQPPRGLTDAFLAEVEKAKGRPESSFNDENLHVVVADLFIAGMVTTSTTLSWALLLMILHPDVQSRVQQEIDDVIGQVRRPEMADQAR 355          
BLAST of probable cytochrome p450 303a1 vs. SwissProt
Match: gi|3123191|sp|P04167.2|CP2B2_RAT (RecName: Full=Cytochrome P450 2B2; AltName: Full=CYPIIB2; AltName: Full=Cytochrome P450 PB4; AltName: Full=Cytochrome P450E)

HSP 1 Score: 234.572 bits (597), Expect = 1.302e-66
Identity = 146/444 (32.88%), Postives = 229/444 (51.58%), Query Frame = 0
Query:  339 KARYGKIVGCMLGPFPSVTVYDYNLIKE--IFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGEKIMLITLMPWLRHIAPVRSGWVAY--------KKFSDELVGYVKDLM-KQRGGIETAAKEESDGDFITAY---SKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMG-KEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFI-KDGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYIT----GFILSPETFHV 762
            + +YG +    LGP P V +   + IKE  +   ++F GR GT A +   + K  G++F  G  WK+ RRFSL  +RD G GK+S+E+ +  EA  + +++  SQG PL+   +F     NI+  +V   R+D  D   L+ +     +          +  +        SG++ Y         K   E++ Y+  ++ K R  ++ +A      DFI  Y    +    +   +F+   LM +++ +F AG++T + TL +  L M+ +P   EKVQ+EID V+   + P LDD+ ++PYT+AVI EIQR + + P G+PH   KDT    Y +PK T V   L   +HDP Y++ P++F P+ F+  DG  KK E    F  GKR CLGE +ARNELF+ F  I+Q   +++   H  P D  +T    G    P T+ +
Sbjct:   59 REKYGDVFTVHLGPRPVVMLCGTDTIKEALVGQAEDFSGR-GTIA-VIEPIFKEYGVIFANGERWKALRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQGAPLDPTFLFQCITANIICSIVFGERFDYTDRQFLRLLELFYRTFSLLSSFSSQVFEFF-------SGFLKYFPGAHRQISKNLQEILDYIGHIVEKHRATLDPSAPR----DFIDTYLLRMEKEKSNHHTEFHHENLMISLLSLFFAGTETGSTTLRYGFLLMLKYPHVTEKVQKEIDQVIGSHRPPSLDDRTKMPYTDAVIHEIQRFADLAPIGLPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFDHPDTFNPEHFLDADGTLKKSEAFMPFSTGKRICLGEGIARNELFLFFTTILQNFSVSS---HLAPKDIDLTPKESGIAKIPPTYQI 486          

HSP 2 Score: 127.872 bits (320), Expect = 9.194e-30
Identity = 86/300 (28.67%), Postives = 150/300 (50.00%), Query Frame = 0
Query:   52 SWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKE--IFNKDEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNISVITVMPWLRHIAPVRSGWVAYKWFS---DELVGYVKDLM-KERGGIKTAAKEESDGDFITAY---SKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVLMG-KEPVLDDKAR 341
            S+ ++ E+YG +    LGP P V++   + IKE  +   ++F GR GT A +   + K  G++F  G  WK+ RRF+L  +RD G GK+S+E+ +  EA  + +++  + G PL+   +F     NI+  +V   R+D  D   L+ +     +    +     V  +         G  A++  S    E++ Y+  ++ K R  +  +A      DFI  Y    +    +   EF+   LM +++ +F AG++T + TL +  L M+ +P   EKVQ+EID V+   + P LDD+ +
Sbjct:   54 SFMQLREKYGDVFTVHLGPRPVVMLCGTDTIKEALVGQAEDFSGR-GTIA-VIEPIFKEYGVIFANGERWKALRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQGAPLDPTFLFQCITANIICSIVFGERFDYTDRQFLRLLELFYRTFSLLSSFSSQVFEFFSGFLKYFPG--AHRQISKNLQEILDYIGHIVEKHRATLDPSAPR----DFIDTYLLRMEKEKSNHHTEFHHENLMISLLSLFFAGTETGSTTLRYGFLLMLKYPHVTEKVQKEIDQVIGSHRPPSLDDRTK 345          

HSP 3 Score: 57.7658 bits (138), Expect = 3.060e-7
Identity = 38/108 (35.19%), Postives = 55/108 (50.93%), Query Frame = 0
Query:  838 AMWNKFPALREASTRRMASSVANYGKIVGSMMGSFPVVAVYDYNLIKE--IFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMED 943
             + N F  LRE            YG +    +G  PVV +   + IKE  +   ++F GR GT A +   + K  G++F  G  WK+ RRFSL  +RD G GK+S+E+
Sbjct:   50 GLLNSFMQLRE-----------KYGDVFTVHLGPRPVVMLCGTDTIKEALVGQAEDFSGR-GTIA-VIEPIFKEYGVIFANGERWKALRRFSLATMRDFGMGKRSVEE 144          
BLAST of probable cytochrome p450 303a1 vs. SwissProt
Match: gi|3915646|sp|P12938.2|CP2D3_RAT (RecName: Full=Cytochrome P450 2D3; AltName: Full=CYPIID3; AltName: Full=Cytochrome P450-DB3; AltName: Full=Debrisoquine 4-hydroxylase)

HSP 1 Score: 234.187 bits (596), Expect = 2.520e-66
Identity = 147/437 (33.64%), Postives = 233/437 (53.32%), Query Frame = 0
Query:  339 KARYGKIVGCMLGPFPSVTVYDYNLIKEIFNK--DEFCGRP--GTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGEKIMLITLMPWLRHIAPV--RSGWVAYKKFSDE--LVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQS-GDPD--FNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVL-MGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFI-KDGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHV 762
            + RYG +    +G  P V +     ++E+     ++   RP    F H+      +  +L   G  W+  RRFS+  LR+ G GKKS+E  ++ EA+ +CD + A  G+PL+   + N AV N++  L+  RR+D  DP  +K +  +  S+ GE+     L P + ++ PV  R   +A K F  +   +  V +L+ +    +T   ++   D   A+     ++ G+P+  FN+  L   V D+F AG  TT+ TL+WA+L M+LHP+ Q +VQ+EID+V+   + P + D+A +P+T AVI E+QR + IVP  +PH T +D  +  + IPKGT +I  L   + D   W +P  F P+ F+   G F K E    F  G+R CLGE LAR ELF+ F  ++QR   +     P P D  +  F+LSP  + +
Sbjct:   65 QNRYGDVFSLQMGWKPVVVINGLKAVQELLVTCGEDTADRPEMPIFQHIGYGHKAKGVVLAPYGPEWREQRRFSVSTLRNFGVGKKSLEQWVTDEASHLCDALTAEAGRPLDPYTLLNKAVCNVIASLIYARRFDYGDPDFIKVLKILKESM-GEQ---TGLFPEVLNMFPVLLRIPGLADKVFPGQKTFLTMVDNLVTEHK--KTWDPDQPPRDLTDAFLAEIEKAKGNPESSFNDANLRLVVNDLFGAGMVTTSITLTWALLLMILHPDVQCRVQQEIDEVIGQVRHPEMADQAHMPFTNAVIHEVQRFADIVPMNLPHKTSRDIEVQGFLIPKGTTLIPNLSSVLKDETVWEKPLRFHPEHFLDAQGNFVKHEAFMPFSAGRRACLGEPLARMELFLFFTCLLQRFSFSVPTGQPRPSDYGVFAFLLSPSPYQL 495          

HSP 2 Score: 143.665 bits (361), Expect = 6.245e-35
Identity = 128/481 (26.61%), Postives = 215/481 (44.70%), Query Frame = 0
Query:    3 IAVLALVGLLLVWVVRKYSK-PRNFPPGP-PWVPFFGSMPFLPKIGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGT-------FAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASL---QGKNISVITVMPWLRHIAPVRSGWVAYKWFSDE--LVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQS-GDPE--FNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVL-MGKEPVLDDKARYGKIVGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHS--------------WKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVF 451
            +A+  ++ +LLV ++ +  +    +PPGP PW P  G++  +     P S+   ++  RYG +    +G  P VV+     ++E+      CG           F H+      +  +L   GP W+  RRF++  LR+ G GKKS+E  +  EA+ +CD + A  G+PL+   + N AV N++  L+  RR+D  DP  +K +  +  S+    G    V+ + P L     +R   +A K F  +   +  V +L+ E    KT   ++   D   A+     ++ G+PE  FN+  L   + D+F AG  TT+ TL WA+L MILHP+   +VQ+EID+V+   + P + D+A           PF +  +++     +I         P    H      + QG L  +G +              W+   RF  ++  D        E  + F A +      A  G+PL    +F
Sbjct:   12 MAIFTVIFILLVDLMHRRQRWTSRYPPGPVPW-PVLGNLLQVDLCNMPYSMY--KLQNRYGDVFSLQMGWKPVVVINGLKAVQELLVT---CGEDTADRPEMPIFQHIGYGHKAKGVVLAPYGPEWREQRRFSVSTLRNFGVGKKSLEQWVTDEASHLCDALTAEAGRPLDPYTLLNKAVCNVIASLIYARRFDYGDPDFIKVLKILKESMGEQTGLFPEVLNMFPVL-----LRIPGLADKVFPGQKTFLTMVDNLVTEHK--KTWDPDQPPRDLTDAFLAEIEKAKGNPESSFNDANLRLVVNDLFGAGMVTTSITLTWALLLMILHPDVQCRVQQEIDEVIGQVRHPEMADQAHM---------PFTNAVIHEVQRFADIV--------PMNLPHKTSRDIEVQGFLIPKGTTLIPNLSSVLKDETVWEKPLRFHPEHFLDAQGNFVKHEAFMPFSAGR-----RACLGEPLARMELF 457          
BLAST of probable cytochrome p450 303a1 vs. SwissProt
Match: gi|3913320|sp|O55071.1|CP2BJ_MOUSE (RecName: Full=Cytochrome P450 2B19; AltName: Full=CYPIIB19)

HSP 1 Score: 233.032 bits (593), Expect = 5.677e-66
Identity = 145/420 (34.52%), Postives = 228/420 (54.29%), Query Frame = 0
Query:  339 KARYGKIVGCMLGPFPSVTVYDYNLIKE-IFNKDE-FCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGEKIMLITLMPWLRHIAPVRSGWVAYKKFS---DELVGYV-KDLMKQRGGIETAAKEESDGDFITAY---SKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMG-KEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFI-KDGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVD 747
            + +YG +    LGP P V +   + I+E + N+ E F GR GT A +  ++ +  G++F+ G  WK+ RRFSL  +RD G GK+S+E+ +  EA  + ++++  +G PL     F   V NI+  +V   R+D  D   L  ++ I  +      +   +      I     G  A+++ S    E++ Y+   + K R  ++ +A      DFI  Y    +    +   +F+   L+ +V+ +F AG++TT+ TL ++ L M+ +P   EKVQ+EID V+   + P LDD+ ++PYT+AVI EIQR + + P G+PH   KDT    Y IPK T V   L   +HDP Y+ +P+SF P+ F+  +G  K +E    F  GKR CLGE +ARNELF+ F  I+Q   + ASP  P  +D
Sbjct:   60 QEKYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGR-GTVAVLDPIV-QGYGVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKGAPLNPTFYFQCIVANIICSIVFGERFDYKDHQFLHLLNLIYQTFSLMSSLSSQVFELFSAILKYFPG--AHRQISKNLQEILDYIGHSVEKHRATLDPSAPR----DFIDTYLLRMEKEKSNHHTEFHHQNLVISVLSLFFAGTETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFTDLAPIGLPHKVTKDTLFRGYLIPKNTEVYPILSSALHDPRYFEQPDSFNPEHFLDANGALKTNEAFMPFSTGKRICLGEGIARNELFLFFTTILQNFSL-ASPVAPENID 470          

HSP 2 Score: 145.591 bits (366), Expect = 1.227e-35
Identity = 108/357 (30.25%), Postives = 187/357 (52.38%), Query Frame = 0
Query:    1 MSIAVLALVGL---LLVWVVRKYSKPR---NFPPGPPWVPFFGSMPFLPKIGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKE-IFNKDE-FCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNISVITVMPWLRHIAPVRSGWVAYKWFS---DELVGYV-KDLMKERGGIKTAAKEESDGDFITAY---SKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVLMG-KEPVLDDKAR 341
            M  +VL L+ L    L+++V + S+P+   +FPPGP  +PF G++  + + G  L  S+ ++ E+YG +    LGP P V++   + I+E + N+ E F GR GT A +  ++ +  G++F+ G  WK+ RRF+L  +RD G GK+S+E+ +  EA  + ++++   G PL     F   V NI+  +V   R+D  D   L  ++ I  +    +     V      I     G  A++  S    E++ Y+   + K R  +  +A      DFI  Y    +    +   EF+   L+ +++ +F AG++TT+ TL ++ L M+ +P   EKVQ+EID V+   + P LDD+ +
Sbjct:    1 MEFSVLLLLALTTGFLIFLVSQ-SQPKTHGHFPPGPRPLPFLGNLLQMDRRG--LLSSFIQLQEKYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGR-GTVAVLDPIV-QGYGVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKGAPLNPTFYFQCIVANIICSIVFGERFDYKDHQFLHLLNLIYQTFSLMSSLSSQVFELFSAILKYFPG--AHRQISKNLQEILDYIGHSVEKHRATLDPSAPR----DFIDTYLLRMEKEKSNHHTEFHHQNLVISVLSLFFAGTETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTK 346          
BLAST of probable cytochrome p450 303a1 vs. SwissProt
Match: gi|81908683|sp|Q4V8D1.1|CP2U1_RAT (RecName: Full=Cytochrome P450 2U1)

HSP 1 Score: 233.417 bits (594), Expect = 9.361e-66
Identity = 148/449 (32.96%), Postives = 231/449 (51.45%), Query Frame = 0
Query:  330 MGKEPVLDDKAR-YGKIVGCMLGPFPSVTVYDYNLIKE--IFNKDEFCGRPGTFAHMYRMLGKRQGLLF-NEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQ---GEKIMLITLMPWLRHI--APVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSGD----PDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVL-MGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIKD-GKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHVV 763
            +G+   L   AR YG I    +G    V + D+  ++E  +   + F  RP     +  +L K +G++F + G  WK  RRFS   LR  G GK S+E  +  E   +  +M+     P     V + AV NI+  L   +R+D  +    K +  +   ++     ++ LI L PW  ++   P +      ++   ++  ++K+++K+    + +    +  DFI  Y  H  +  D     +F+E+ L   + D+F AG+DTT N+L W +LYM L+P  Q+KV  EI+ V+   + P L DKA++PYTEA I E+QR S +VP  IPH+T + T +  Y IPKGT V+  L+    DP  W +P+ F P RF+ D G+  K E    FGIGKR C+GEQLA+ ELF++F+ +MQ            P+     G  L+P  F+V 
Sbjct:   87 VGRHVYLARLARVYGNIFSFFIGHRLVVVLSDFQSVREALVQQAEVFSDRPRM--PLISILTKEKGIVFAHYGPIWKQQRRFSHSTLRHFGLGKLSLEPRIIEEFAYVKAEMQKHGEAPFSPFPVISNAVSNIICSLCFGQRFDYTNKEFKKVLDFMSRGLEICLHSQLFLINLCPWFYYLPFGPFKE----LRQIERDITCFLKNIIKEH---QESLDANNPQDFIDMYLLHTQEEKDKCKGTNFDEDYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPGVQKKVHEEIERVIGRDRAPSLTDKAQMPYTEATIMEVQRLSMVVPLAIPHMTSEKTVLQGYSIPKGTVVLPNLWSIHRDPVIWEKPDDFCPHRFLDDQGQLLKRETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSFTFALPEGSEKPIMTGRFGLTLAPHPFNVT 526          

HSP 2 Score: 116.701 bits (291), Expect = 6.212e-26
Identity = 93/356 (26.12%), Postives = 158/356 (44.38%), Query Frame = 0
Query:   15 WVVRKYSKPRNFPPGPPWVPFFGSMPFL--PK----------------IGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHMYRMLGKRQGLLF-NEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQ---GKNISVITVMPWLRHI--APVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQSGD----PEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVL-MGKEPVLDDKAR 341
            WV  +  +    PPGP   P  G+  +L  P+                +G  + L+   +   YG I    +G    VV+ D+  ++E   +            +  +L K +G++F + GP WK  RRF+   LR  G GK S+E  +  E   +  +M+     P     V + AV NI+  L   +R+D  +    K +  +   L+      + +I + PW  ++   P +      +    ++  ++K+++KE    + +    +  DFI  Y  H  +  D      F+E+ L   I D+F AG+DTT N+L W +LYM L+P   +KV  EI+ V+   + P L DKA+
Sbjct:   39 WVWLQRQRAGGIPPGPKPRPLVGNFGYLLLPRFLRLHFWLGSGSQTDTVGRHVYLA--RLARVYGNIFSFFIGHRLVVVLSDFQSVREALVQQAEVFSDRPRMPLISILTKEKGIVFAHYGPIWKQQRRFSHSTLRHFGLGKLSLEPRIIEEFAYVKAEMQKHGEAPFSPFPVISNAVSNIICSLCFGQRFDYTNKEFKKVLDFMSRGLEICLHSQLFLINLCPWFYYLPFGPFKE----LRQIERDITCFLKNIIKEH---QESLDANNPQDFIDMYLLHTQEEKDKCKGTNFDEDYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPGVQKKVHEEIERVIGRDRAPSLTDKAQ 385          
BLAST of probable cytochrome p450 303a1 vs. SwissProt
Match: gi|341940386|sp|P11714.2|CP2D9_MOUSE (RecName: Full=Cytochrome P450 2D9; AltName: Full=CYPIID9; AltName: Full=Cytochrome P450-16-alpha; AltName: Full=Cytochrome P450CA; AltName: Full=Testosterone 16-alpha hydroxylase)

HSP 1 Score: 232.646 bits (592), Expect = 1.078e-65
Identity = 134/434 (30.88%), Postives = 223/434 (51.38%), Query Frame = 0
Query:  339 KARYGKIVGCMLGPFPSVTVYDYNLIKEIFNK--DEFCGRPGT--FAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDAS---VQGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQ-RGGIETAAKEESDGDFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVL-MGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFI-KDGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHV 762
            + RYG +    +   P V +     +KE+     ++   RP    F ++    G +  +L   G  W+  RRFS+  LR+ G GKKS+ED ++ EAN +CD   A  G+P+    + N +  N++  L+  RR++ +DP L++ +  ++ S   V G    ++   P L  I  +    +  +K     +  + +L+ + R   +      +  D   A  + A  + +  FN+  L+  V D+F AG  TT+ TLSWA++ M+LHP+ Q +VQ+EID+V+   + P + D+A +PYT AVI E+QR   IVP  +P +T  D  +  + IPKGT ++  +   + D   W +P  F P+ F+   G F K E    F  G+R CLGE LAR ELF+ F  ++QR   +     P P +  + G +++P  + +
Sbjct:   65 QNRYGDVFSLQMAWKPMVVINGLKAMKEMLLTCGEDTADRPPVPIFEYLGVKPGSQGVVLAPYGPEWREQRRFSVSTLRNFGLGKKSLEDWVTKEANHLCDAFTAQAGQPINPNPMLNKSTCNVIASLIFARRFEYEDPFLIRMLKVLEQSLTEVSGLIPEVLNAFPILLRIPRLADKALQGQK---SFIAILDNLLTENRTTWDPVQAPRNLTDAFLAEIEKAKGNPESSFNDENLLMVVRDLFGAGMLTTSTTLSWALMLMILHPDVQRRVQQEIDEVIGQVRHPEMADQAHMPYTNAVIHEVQRFGDIVPVNLPRITSHDIEVQDFLIPKGTILLPNMSSMLKDESVWEKPLRFHPEHFLDAQGHFVKPEAFMPFSAGRRSCLGEALARMELFLFFTCLLQRFSFSVPDGQPQPSNSGVYGILVAPSPYQL 495          

HSP 2 Score: 146.747 bits (369), Expect = 5.920e-36
Identity = 108/385 (28.05%), Postives = 184/385 (47.79%), Query Frame = 0
Query:    3 IAVLALVGLLLVWVVRKYSK-PRNFPPGP-PWVPFFGSMPFLPKIGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGT---FAHMYRMLGKRQG----LLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASL---QGKNISVITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKE-RGGIKTAAKEESDGDFITAYSKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVL-MGKEPVLDDKA-------------RYGKIVGCMLGPFPSVTVYD 360
            +A+  ++ +LLV +  +  +    +PPGP PW P  G++  +     P SL   ++  RYG +    +   P VV+     +KE+      CG          ++  LG + G    +L   GP W+  RRF++  LR+ G GKKS+ED +  EAN +CD   A  G+P+    + N +  N++  L+  RR++ +DP L++ +  ++ SL    G    V+   P L  I  +    +  +      +  + +L+ E R          +  D   A  + A  + +  FN+  L+  + D+F AG  TT+ TL+WA++ MILHP+   +VQ+EID+V+   + P + D+A             R+G IV   L   P +T +D
Sbjct:   12 VAIFTVIFILLVDLTHQRQRWTSRYPPGPVPW-PVLGNLLQVDLGNMPYSL--YKLQNRYGDVFSLQMAWKPMVVINGLKAMKEMLLT---CGEDTADRPPVPIFEYLGVKPGSQGVVLAPYGPEWREQRRFSVSTLRNFGLGKKSLEDWVTKEANHLCDAFTAQAGQPINPNPMLNKSTCNVIASLIFARRFEYEDPFLIRMLKVLEQSLTEVSGLIPEVLNAFPILLRIPRLADKALQGQ---KSFIAILDNLLTENRTTWDPVQAPRNLTDAFLAEIEKAKGNPESSFNDENLLMVVRDLFGAGMLTTSTTLSWALMLMILHPDVQRRVQQEIDEVIGQVRHPEMADQAHMPYTNAVIHEVQRFGDIVPVNL---PRITSHD 384          
BLAST of probable cytochrome p450 303a1 vs. SwissProt
Match: gi|10719968|sp|Q9QYG6.1|CP2DR_MESAU (RecName: Full=Cytochrome P450 2D27; AltName: Full=CYPIID27)

HSP 1 Score: 230.335 bits (586), Expect = 5.426e-65
Identity = 141/433 (32.56%), Postives = 212/433 (48.96%), Query Frame = 0
Query:  339 KARYGKIVGCMLGPFPSVTVYDYNLIKEIFNK--DEFCGRPGTFAHMYRMLG-KRQGLLFNE-GHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPM---LLKCVSAIDASVQGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVL-MGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFI-KDGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHV 762
            + RYG +    +   P V +     ++E+     ++   RP      +   G   QG+ F   G  W+  RRF +  +RD G GKKS+E  ++ EA  +CD      G P     + N +V N++  L+   R+D +DP    LLK +        G    ++  +P L  I  +     A+ K +  +    K L++ +   + A       D   A  + A    +  FN+  L   V DMF AG  TT+ TLSWA+L M+LHP+ Q +VQ+EIDDV+   + P + D+AR+PYT AVI E+QR   I P  IPH+T  D  +  + IPKGT +I  L   + D   W +P  F P+ F+   G+F K E    F  G+R CLGE LAR ELF+ F  ++QR   +     P P D+ I    ++P  + +
Sbjct:   65 RQRYGDVFSLQMAWKPVVVINGLKAVREVLVNCGEDTADRPPVPIFNHVGFGHNSQGVAFARYGPQWREQRRFCVSTMRDFGVGKKSLEQWVTEEAGHLCDAFTQEAGHPFNPTTLLNKSVCNVISSLIYAHRFDYEDPFFNSLLKMLQESFGEDTGFIAEVLNAVPVLLRIPGLPGK--AFPKLTAFMDSLYKMLIEHKTTWDPAQPPRGLTDAFLAEVEKAKGRPESSFNDENLRMVVADMFIAGMVTTSTTLSWALLLMILHPDVQSRVQQEIDDVIGQVRRPEMADQARMPYTNAVIHEVQRFGDIAPVNIPHMTSHDVEVQGFLIPKGTTLIPNLSSVLKDETVWEKPLHFHPEHFLDAQGRFVKHEAFMPFSAGRRACLGEPLARMELFLFFTCLLQRFSFSVPAGQPRPSDQGIFALPVTPTPYEL 495          

HSP 2 Score: 127.487 bits (319), Expect = 1.491e-29
Identity = 97/361 (26.87%), Postives = 155/361 (42.94%), Query Frame = 0
Query:   49 LSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGT---FAHMYRMLG---KRQGLLFNE-GPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPM---LLKCVSAIDASLQGKNISVITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVL-MGKEPVLDDKARYGKIVGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEG 398
            +  S  +  +RYG +    +   P VV+     ++E+      CG          ++  +G     QG+ F   GP W+  RRF +  +RD G GKKS+E  +  EA  +CD      G P     + N +V N++  L+   R+D +DP    LLK +        G    V+  +P L  I  +     A+   +  +    K L++ +     A       D   A  + A    +  FN+  L   + DMF AG  TT+ TL+WA+L MILHP+   +VQ+EIDDV+   + P + D+AR          P+ +  +++     +I         P    HM     + QG L  +G
Sbjct:   57 MPYSLYKFRQRYGDVFSLQMAWKPVVVINGLKAVREVLVN---CGEDTADRPPVPIFNHVGFGHNSQGVAFARYGPQWREQRRFCVSTMRDFGVGKKSLEQWVTEEAGHLCDAFTQEAGHPFNPTTLLNKSVCNVISSLIYAHRFDYEDPFFNSLLKMLQESFGEDTGFIAEVLNAVPVLLRIPGLPGK--AFPKLTAFMDSLYKMLIEHKTTWDPAQPPRGLTDAFLAEVEKAKGRPESSFNDENLRMVVADMFIAGMVTTSTTLSWALLLMILHPDVQSRVQQEIDDVIGQVRRPEMADQARM---------PYTNAVIHEVQRFGDI--------APVNIPHMTSHDVEVQGFLIPKG 395          
BLAST of probable cytochrome p450 303a1 vs. SwissProt
Match: gi|3913341|sp|O54749.1|CP2J5_MOUSE (RecName: Full=Cytochrome P450 2J5; AltName: Full=Arachidonic acid epoxygenase; AltName: Full=CYPIIJ5)

HSP 1 Score: 230.335 bits (586), Expect = 7.199e-65
Identity = 150/442 (33.94%), Postives = 217/442 (49.10%), Query Frame = 0
Query:  341 RYGKIVGCMLGPFPSVTVYDYNLIKEIFNK--DEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQ---GEKIMLITLMPWLRHIAP-----VRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSGDPD----FNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKEPV-LDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIKDGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVD-----KYITGFILSPETFHV 762
            +YG +    LG  P V V    LIKE+F      F  R  T     R+ GK  GL+ + G +WK  RR +L  LR+ G GKKS+E+ +  E + + + +    G+P         AV NI+  +    R+D +D    + +  +D ++         L    P +    P     +   W   K F       V  ++K+    E     +   DFI A+        DPD    FNE  L++T +D+F  G++TT++TL WA+LYM  +PE QE VQ EID V+  K  V L D+  +PYT AVI E+QR   IVP         DT    + +PKGT ++  L     DP  W  PE F P+ F+++G+FKK E    F +GKR CLGEQLA++ELFI F  +MQ+          PP++     K+  G ILSP ++ +
Sbjct:   74 KYGNVFSLELGQSPVVVVSGLPLIKEMFTHLDQNFVNRFMTPVR-ERITGK-NGLVVSNGQTWKEQRRLALMALRNFGLGKKSLEERIQEETHHLVEAIREEGGQPFNPHLKLINAVSNIICSVTFGERFDYEDCQFQELLQLLDETMHLMGSSAGQLYNGFPCIMKYLPGPHQKIFRNWGKLKLF-------VSHIVKKH---EKDWNPDEPRDFIDAFLIEM--QKDPDRTTSFNEENLISTTLDLFLGGTETTSSTLRWALLYMSSYPEIQENVQAEIDRVIGHKRQVSLSDRESMPYTNAVIHEVQRMGNIVPLNSSREVTVDTKFNGFHLPKGTMILTNLTALHRDPKEWATPEVFNPEHFLENGQFKKRESFLPFSMGKRACLGEQLAKSELFIFFSALMQKFTFK------PPINEKLSLKFRMGLILSPASYRI 495          

HSP 2 Score: 141.739 bits (356), Expect = 2.676e-34
Identity = 105/347 (30.26%), Postives = 164/347 (47.26%), Query Frame = 0
Query:    1 MSIAVLALVGLLLVWVVRKYSKPRNFPPGPPWVPFFGSMPFLPKIGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNK--DEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNISVITV---MPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQSGD--PEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVLMGKEPV-LDDK 339
            +   VLA+V  L +  + +   P+N+PPGP  +PF G+  F         L  ++  ++YG +    LG  P VVV    LIKE+F      F  R  T     R+ GK  GL+ + G  WK  RR  L  LR+ G GKKS+E+ +  E + + + +    G+P         AV NI+  +    R+D +D    + +  +D ++     S   +    P +    P     +   W   +L  +V  ++K+    +     +   DFI A+     +  D    FNE  L+ST +D+F  G++TT++TL WA+LYM  +PE  E VQ EID V+  K  V L D+
Sbjct:   18 LKTLVLAVVTFLFLINILRSRHPKNYPPGPWRLPFVGN--FFQIDTKQTHLVLQQFVKKYGNVFSLELGQSPVVVVSGLPLIKEMFTHLDQNFVNRFMTPVR-ERITGK-NGLVVSNGQTWKEQRRLALMALRNFGLGKKSLEERIQEETHHLVEAIREEGGQPFNPHLKLINAVSNIICSVTFGERFDYEDCQFQELLQLLDETMHLMGSSAGQLYNGFPCIMKYLPGPHQKIFRNW--GKLKLFVSHIVKKH---EKDWNPDEPRDFIDAFLIEMQKDPDRTTSFNEENLISTTLDLFLGGTETTSSTLRWALLYMSSYPEIQENVQAEIDRVIGHKRQVSLSDR 355          

HSP 3 Score: 56.6102 bits (135), Expect = 6.156e-7
Identity = 35/88 (39.77%), Postives = 46/88 (52.27%), Query Frame = 0
Query:  858 VANYGKIVGSMMGSFPVVAVYDYNLIKEIFNK--DEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMED 943
            V  YG +    +G  PVV V    LIKE+F      F  R  T     R+ GK  GL+ + G +WK  RR +L  LR+ G GKKS+E+
Sbjct:   72 VKKYGNVFSLELGQSPVVVVSGLPLIKEMFTHLDQNFVNRFMTPVR-ERITGK-NGLVVSNGQTWKEQRRLALMALRNFGLGKKSLEE 157          
BLAST of probable cytochrome p450 303a1 vs. SwissProt
Match: gi|11386674|sp|Q9VW43.1|CP305_DROME (RecName: Full=Probable cytochrome P450 305a1; AltName: Full=CYPCCCVA1)

HSP 1 Score: 229.565 bits (584), Expect = 1.377e-64
Identity = 132/430 (30.70%), Postives = 222/430 (51.63%), Query Frame = 0
Query:  345 IVGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRY-DLDDPMLLKCVSAIDASVQGEKIM--LITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKH----AVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKE----PVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIKD-GKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHV 762
            +VG  LG    V    + ++KE+  ++ F GRP  F    R +G R+G+   +G  W  HR F++K +R++G+G+  ME ++  EA ++  ++E ++ +P+E       +VLN+LW L+A +R    +D  L + +  ++   +   I   L+   PWLRH+AP R+G+   ++ + EL G+  D +++           ++ D I AY +     +       FNE  L+ T++D F AGS TT+NT++ A++ + + P+ QEK+  ++   +        P L  +    Y +A I E+QR   I P   P   L  T +G Y IPK   ++  L     D ++W +P  F+P+RFI   GK  KDE    FG+G+R CLG+ LAR  +F   +RI+Q   +   P    P    + G  L+P+ + V
Sbjct:   70 LVGLKLGREYVVVALGHEMVKEVQLQEVFEGRPDNFFLRLRTMGTRKGITCTDGQLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVTWLAQSVLNVLWCLIAGKRIARQEDGTLRRLLDLMNRRSKLFDICGGLLAQFPWLRHVAPDRTGYNLIQQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGESSTFNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSRREAFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERFIDSAGKCFKDEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHFSVVL-PAGESPSMVLLPGITLTPKPYKV 498          

HSP 2 Score: 169.474 bits (428), Expect = 1.104e-43
Identity = 117/444 (26.35%), Postives = 208/444 (46.85%), Query Frame = 0
Query:    8 LVGLLLVWVVRKYSKPRNFPPGPPWVPFFGSMPFLPKIGSPLSLSWKEMTERYGK-----IVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRY-DLDDPMLLKCVSAIDASLQGKNI--SVITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKH----AVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVLMGKEPVLDDKARYGKIVGCMLGPFPSVT---VYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFS-LKNLRDLGFGKKSMEDNLSFEANQICD 435
            L+G ++  ++    +P+NFPPGP +VP+ G+     K  S +      + ER+ K     +VG  LG    VV   + ++KE+  ++ F GR   F    R +G R+G+   +G  W  HR F +K +R++G+G+  ME ++  EA ++  ++E T  +P+E       +VLN+LW L+A +R    +D  L + +  ++   +  +I   ++   PWLRH+AP R+G+   +  + EL G+  D ++E           ++ D I AY +     +       FNE  L+ TI+D F AGS TT+NT+  A++ + + P+  EK+  ++                   +       FP ++    +DY         D F      F H+  + G R+ L   +   +   +  + L +LR +   K+  +D L F   +  D
Sbjct:   11 LIGFVIYSLISSARRPKNFPPGPRFVPWLGNTLQFRKEASAVG-GQHILFERWAKDFRSDLVGLKLGREYVVVALGHEMVKEVQLQEVFEGRPDNFFLRLRTMGTRKGITCTDGQLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVTWLAQSVLNVLWCLIAGKRIARQEDGTLRRLLDLMNRRSKLFDICGGLLAQFPWLRHVAPDRTGYNLIQQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGESSTFNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVT----------------ASVAAASTDAFPHLSRREAFDY--------MDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERFID 429          

HSP 3 Score: 62.3882 bits (150), Expect = 9.041e-9
Identity = 27/81 (33.33%), Postives = 47/81 (58.02%), Query Frame = 0
Query:  864 IVGSMMGSFPVVAVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDN 944
            +VG  +G   VV    + ++KE+  ++ F GRP  F    R +G R+G+   +G  W  HR F++K +R++G+G+  ME +
Sbjct:   70 LVGLKLGREYVVVALGHEMVKEVQLQEVFEGRPDNFFLRLRTMGTRKGITCTDGQLWYEHRHFAMKQMRNVGYGRSQMEHH 150          
BLAST of probable cytochrome p450 303a1 vs. nr
Match: gi|675803047|gb|AIL94131.1| (cytochrome P450 CYP3037A1 [Tigriopus japonicus])

HSP 1 Score: 461.455 bits (1186), Expect = 9.303e-150
Identity = 206/424 (48.58%), Postives = 294/424 (69.34%), Query Frame = 0
Query:  339 KARYGKIVGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIKDGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHV 762
            K++YGKI+G M+G    + +YD++LIKE ++K+EFC RP +  H +RMLGK++G++ N+G+ WK HRRF+LK L+D GFG   +ED +  EAN ICD +      P +   VFNV +LNI+WK++ ++R+DL+DP L  CV AI+     +++ ++  MPW RH+ P  SGW  +K+F+  +    K ++ +        +E  D  FITAY + A ++GDP+FN+  L  T+ D+F A SDTTA+TLSW +LYM+LHPE Q+KVQ EIDD L G+EP L+D+ARL YT+A +AEIQR++ IVP  +PH   KD  +G Y IPK + VI  LY+ MHDP+YW   + F P RFI++GKF+KDER   FGIGKR CLG+ LARNELFI+F R+MQR +  ASP+HP P ++Y+   ++ P+ F++
Sbjct:   57 KSKYGKIMGMMIGDQHVIGIYDFDLIKEAYSKEEFCARPNSKLHDFRMLGKKRGIVMNDGYGWKVHRRFTLKTLKDFGFGNACVEDGILEEANHICDHIAKKNAAPFKAEDVFNVGILNIMWKILTHKRFDLEDPRLANCVRAINGQFSSDRVRIVLAMPWTRHLFPEMSGWNDWKRFAVTMQDMTKQILDEHEPCYGPNQEPLD--FITAYKEEAKRTGDPEFNDLDLQTTIADIFVASSDTTAHTLSWGLLYMILHPEIQKKVQNEIDDTLSGREPNLEDRARLVYTDATLAEIQRRANIVPGALPHRVTKDMMLGGYSIPKDSMVISSLYYVMHDPEYWKNADQFDPTRFIENGKFRKDERFVPFGIGKRICLGDTLARNELFIVFTRLMQRFNFEASPDHPFPKEEYLPSTVMGPKPFYL 478          

HSP 2 Score: 340.887 bits (873), Expect = 1.205e-103
Identity = 154/327 (47.09%), Postives = 217/327 (66.36%), Query Frame = 0
Query:   15 WVVRKYSKPRNFPPGPPWVPFFGSMPFLPKIGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNISVITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVLMGKEPVLDDKAR 341
            W +++Y +PRNFPPGPP +P  GS+PFLP+      + WK    +YGKI+G M+G    + +YD++LIKE ++K+EFC R  +  H +RMLGK++G++ N+G GWK HRRFTLK L+D GFG   +ED +  EAN ICD +      P + + VFNV +LNI+WK++ ++R+DL+DP L  CV AI+       + ++  MPW RH+ P  SGW  +K F+  +    K ++ E        +E    DFITAY + A ++GDPEFN+  L +TI D+F A SDTTA+TL+W +LYMILHPE  +KVQ EIDD L G+EP L+D+AR
Sbjct:   15 WFLKRYIRPRNFPPGPPSIPILGSLPFLPQEAMATGILWKHFKSKYGKIMGMMIGDQHVIGIYDFDLIKEAYSKEEFCARPNSKLHDFRMLGKKRGIVMNDGYGWKVHRRFTLKTLKDFGFGNACVEDGILEEANHICDHIAKKNAAPFKAEDVFNVGILNIMWKILTHKRFDLEDPRLANCVRAINGQFSSDRVRIVLAMPWTRHLFPEMSGWNDWKRFAVTMQDMTKQILDEHEPCYGPNQEPL--DFITAYKEEAKRTGDPEFNDLDLQTTIADIFVASSDTTAHTLSWGLLYMILHPEIQKKVQNEIDDTLSGREPNLEDRAR 339          

HSP 3 Score: 107.842 bits (268), Expect = 9.426e-21
Identity = 44/85 (51.76%), Postives = 65/85 (76.47%), Query Frame = 0
Query:  859 ANYGKIVGSMMGSFPVVAVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMED 943
            + YGKI+G M+G   V+ +YD++LIKE ++K+EFC RP +  H +RMLGK++G++ N+G+ WK HRRF+LK L+D GFG   +ED
Sbjct:   58 SKYGKIMGMMIGDQHVIGIYDFDLIKEAYSKEEFCARPNSKLHDFRMLGKKRGIVMNDGYGWKVHRRFTLKTLKDFGFGNACVED 142          
BLAST of probable cytochrome p450 303a1 vs. nr
Match: gi|820982932|gb|AKH03504.1| (cytochrome P450 3037B1 [Paracyclopina nana])

HSP 1 Score: 402.519 bits (1033), Expect = 4.128e-127
Identity = 201/428 (46.96%), Postives = 278/428 (64.95%), Query Frame = 0
Query:  342 YGKIVGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDG----DFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIK-DG-KFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHVV 763
            + KIVG  LG FP V +YD+ + KEIF++D+  GRP    + +R  GK QGL+F +G+SWKSHRRFSLK LRD GFGK S+E  L  EA+++ +   + + +P  V+ +FN+ +LN+LW +VA +RY+L DP     V  I  SVQ E +  +  MPW+R++ P  SGW   KK    ++G ++DL+   GG+    K   D     DF+  Y +     G  +FNE AL+ T +D+FAAGS+TTA TLSWAVLYM+L+P+ Q KV +EI +VL  +EP L+D++ LPYT+A I EIQR   I P  +PH  LKD  +  Y+IPK T V   LY  + DPDYW +P +FKP+RF+  DG +  K+ER   FG+GKRYCLGE LA+ ELFII  R++Q+    ++P HP P D+ + GFI +P+ FH V
Sbjct:   60 HSKIVGLYLGRFPIVAIYDFEVAKEIFSRDDLTGRPDNVLYRFRTNGKNQGLMFADGNSWKSHRRFSLKTLRDFGFGKSSLESVLIEEADRMGEFFLSQKDEPFLVQTLFNLVILNVLWTIVAGKRYELSDPKAQGIVRLITESVQVENLRFLFNMPWVRYLFPQASGWNTQKK----IIGDLRDLV---GGLVDEHKSNFDTSDMRDFMDVYLRE--MDGRTEFNEEALIVTAMDLFAAGSETTATTLSWAVLYMILYPDVQAKVYKEISEVLGDREPTLEDRSSLPYTDACIMEIQRLGSIAPMAVPHRALKDVEVKGYRIPKDTLVFSVLYHILRDPDYWPDPNAFKPERFLTPDGSQVIKEERFIPFGVGKRYCLGESLAKAELFIILTRLLQKFSFHSAPGHPVPSDQPVFGFIYAPKPFHAV 478          

HSP 2 Score: 280.026 bits (715), Expect = 1.025e-80
Identity = 145/340 (42.65%), Postives = 210/340 (61.76%), Query Frame = 0
Query:   16 VVRKYSKPRNFPPGPPWVPFFGSMPFLPKIGSPLSLSWKEMTERY-GKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNISVITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDG----DFITAYSKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVLMGKEPVLDDKARYGKIVGCML 350
            VV  + KPR FPPGPP +PFFGS+ F+P +   ++ +      RY  KIVG  LG FP V +YD+ + KEIF++D+  GR     + +R  GK QGL+F +G  WKSHRRF+LK LRD GFGK S+E  L  EA+++ +   +   +P  V+ +FN+ +LN+LW +VA +RY+L DP     V  I  S+Q +N+  +  MPW+R++ P  SGW   K    +++G ++DL+   GG+    K   D     DF+  Y +     G  EFNE AL+ T +D+FAAGS+TTA TL+WAVLYMIL+P+   KV +EI +VL  +EP L+D++       C++
Sbjct:   15 VVVFFKKPRKFPPGPPAIPFFGSVFFVPHLPGLIATAATWFINRYHSKIVGLYLGRFPIVAIYDFEVAKEIFSRDDLTGRPDNVLYRFRTNGKNQGLMFADGNSWKSHRRFSLKTLRDFGFGKSSLESVLIEEADRMGEFFLSQKDEPFLVQTLFNLVILNVLWTIVAGKRYELSDPKAQGIVRLITESVQVENLRFLFNMPWVRYLFPQASGWNTQK----KIIGDLRDLV---GGLVDEHKSNFDTSDMRDFMDVYLRE--MDGRTEFNEEALIVTAMDLFAAGSETTATTLSWAVLYMILYPDVQAKVYKEISEVLGDREPTLEDRSSLPYTDACIM 345          

HSP 3 Score: 109.383 bits (272), Expect = 3.303e-21
Identity = 47/82 (57.32%), Postives = 62/82 (75.61%), Query Frame = 0
Query:  861 YGKIVGSMMGSFPVVAVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSME 942
            + KIVG  +G FP+VA+YD+ + KEIF++D+  GRP    + +R  GK QGL+F +G+SWKSHRRFSLK LRD GFGK S+E
Sbjct:   60 HSKIVGLYLGRFPIVAIYDFEVAKEIFSRDDLTGRPDNVLYRFRTNGKNQGLMFADGNSWKSHRRFSLKTLRDFGFGKSSLE 141          
BLAST of probable cytochrome p450 303a1 vs. nr
Match: gi|1325331159|ref|XP_023347441.1| (methyl farnesoate epoxidase-like, partial [Eurytemora affinis])

HSP 1 Score: 370.548 bits (950), Expect = 8.587e-116
Identity = 183/417 (43.88%), Postives = 262/417 (62.83%), Query Frame = 0
Query:  346 VGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIK-DGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFH 761
            VG  LG +P+V +YD N  KE+F++D   GRP +F + YRMLG++ GLLFN+G +WK+ RRF LK L+D GFGKK +E  L  EA++I D   + Q +P  V ++FNVA+LN+LW +VAN RYDL DP     V  I  S+Q E +  +  +P  RH AP  +GW   ++   E    ++ ++++    + + +E++  DFI  Y +     G PDFN+  L+   +D+F+AGS+TTA TL+WAV +M+LHPE Q++VQ E+D  +  ++P L+D  RLP TEA I EIQR   I P G  H  +       + I   TFV   LY+ M DP+ W+EPE F P RF+  +GK  K +    FG+GKR CLGE LA++ELFIIF R++Q+   T SP+HP P    + GFI++P+ F+
Sbjct:    1 VGLFLGEYPAVILYDLNTAKELFSQDNAAGRPDSFVYKYRMLGQKLGLLFNDGEAWKTQRRFVLKTLKDFGFGKKGLEGVLVEEADKIGDLFRSKQNEPFLVLNLFNVAILNVLWTIVANHRYDLTDPNAQTLVKLITDSIQVEGLRFLFAVPVSRHFAPEWTGWNKQQQVVGETQNLMRRIVEEH---KESYQEDNMRDFIDVYLREMKTGGSPDFNDEQLIVNAMDLFSAGSETTATTLAWAVAFMILHPEVQKEVQEELDREIGDRKPALEDIVRLPLTEATIMEIQRMGSIAPQGY-HFFIIGNNPMKHAI-WNTFVFSMLYYIMRDPEIWSEPERFNPRRFLNPEGKLVKHDHFVPFGVGKRQCLGESLAKSELFIIFTRLIQQFSFTESPDHPGPFPTPVPGFIMAPKPFY 412          

HSP 2 Score: 242.276 bits (617), Expect = 1.135e-67
Identity = 118/278 (42.45%), Postives = 173/278 (62.23%), Query Frame = 0
Query:   64 VGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNISVITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVLMGKEPVLDDKAR 341
            VG  LG +P V++YD N  KE+F++D   GR  +F + YRMLG++ GLLFN+G  WK+ RRF LK L+D GFGKK +E  L  EA++I D   +   +P  V ++FNVA+LN+LW +VAN RYDL DP     V  I  S+Q + +  +  +P  RH AP  +GW   +    E    ++ +++E    K + +E++  DFI  Y +     G P+FN+  L+   +D+F+AGS+TTA TLAWAV +MILHPE  ++VQ E+D  +  ++P L+D  R
Sbjct:    1 VGLFLGEYPAVILYDLNTAKELFSQDNAAGRPDSFVYKYRMLGQKLGLLFNDGEAWKTQRRFVLKTLKDFGFGKKGLEGVLVEEADKIGDLFRSKQNEPFLVLNLFNVAILNVLWTIVANHRYDLTDPNAQTLVKLITDSIQVEGLRFLFAVPVSRHFAPEWTGWNKQQQVVGETQNLMRRIVEEH---KESYQEDNMRDFIDVYLREMKTGGSPDFNDEQLIVNAMDLFSAGSETTATTLAWAVAFMILHPEVQKEVQEELDREIGDRKPALEDIVR 275          

HSP 3 Score: 100.138 bits (248), Expect = 1.594e-18
Identity = 42/78 (53.85%), Postives = 57/78 (73.08%), Query Frame = 0
Query:  865 VGSMMGSFPVVAVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSME 942
            VG  +G +P V +YD N  KE+F++D   GRP +F + YRMLG++ GLLFN+G +WK+ RRF LK L+D GFGKK +E
Sbjct:    1 VGLFLGEYPAVILYDLNTAKELFSQDNAAGRPDSFVYKYRMLGQKLGLLFNDGEAWKTQRRFVLKTLKDFGFGKKGLE 78          
BLAST of probable cytochrome p450 303a1 vs. nr
Match: gi|918996737|ref|XP_013390837.1| (cytochrome P450 2J6 [Lingula anatina])

HSP 1 Score: 353.214 bits (905), Expect = 4.139e-105
Identity = 244/761 (32.06%), Postives = 391/761 (51.38%), Query Frame = 0
Query:   23 PR-NFPPGPPWVPFFGSMPFLPKIG---SPLSL-SWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIF--NKDEFCGRQGTFAHMYRMLGKR-QGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDD-----PMLLKCVSAIDASLQGKNISVITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQSGDPE-FNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVL-MGKEPVLDDKARYGKIVGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDD-PMLLKCVSAIDASVQGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESD-GDFITAYSKHAVQSGDPD-FNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVL-MGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIK-DGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASP-EHPPPVDKYITGFILSPETFHV 762
            PR  +PPGP   P  G +P +   G    P  L  W +    YG I+    G    +++  Y LI+E F  N D    R      + +++GK   G+LF  G  WK  RRFTL +LRDLG G+KS+++ +  EA  +   +E   GK    +     AV NI+  +V   RYD +D     P+L + +   +  +   N++   +MP  + IA V           D+L   ++  +++    + +       DFI  + K   +  DPE + E  +   I+D++ AG+DTTANTL W++++M+ HP+  ++VQREID V+  G+   ++DKAR          PF   T+ +                      ++R+     G++   GH+WK  RRF+L +LRDLG G+KS+++ +  EA  +   +E   GK    R     AV NI+  +V   RYD +D P +L  +   +A   GE  + +T +   R I P++      K  S  LV  +  L++Q       + +  D  DFI  + K   +  DP+ + E  +   ++D++ AG+DTTANTL W++++MV HP+ Q++VQ+EID V+  G+   ++DKAR+P+TEA + E+ R S +VP G+PH T + T +  Y IPKGT ++G LY  +HD + + +   FKP+R++  DGK  K ++L  F +G R CLG+ LA  E FI F  ++Q      +  E PP   + +  F  +P  ++V
Sbjct:   39 PRVKWPPGPVCFPVVGCLPQMMISGRRRQPTDLLPWYDT---YGDIMHVKFGEQHMIMLGTYELIQEAFVKNADTVSARPTWIYFLRQIVGKDGAGVLFKSGKAWKELRRFTLSSLRDLGLGRKSLQERIQDEARYLVQNIENENGKAFSPRERIGKAVSNIISIVVFGTRYDYNDTPEMLPVLEEVLRLGEGPVLLTNLARF-IMPMKKMIALV-----------DKLYSLIRQEVEKH---RQSFDPTDIRDFIDLFIKVTQEEEDPEVYTEWNVFRIIVDLYLAGTDTTANTLRWSLVHMVNHPDAQKRVQREIDQVIGQGRVAKMEDKARM---------PFTEATILE----------------------VFRLSTVGAGVILKTGHAWKELRRFTLSSLRDLGLGRKSLQERIQDEARYLVQNIEDENGKAFSPRDRIGKAVSNIISIVVFGTRYDYNDTPEMLPVLE--EALRLGEGPLSLTNLA--RFIMPMK------KIMS--LVDKLYSLIRQEVEKHRQSFDPKDIRDFIDLFIKVTQEEEDPEVYTEWNVFRIIVDLYLAGTDTTANTLRWSLVHMVNHPDAQKRVQQEIDQVIGQGRVAKMEDKARMPFTEATVLEVFRLSTVVPLGVPHATSETTNLAGYTIPKGTVILGDLYRVLHDENNFEDAYKFKPERWLDVDGKVVKSDKLIPFSMGPRICLGKGLAEMESFIFFTTLLQNFTFKVTEGEKPPDGVEGLNTFTFTPYPYNV 738          
BLAST of probable cytochrome p450 303a1 vs. nr
Match: gi|1041543175|ref|XP_017300863.1| (PREDICTED: probable cytochrome P450 303a1 [Diaphorina citri])

HSP 1 Score: 342.043 bits (876), Expect = 2.900e-100
Identity = 241/786 (30.66%), Postives = 399/786 (50.76%), Query Frame = 0
Query:   22 KPRNFPPGPPWVPFFGSMPFLPKIGSPLSLSWK---EMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATL------GKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNI--SVITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQSGDP--EFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREID---------------DVLMGKEPVLDDKARYGKIVGCMLGPFPSVTVYDYNLI---------KEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICD--KMEASQGKP-LEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGEKIM--LITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSGDPD-FNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKE--PVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIKD-GKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFH 761
            KPRNFPPGP W+P  GS   + K+ +     ++   E++++YG +VG  +G    VV + Y  IKE+ +K+EF GR     +  R  GKRQGLL  +   W   RRF L+ LR+ GFGK++M   +  EA Q+    +  +      G  + ++  F+V VLN LW ++A  RY  +D  L K  S +       ++  ++ +  P LR++AP  SG+ ++     ++  ++++   E    K     +   D +  Y K  ++S D    F+E+ L++  +DMF AGS+TT+ +L +  LY++LHP+  +K Q E+                 V MG+   +  +A     +     P  ++ + ++N +          E+F  + F    G      + L    GLL  +   W   RRF L+ LR+ GFGK++M   +  EA Q+    K E   G   + +R  F+V VLN LW ++A  RY  +D  L K  S +        ++  L +  P LR++AP  SG+ ++     ++  ++++ +      ET   +E   D +  Y K        D F+E+ L+A  +DMF AGS+TT+ +L +  LY++LHP+ Q+K Q EID V+ G++  P L+D+  +PY EA+  E  R        IPH  L+DTT+  Y IPK T +I      + D ++W++PE F+P+RF+ D G  +  ++   FG GK  C+G+ LAR+ +F++   ++Q  D++  P   PP    + G   SP  ++
Sbjct:   22 KPRNFPPGPDWIPILGSALAIQKLRNQTGYLYQACAELSKQYGPVVGLRVGKDRQVVCFGYPAIKEMLSKEEFDGRPRGPFYETRTWGKRQGLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQHLSLPGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRN---ELDNHKETFNPDEMRDIMDVYLK-TLKSEDKTDTFSESQLLAICMDMFMAGSETTSKSLGFGFLYLLLHPDVQKKAQAELYAVTLPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQDGGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHK--ETFNPDEMR-DIMDVYLKTLKSEDKTDTFSESQLLAICMDMFMAGSETTSKSLGFGFLYLLLHPDVQKKAQAEIDRVV-GRDRLPSLNDRPHMPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGKHQCMGQTLARSNIFLLTASLLQNFDLSVPPGEAPPSTLGVDGVTPSPGEYN 799          

HSP 2 Score: 73.559 bits (179), Expect = 1.474e-9
Identity = 36/82 (43.90%), Postives = 48/82 (58.54%), Query Frame = 0
Query:  860 NYGKIVGSMMGSFPVVAVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSM 941
             YG +VG  +G    V  + Y  IKE+ +K+EF GRP    +  R  GKRQGLL  +   W   RRF L+ LR+ GFGK++M
Sbjct:   62 QYGPVVGLRVGKDRQVVCFGYPAIKEMLSKEEFDGRPRGPFYETRTWGKRQGLLVTDEQLWVEQRRFVLRQLREFGFGKRTM 143          
BLAST of probable cytochrome p450 303a1 vs. nr
Match: gi|1339063427|ref|XP_023720400.1| (methyl farnesoate epoxidase-like [Cryptotermes secundus])

HSP 1 Score: 328.561 bits (841), Expect = 4.991e-94
Identity = 203/624 (32.53%), Postives = 313/624 (50.16%), Query Frame = 0
Query:  339 KARYGKIVGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDD---PMLLKCVSAI--DASVQGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQS---GDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVL-MGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFI-KDGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHV-------VRAGLSCLNEL---TVHAVAMETWRAFHSQDGPDGSRNALGQVLFPSNVATRSTRSETAGVVSPHLPYAANTLVDNGIAMWNKFPALREASTRRMASSVANYGKIVGSMMGSFPVVAVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSME 942
            K +YG +VG MLG  P++ V       E+F +DEF GRP TF    R   KR G  F +G  W   RRF+L++LRDLGFGKKS+E  +  EA  +  +++ ++   ++    F V  +N+LW ++   R+  DD     LL+ ++ +    +  G+   ++ ++P+LR I P  +G+      +     + ++ ++Q         E    DFI  Y K   ++    +  F E+ L+  ++D+F+AG+++ AN+L + +LY++LHP  Q+KVQ E+D V+   + P LDDK RLPY EA + E+ R + I P    H  LKDT +  Y IPK T VI   Y  + DPD+W +PE F+P+RF+  +GKF KD+ +  FG GKR+CLGE LARN LFI F    Q   ++     P P     +GF  +P  F +          G+  +  L   T+    + +W     ++ P G  +      FP              V+ P        +       W                 +  YG +VG   GS  ++A+     + E+  ++EF  RP +     R  GKR G+ F++G  W   RRF+L+NLRD GFGK+SME
Sbjct:   55 KKQYGPVVGLMLGSKPALAVIGAEECLEVFRRDEFQGRPDTFNSRDRAFNKRLGFFFTDGPFWVEQRRFTLRHLRDLGFGKKSLEGIILDEAEVLIKQLQFNE---IQKCGFFGVPAINVLWAVLGGERHSHDDREFKALLQKITRLFRTGNPSGD---IVDVLPFLRLIFPNLAGYRERNIATTGGHNFFREAIRQHA---RTLDENESRDFIDVYLKEMKKNDGINNTSFTEDGLITILLDLFSAGAESVANSLDYCILYLILHPHIQKKVQDELDAVVGRSRRPSLDDKPRLPYVEATLTEVLRINPIAPLTPHHRVLKDTKLNGYDIPKDTTVIICSYGVLSDPDHWGDPEVFRPERFLDSNGKFMKDDWMINFGSGKRFCLGESLARNILFIFFATFFQEFSLSIPEGDPKPSTMPQSGFTTAPYPFRMKIKERLGKNPGIQMIVTLVLWTLFFYLLYSWLTMKPKNYPPGPLH------FP--------------VIGPAFSVPRKLVHITLAGEW-----------------LQKYGPVVGLAFGSRKIIAICGAREVLEVLQREEFQARPTSMFFKERSFGKRLGVFFSDGPFWVEQRRFTLRNLRDFGFGKQSME 632          

HSP 2 Score: 215.312 bits (547), Expect = 3.329e-54
Identity = 138/432 (31.94%), Postives = 224/432 (51.85%), Query Frame = 0
Query:  341 RYGKIVGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKM-EASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGEKIM--LITLMPWLRHIAPVRSGWVAYKKFSDELVGYV-KDLMKQRGGIETAAKEESDGDFITAYSKH-AVQSGDPD--FNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVL-MGKEPVLDDKARLPYTEAVIAEIQRKS-CIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFI-KDGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHV 762
            +YG +VG   G    + +     + E+  ++EF  RP +     R  GKR G+ F++G  W   RRF+L+NLRD GFGK+SME    F   ++ D + E +Q   L+V  +F+VA LN+LW+++A   Y  +D  LL  +  +    +       L+   P L+ IAPV SG    K+   ++  Y  K + + +  I+    + +  DFI  Y +   VQ   PD  F E  L+   +D+F+AG +T +++L++++LYM+L+P  Q+ VQ+E+D V+   + P L D+            I R + C V  G    ++               V+  LY    D ++W +PE F+P+RF+  DG F KD+ +  FG+GKR C+GE L RN +F+ F  ++Q    +   E P P    ++GF ++P +F V
Sbjct:  550 KYGPVVGLAFGSRKIIAICGAREVLEVLQREEFQARPTSMFFKERSFGKRLGVFFSDGPFWVEQRRFTLRNLRDFGFGKQSME---GFIMEEVEDTIKEVTQKGVLQVNGLFSVATLNVLWRMIAGSHYSRNDEELLTLLEKVSRFFRSGNPSGGLVNFFPILKTIAPVLSGHTEAKESLLDMQNYFRKSIWEHKKTID----KNNPRDFIDVYLREMEVQRNKPDTTFTEEGLIVLCLDLFSAGGETLSSSLAFSLLYMILNPNVQKAVQKELDQVVGRDRRPTLADRGS--------GTIDRNNHCHVIRGFEQESM---------------VVINLYSVFQDQEHWGDPEVFRPERFLDSDGHFVKDDWIIPFGVGKRMCIGEVLTRNTIFLFFTSLLQEFWFSVPEEDPEPSLVPLSGFTIAPRSFRV 951          

HSP 3 Score: 202.986 bits (515), Expect = 4.142e-50
Identity = 120/345 (34.78%), Postives = 190/345 (55.07%), Query Frame = 0
Query:    3 IAVLALVGLLLVWVVRKYSKPRNFPPGPPWVPFFGSMPFLPKIGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNIS--VITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQS---GDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVL-MGKEPVLDDKAR 341
            +  +A V LLL  V+    KP+NFPPGPP +P  GS+PF+P      ++  K+  ++YG +VG MLG  P + V       E+F +DEF GR  TF    R   KR G  F +GP W   RRFTL++LRDLGFGKKS+E  +  EA  +  +++      ++    F V  +N+LW ++   R+  DD      +  I    +  N S  ++ V+P+LR I P  +G+      +     + ++ +++    +T  + ES  DFI  Y K   ++    +  F E+ L++ ++D+F+AG+++ AN+L + +LY+ILHP   +KVQ E+D V+   + P LDDK R
Sbjct:    4 LIFVAFVALLLYSVL--IFKPKNFPPGPPCLPVVGSIPFIPAKHVQFTMV-KKWKKQYGPVVGLMLGSKPALAVIGAEECLEVFRRDEFQGRPDTFNSRDRAFNKRLGFFFTDGPFWVEQRRFTLRHLRDLGFGKKSLEGIILDEAEVLIKQLQFN---EIQKCGFFGVPAINVLWAVLGGERHSHDDREFKALLQKITRLFRTGNPSGDIVDVLPFLRLIFPNLAGYRERNIATTGGHNFFREAIRQHA--RTLDENESR-DFIDVYLKEMKKNDGINNTSFTEDGLITILLDLFSAGAESVANSLDYCILYLILHPHIQKKVQDELDAVVGRSRRPSLDDKPR 339          

HSP 4 Score: 169.088 bits (427), Expect = 3.215e-39
Identity = 111/336 (33.04%), Postives = 175/336 (52.08%), Query Frame = 0
Query:   11 LLLVWVVRKYSKPRNFPPGPPWVPFFGSMPFLPKIGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNIS--VITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKH-AVQSGDPE--FNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVL-MGKEPVLDDKA 340
            LL  W+     KP+N+PPGP   P  G    +P+    ++L+  E  ++YG +VG   G    + +     + E+  ++EF  R  +     R  GKR G+ F++GP W   RRFTL+NLRD GFGK+SME  +  E        E T    L+V  +F+VA LN+LW+++A   Y  +D  LL  +  +    +  N S  ++   P L+ IAPV SG    K    ++  Y +  + E    K    + +  DFI  Y +   VQ   P+  F E  L+   +D+F+AG +T +++LA+++LYMIL+P   + VQ+E+D V+   + P L D+ 
Sbjct:  506 LLYSWLT---MKPKNYPPGPLHFPVIGPAFSVPRKLVHITLA-GEWLQKYGPVVGLAFGSRKIIAICGAREVLEVLQREEFQARPTSMFFKERSFGKRLGVFFSDGPFWVEQRRFTLRNLRDFGFGKQSMEGFIMEEVEDTIK--EVTQKGVLQVNGLFSVATLNVLWRMIAGSHYSRNDEELLTLLEKVSRFFRSGNPSGGLVNFFPILKTIAPVLSGHTEAKESLLDMQNYFRKSIWEH---KKTIDKNNPRDFIDVYLREMEVQRNKPDTTFTEEGLIVLCLDLFSAGGETLSSSLAFSLLYMILNPNVQKAVQKELDQVVGRDRRPTLADRG 832          
BLAST of probable cytochrome p450 303a1 vs. nr
Match: gi|1139811909|ref|XP_019925087.1| (PREDICTED: cytochrome P450 2C5 [Crassostrea gigas])

HSP 1 Score: 324.324 bits (830), Expect = 6.180e-94
Identity = 215/804 (26.74%), Postives = 391/804 (48.63%), Query Frame = 0
Query:    4 AVLALVGLLLVWVVRKYSKPRNFPPGPPWVPFFGSMP-FLPKIGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNK--DEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNISVITVMPWLRHIAPVRSGWVAYKWF-SDELVGYVKDLMKERGGIKTAAKEESD-GDFITAY---SKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVLMGKEPVLDDKARYGKIVGCMLG----------PFPSVTVYDYNLIKEIFNK--------DEFCGRPGTFAHMYRMLGKR-----------QGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPM---LLKCVSAIDASVQGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFI-KDGKFK--KDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPP--PVDKYITGFILSPETFHV 762
              + +V L L+W +    +P+  P GP   P  G++  F P   S  + + ++  + YG     M+   P + +  +N I+++  K  D F  R   +     ++ KR+GL +  G  WK  R F L  LR  GFGK+ ++  +  E + + D+ E   GKP  + +   ++V N++  L+  +R++ +D    + +  ++  L   N S          I P  S +  + +  +   +  + + + ER        +E++  D+I AY    K      +  F +  L  ++ D FAAG++TT+ T+ WA+LY++ HPE  +K+Q EID VL G +P ++ K R   +   +L             P  T  D+     +F K        D     P  F     +  ++            GL+++ G  W+  R+F+L  L  +GFGK+ ++  +  E + + D++E  + +P ++ H  N AV N++  L+  +R+D +D     L+K +  + A+        +   P LR +    SG+   +K   ++  + ++++K+    +   +E    +F+  +       G+  F +  L+  V + F AG++TT+ TL WA+L+++ HPE Q+ ++ +++ ++   +P +++K  LP  EA I E+QR + + P GIPH   +D     Y +PKGT +   L   M D + + +P  FKP+RF+ ++GK +  + ++L  F IGKR CLGE LA+ ELF+   R +QR +I   PE+P   P  + I G    P+ F +
Sbjct:    5 VAIVVVLLCLIWALT--GRPKGLPAGPTCFPIIGNIGLFRP---SEATQAHRKFRKIYGDFYSLMIFNRPVIFISGFNNIRQLLVKHGDMFSERPRVYPS--EVIAKRKGLAWASGAWWKEQRTFALTTLRKFGFGKRCLQSQVIEEVDCLMDEFEKYEGKPFNIHYQLKISVSNVICSLLFGKRFEYEDAKFHRLMKLLNTLLTVVNFSSPAF------IFPSLSRFSIFNFTKAKPTIKALAEFVGERAEEHRETFDENNIRDYIDAYLLEQKQRTTEVNTTFTDEQLAGSVRDFFAAGTETTSLTMRWALLYLMHHPEIKQKLQTEIDTVLGGDKPTMEIKDRLPMVDAFLLEVQRLGNILPLNLPHTTKEDFWYQGYLFPKNAIMFFMIDSVLSDPAIFPRTAEIQPRKIHTDFDVHTIASGLMWSSGSLWEEQRKFALTTLSKMGFGKRCLQGQIMEEVDCLMDEVEKFENQPFDIHHTLNTAVSNVICSLLFGKRFDHEDAKFKNLIKLLDKMFATTNPSSPAFV--FPLLRFLP--GSGFHNMEKIFGDIDEFTEEIIKEH---KKKFEENQMNNFVDGFLTKQTHDGNSTFTDKQLIIIVREFFGAGTETTSTTLRWALLFLIHHPEWQKDLRGDVETLIGKNQPTMENKENLPRIEAFILEVQRHANLAPFGIPHTPREDFIYNGYLLPKGTCINFALDSVMMDSEIFPDPFVFKPERFLDENGKCQGEQKDKLIPFSIGKRSCLGESLAKMELFLFLTRFLQRFEI--KPENPERLPTLEPILGLTNMPKDFKI 786          
BLAST of probable cytochrome p450 303a1 vs. nr
Match: gi|1080064437|ref|XP_018574350.1| (uncharacterized protein LOC108913304 [Anoplophora glabripennis])

HSP 1 Score: 327.405 bits (838), Expect = 3.495e-93
Identity = 197/614 (32.08%), Postives = 331/614 (53.91%), Query Frame = 0
Query:  341 RYGKIVGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGEKIM--LITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREID-DVLMGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIK-DGKFKKDERLTI-FGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHVVRAGL-----SCLNELTVHAVAMETWRAFHSQDGPDGSRNALGQVLFPSNVATRSTRSETAGVVSPHLPYAAN--TLVDNGIAMWNKFPALREASTRRMASSVANYGKIVGSMMGSFPVVAVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSME 942
            +YG IVG  LG    V V+   +IKE+ +++EF GRP  F    R  GKR G++F++G  W+  R+FSL++LR+ GFG+K ME+ +  E   + +       +P+ +   F+++VLN+LW ++A +R+D++D  L + +  I  + +   +   LI  MP+LRH+AP   G+       + +  ++++ + +       ++     D I A+ +    + D  F ++ LM+  +D+F AG++TT+NTL++ V+YMVL+PE Q++VQ E+D ++   + P L+D+ RL YTEAV+ EIQR+S I P GI H   K+T +  Y++P+GT V+  +Y    D  +W +P +F+P+RF+  +G    +E+    FG GKR CLGE L +  +F+ F  ++    +  + +  P ++ +  G  ++P+ F VV A       SC    TV  +   + RAF           A+  VLF + V  +  +          +P+  N   L +   A+  +  AL E + R   +       ++G  +G    V V  Y +I+ + + DE+ GRP  F    R +G R+G+   +G  WK  R F + +LR LGFGKK ME
Sbjct:   63 QYGDIVGLKLGRHLVVAVFGAEVIKEVLSREEFDGRPDGFFFRLRTFGKRLGIVFSDGQFWRKQRKFSLQHLRNFGFGRKEMEEKIQEETRCLMEIFRGRCSEPMFMHTAFDISVLNVLWAMMAGQRFDIEDERLRRLLQIIHDAFRLVDMSGGLINQMPFLRHVAPDACGYNQIMSILERMWQFLEEAISEHRKTVCFSQPR---DLIDAFLQKMNINNDSTFTDDQLMSLCLDLFMAGAETTSNTLAFTVMYMVLYPEVQKRVQNELDQEIGRNRCPNLNDRVRLKYTEAVLNEIQRRSNIAPLGIAHRATKNTELFGYRVPEGTMVLTSIYSVHMDRRFWQDPMAFRPERFLDGNGDVVVNEKYFFPFGQGKRRCLGESLGKANIFLFFTALLHNFTVKTAEDFYPQLEGF-DGVTIAPKPFKVVLAPREEYFPSC----TVWRIEAHSPRAFCYTMTYVLLVAAV--VLFVTYVINQVRKPPNFPPGPCWIPFVGNLPELRNLSRALGGQHLALVELAKRYKTN-------VLGLKLGKDYFVVVSSYPVIRTVLHGDEYDGRPNNFFIRLRTMGTRRGVTCTDGELWKIQRNFVVTHLRSLGFGKKPME 659          

HSP 2 Score: 259.61 bits (662), Expect = 3.951e-69
Identity = 155/445 (34.83%), Postives = 235/445 (52.81%), Query Frame = 0
Query:  323 REIDDVLMGKEPVLDDKARYGK--IVGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGEKIM--LITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIET-AAKEESDGDFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVL-MGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIK-DGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETF 760
            R +   L G+   L + A+  K  ++G  LG    V V  Y +I+ + + DE+ GRP  F    R +G R+G+   +G  WK  R F + +LR LGFGKK ME  +  E +++   ++ + G  + +  V   AV+NILW L    R D  DP L + +  +D   +   +   ++T  PWLR +AP ++G+   KK + EL   + + + Q     T  A E+    FIT   K         F E  L+   +D+F AGS TT+NTL +A L M+LHP+ Q +V   +D      +E    D+ R+PY EAV+ E++R   + P   P   L+DTT+  Y IP+G  V+   Y   +D DYW +PE F+PDRF+  + K    +RL  FG+GKR CLGE LA+  +F+ F+ +M+R ++T  P    P    + G  LSPE +
Sbjct:  557 RNLSRALGGQHLALVELAKRYKTNVLGLKLGKDYFVVVSSYPVIRTVLHGDEYDGRPNNFFIRLRTMGTRRGVTCTDGELWKIQRNFVVTHLRSLGFGKKPMEILIKEEISEVLGILQEN-GSIVRIGKVIAPAVINILWALTTGSRIDRKDPRLNRLLELLDMRSKAFDMSGGILTQHPWLRLVAPEKTGYNLIKKLNCELRDLLMETVTQHQKTWTPGANEDLIYSFITEMKK--TNGHKSTFTEVQLIMVCLDIFIAGSQTTSNTLDFAFLAMILHPDVQTRVHARLDQAFEKSQEISYTDRVRIPYVEAVLLEVERFYHVAPITGPRRVLRDTTLEGYSIPRGATVLISSYSVHNDKDYWGDPEVFRPDRFLDVNEKLLPHDRLIPFGLGKRRCLGEVLAKQCIFLFFVELMRRYELTFLPNTDKPTGIPLPGITLSPERY 998          

HSP 3 Score: 211.846 bits (538), Expect = 6.870e-53
Identity = 116/344 (33.72%), Postives = 203/344 (59.01%), Query Frame = 0
Query:    5 VLALVGLLLVWVVRKYSKPRNFPPGPPWVPFFGSMPF----LPKIGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNIS--VITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREID-DVLMGKEPVLDDKAR 341
            V++ V LLLV+ ++K   PR +PPGP ++P  GS       L  +G    L W E++++YG IVG  LG    V V+   +IKE+ +++EF GR   F    R  GKR G++F++G  W+  R+F+L++LR+ GFG+K ME+ +  E   + +       +P+ +   F+++VLN+LW ++A +R+D++D  L + +  I  + +  ++S  +I  MP+LRH+AP   G+       + +  ++++ + E    KT    +   D I A+ +    + D  F ++ LMS  +D+F AG++TT+NTLA+ V+YM+L+PE  ++VQ E+D ++   + P L+D+ R
Sbjct:    9 VISAVCLLLVYDMKK---PRKYPPGPKFLPIIGSYGHYRNRLKSLGYH-HLVWSELSKQYGDIVGLKLGRHLVVAVFGAEVIKEVLSREEFDGRPDGFFFRLRTFGKRLGIVFSDGQFWRKQRKFSLQHLRNFGFGRKEMEEKIQEETRCLMEIFRGRCSEPMFMHTAFDISVLNVLWAMMAGQRFDIEDERLRRLLQIIHDAFRLVDMSGGLINQMPFLRHVAPDACGYNQIMSILERMWQFLEEAISEHR--KTVCFSQPR-DLIDAFLQKMNINNDSTFTDDQLMSLCLDLFMAGAETTSNTLAFTVMYMVLYPEVQKRVQNELDQEIGRNRCPNLNDRVR 345          

HSP 4 Score: 183.726 bits (465), Expect = 7.007e-44
Identity = 116/356 (32.58%), Postives = 182/356 (51.12%), Query Frame = 0
Query:    3 IAVLALVGLLLVWVVRKYSKPRNFPPGPPWVPFFGSMPFLPKIGSPLS---LSWKEMTERY-GKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNIS--VITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKT-AAKEESDGDFITAYSKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVL-MGKEPVLDDKARYGKIVGCML 350
            + ++A V L + +V+ +  KP NFPPGP W+PF G++P L  +   L    L+  E+ +RY   ++G  LG    VVV  Y +I+ + + DE+ GR   F    R +G R+G+   +G  WK  R F + +LR LGFGKK ME  +  E +++   ++   G  + +  V   AV+NILW L    R D  DP L + +  +D   +  ++S  ++T  PWLR +AP ++G+   K  + EL   + + + +     T  A E+    FIT   K         F E  L+   +D+F AGS TT+NTL +A L MILHP+   +V   +D      +E    D+ R   +   +L
Sbjct:  517 VLLVAAVVLFVTYVINQVRKPPNFPPGPCWIPFVGNLPELRNLSRALGGQHLALVELAKRYKTNVLGLKLGKDYFVVVSSYPVIRTVLHGDEYDGRPNNFFIRLRTMGTRRGVTCTDGELWKIQRNFVVTHLRSLGFGKKPMEILIKEEISEVLGILQEN-GSIVRIGKVIAPAVINILWALTTGSRIDRKDPRLNRLLELLDMRSKAFDMSGGILTQHPWLRLVAPEKTGYNLIKKLNCELRDLLMETVTQHQKTWTPGANEDLIYSFITEMKK--TNGHKSTFTEVQLIMVCLDIFIAGSQTTSNTLDFAFLAMILHPDVQTRVHARLDQAFEKSQEISYTDRVRIPYVEAVLL 869          

HSP 5 Score: 87.8113 bits (216), Expect = 7.347e-14
Identity = 39/84 (46.43%), Postives = 57/84 (67.86%), Query Frame = 0
Query:  860 NYGKIVGSMMGSFPVVAVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMED 943
             YG IVG  +G   VVAV+   +IKE+ +++EF GRP  F    R  GKR G++F++G  W+  R+FSL++LR+ GFG+K ME+
Sbjct:   63 QYGDIVGLKLGRHLVVAVFGAEVIKEVLSREEFDGRPDGFFFRLRTFGKRLGIVFSDGQFWRKQRKFSLQHLRNFGFGRKEMEE 146          
BLAST of probable cytochrome p450 303a1 vs. nr
Match: gi|565304710|gb|ETE60167.1| (Cytochrome protein, partial [Ophiophagus hannah])

HSP 1 Score: 328.176 bits (840), Expect = 4.829e-91
Identity = 249/924 (26.95%), Postives = 425/924 (46.00%), Query Frame = 0
Query:   40 PFLPKIGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQ---GKNISVITVMPWLRHIAPVRSGWVA-YKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAY----SKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVLMGKEPVLDDKAR-YGKIVGCMLGPFPSVTVYDYNLIKEI--FNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQGE---KIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVK-DLMKQRGGIETAAKEESDGDFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFIK-DGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHVVRAGLSCLNELTVHAVAMETWRAFHSQDGPDGSRNALGQVLFPSNVATRSTRSETAGVVSPHLPYAANT--LVDNGIAMWNKFPALREASTRRMASSVANYGKIVGSMMGSFPVVAVYDYNLIKE--IFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMED 943
            P L  I  P+      M++ YG I    +G    VV+  Y  +KE          +     ++    K  G+ F  G  W+  R+F+L  LRD G GK+ +ED +  E + +    E   GKP E   +   A  NI+   +  +R++ +D  LL+ +  ++ ++       + V  V P L  +   R   +   K + D +     + +KE         E +   FI A+     +   +S    F+ + L++ + ++F AG +T +NTL WA+L M+ +PE   KVQ EI   +  ++P  +D+ + +    G  + P  +  ++D +  ++   F  + F    G F      +    G++F +G +W+  RRFS+  LRD G GK+ +ED ++ E + +    +  +GKPL    +   A  NI+   +  +R++ DD  LL+ +  ++ ++       ++L  + P L  +       +  +K   EL  +++   +++   ++   +      F+    K   +S    F+ + L   V ++F AG DTT+NTL WA+L M+ +PE Q KVQ EI   +   +P  +D+A++PYT AVI EIQR + IVP+ +PH T +D T   + IPKG +++  L   +HD   W +P  F P+ F+   GKF K +    F  G+R C+GE LA+ ELF+ F  ++QR          PP         L+P            +  LT   +  +T          D +   L  +LF   +     +  +     P+LP    T  ++ N   M  K P       + M      YG I    +G   +V +  Y  +KE  +   D F GRP     ++  + K  G++F+ G +WK  RRF++  LRD G GK+++ED
Sbjct:  435 PALGLITPPMPYKTCAMSKEYGPIFRLQMGCQKMVVLIGYETVKEALVNQAEAFAERPIVPIFEDYAKGFGISFAHGENWRQMRQFSLSALRDYGMGKRIVEDKITEECSILTKAFETYEGKPFEPATILKAAAANIIVSFLLGKRFEYEDATLLRLLEILEENIHLAGTPAVLVYNVFPKLGFLLGARKTIMNNRKKYHDFIQATFLENIKE-------FDENNQRTFIDAFLVRQKEENKKSTHSYFHNDNLLALMDNLFGAGMETVSNTLCWAILLMMKYPEVQSKVQEEIAREMGVRQPRTEDRVKMHYTNAGMYIIPLLTSVLHDESQWEKPHEFYPEHFLDSKGKFVKRDAFMPFSAGVVFADGENWRVMRRFSISALRDYGMGKRIVEDKITEECSVLTKTFQTYEGKPLGPATILKAAAANIIVSFLLGKRFEYDDATLLRLLEILEENLHLAGTPAVLLYIVFPKLGFLLGAHKKIMNNRK---ELHDFIQATFLEKLKDLDENNQRNFIDAFLVQQKKEIKKSTASYFHNDNLKTLVDNLFGAGMDTTSNTLCWAILLMMKYPEVQRKVQEEIAKEIGACQPRTEDRAKIPYTNAVIHEIQRFADIVPTNLPHATTRDITFKGFFIPKGMYIVPLLTSVLHDESQWEKPHEFYPEHFLDLQGKFVKRDAFLPFSAGQRVCVGENLAKMELFLFFTNLLQRFTFQ------PPSGTSKDDLDLTP------------VLGLTTPPLPYKTCAEM------DWTGTILIVLLFILAIMFLLKKESSWKTSCPNLPPGPRTIPILGNLHMMDLKRPY------KTMIELSKKYGPIFRLRLGFQEMVVLTGYETVKEALVNQADAFAGRPS--VPVFEDIAKGFGIIFSHGENWKVMRRFTISTLRDYGVGKRTIED 1316          

HSP 2 Score: 194.126 bits (492), Expect = 7.924e-47
Identity = 128/423 (30.26%), Postives = 206/423 (48.70%), Query Frame = 0
Query:  341 RYGKIVGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDAS---VQGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELV--GYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFI-KDGKFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSP 757
             YG I    +G    V +  Y  +KE                ++    K  G++   G +W+  R+FSL  L D G GK+ +ED +S E + +    E  +GKP E   +   A  NI+   +  +R++ +D  LL+ +  I+ +   V    +++I +M +    +  R   +  +K   E +   +++++ +    I+    +     F+    K   +S D  F+ + L+  V ++F AG DTT+NTLSW +L M+ +PE Q+KVQ EI   +   +P  +D  ++PYT AVI EIQR + IVP+ +PH T KD T   + IPKG  ++  L   +HD   W +P  F P+ F+  +GKF K +    F  G R C  E LA+ ELF+ F  ++QR          PP      G  L+P
Sbjct:   26 EYGPIFHLQMGSQEMVVLTGYETVKEALVNQAEAFSERAIVPIFEDYAKGFGIVMAHGENWRQMRQFSLSALWDYGMGKRIVEDKISEECSVLIKTYETYEGKPFEPATILKAAAANIIVSFLLGKRFEYEDATLLRLLELIEENLHLVGTPAVLVIYIMCF---PSCARKKILNNQKEFHEFIQATFLENIKEFDENIQRTFIDA----FLVQEKKENKKSIDSYFHNDNLIGLVDNLFIAGMDTTSNTLSWVLLLMMKYPEVQKKVQEEIAKEIGVCQPRTEDGVKMPYTNAVIHEIQRFADIVPTNLPHATTKDVTFKGFFIPKGIHIVPLLSSVLHDESQWEKPHEFYPEHFLDSEGKFVKKDAFMPFSAGHRVCASENLAKMELFLFFTNLLQRFTFQ------PPSGTSKDGLDLTP 435          

HSP 3 Score: 184.882 bits (468), Expect = 7.268e-44
Identity = 111/334 (33.23%), Postives = 180/334 (53.89%), Query Frame = 0
Query:  341 RYGKIVGCMLGPFPSVTVYDYNLIKE--IFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASVQ---GEKIMLITLMPWLRHIAPVRSGWVAYKK-FSD----ELVGYVKDLMK--QRGGIETAAKEESDGDFITAYSKHAVQSGDPDFNENALMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVLMGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPK 662
            +YG I    LG    V +  Y  +KE  +   D F GRP     ++  + K  G++F+ G +WK  RRF++  LRD G GK+++ED +  E + +   ++A+ GKP EV+ V   AV NI+  ++  +RYD +DP  ++ +  I  ++       I+L  + P L  +       +  K+ F D      + Y+K+L +  QR  I++         F+    +   +  +  F+   L A   ++FAAG++TT NTL WA+L M+ +PE Q KVQ EI   +  ++P ++D+ ++PYT+AVI EIQR + IVP+ +PH T KD T   + IPK
Sbjct: 1233 KYGPIFRLRLGFQEMVVLTGYETVKEALVNQADAFAGRPS--VPVFEDIAKGFGIIFSHGENWKVMRRFTISTLRDYGVGKRTIEDKIIEECSVLTKTIKANAGKPFEVQTVITAAVSNIIVSILLGKRYDYEDPKFVRLLKIITENIHLSGTPNILLYNIFPMLGFLLGSHKKVINNKEEFHDFIQTTFIEYLKNLDENDQRSFIDS---------FLIRQREENKKMTNGYFHNENLKAVSSNLFAAGTETTGNTLRWAILLMMKNPEIQSKVQEEIAKEIGVRQPRIEDRTKMPYTDAVIHEIQRFADIVPTNLPHATTKDITFKGFFIPK 1555          

HSP 4 Score: 151.369 bits (381), Expect = 2.275e-33
Identity = 99/356 (27.81%), Postives = 180/356 (50.56%), Query Frame = 0
Query:    2 SIAVLALVGLLLVWVVRKYSKPR----NFPPGPPWVPFFGSMPFLPKIGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKE--IFNKDEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQ---GKNISVITVMPWL-----RHIAPVRSGWVAYKWFSDELVGYVKDLMK--ERGGIKTAAKEESDGDFITAYSKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVLMGKEPVLDDKAR 341
            +I ++ L  L ++++++K S  +    N PPGP  +P  G++  +  +  P   +  E++++YG I    LG    VV+  Y  +KE  +   D F GR      ++  + K  G++F+ G  WK  RRFT+  LRD G GK+++ED +  E + +   ++A  GKP EV+ V   AV NI+  ++  +RYD +DP  ++ +  I  ++      NI +  + P L      H   + +    + +     + Y+K+L +  +R  I +         F+    +   +  +  F+   L +   ++FAAG++TT NTL WA+L M+ +PE   KVQ EI   +  ++P ++D+ +
Sbjct: 1174 TILIVLLFILAIMFLLKKESSWKTSCPNLPPGPRTIPILGNLHMM-DLKRPYK-TMIELSKKYGPIFRLRLGFQEMVVLTGYETVKEALVNQADAFAGRPS--VPVFEDIAKGFGIIFSHGENWKVMRRFTISTLRDYGVGKRTIEDKIIEECSVLTKTIKANAGKPFEVQTVITAAVSNIIVSILLGKRYDYEDPKFVRLLKIITENIHLSGTPNILLYNIFPMLGFLLGSHKKVINNKEEFHDFIQTTFIEYLKNLDENDQRSFIDS---------FLIRQREENKKMTNGYFHNENLKAVSSNLFAAGTETTGNTLRWAILLMMKNPEIQSKVQEEIAKEIGVRQPRIEDRTK 1516          

HSP 5 Score: 94.7449 bits (234), Expect = 5.925e-16
Identity = 74/292 (25.34%), Postives = 132/292 (45.21%), Query Frame = 0
Query:   55 EMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCVSAIDASLQGKNISVITVMPWLRHIAPVRSGWV-AYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAY----SKHAVQSGDPEFNENALMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVLMGKEPVLDDKAR 341
            ++++ YG I    +G    VV+  Y  +KE          +     ++    K  G++   G  W+  R+F+L  L D G GK+ +ED +  E + +    E   GKP E   +   A  NI+   +  +R++ +D  LL+ +  I+ +L       + V+  +   +  R   +   K F + +     + +KE         E     FI A+     K   +S D  F+ + L+  + ++F AG DTT+NTL+W +L M+ +PE  +KVQ EI   +   +P  +D  +
Sbjct:   22 QLSKEYGPIFHLQMGSQEMVVLTGYETVKEALVNQAEAFSERAIVPIFEDYAKGFGIVMAHGENWRQMRQFSLSALWDYGMGKRIVEDKISEECSVLIKTYETYEGKPFEPATILKAAAANIIVSFLLGKRFEYEDATLLRLLELIEENLHLVGTPAVLVIYIMCFPSCARKKILNNQKEFHEFIQATFLENIKE-------FDENIQRTFIDAFLVQEKKENKKSIDSYFHNDNLIGLVDNLFIAGMDTTSNTLSWVLLLMMKYPEVQKKVQEEIAKEIGVCQPRTEDGVK 306          
BLAST of probable cytochrome p450 303a1 vs. nr
Match: gi|1228379904|ref|XP_021951391.1| (methyl farnesoate epoxidase-like [Folsomia candida] >gi|1215269192|gb|OXA55504.1| Methyl farnesoate epoxidase [Folsomia candida])

HSP 1 Score: 301.982 bits (772), Expect = 7.605e-89
Identity = 170/437 (38.90%), Postives = 254/437 (58.12%), Query Frame = 0
Query:  341 RYGKIVGCMLGPFPSVTVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMEDNLSFEANQICDKMEASQGKPLEVRHVFNVAVLNILWKLVANRRYDLDDPMLLKCV-SAIDASVQGEKIMLITLMPWLRHIAPVRSGWVAYKKFSDELVGYVKDLMKQRGGIETAAKEESDGDFITAYSKHAVQ----SGDP--DFNENA----LMATVIDMFAAGSDTTANTLSWAVLYMVLHPECQEKVQREIDDVL-MGKEPVLDDKARLPYTEAVIAEIQRKSCIVPSGIPHVTLKDTTIGSYQIPKGTFVIGPLYFFMHDPDYWNEPESFKPDRFI-KDG-KFKKDERLTIFGIGKRYCLGEQLARNELFIIFIRIMQRLDITASPEHPPPVDKYITGFILSPETFHVV 763
            +YG I    LG    V V DY L+KEIFN+  F GRP     +    G   G++ +EG +W++ RRF+L++LRD GFGK  ME+ +  E  +I D ++  +G+ + +   F++AVLN LW + + +RY  +D  L   + S+I A     +  L+   PW RH+AP  +GW   +    E+  + K  + +        KE   GD I  +  H +Q    + DP   F++      L ATV D+F AG++TT+ TL WAVLY+  HP  QEK+Q EID V+   + P L D+A +PYTE+VI E+ R S +VPSG+ H  +++     Y IPKGT++IG L+   ++P+ W +PE+F+P+RF+ +DG K KK E L  F +GKR CLGE LAR+ +F+    I Q+  +   PE+P    + + GFIL P+ F+VV
Sbjct:   61 QYGSIFSIQLGLEKIVVVDDYKLMKEIFNEPAFSGRPQNEVFLGMSQGN-YGVINSEGSTWETQRRFTLRHLRDFGFGKNYMENLIQDEVKEILDWLKGEEGRLVNLNRKFSLAVLNALWSITSGKRYPQNDSTLTNMLDSSIRAFNSLSETGLLLFAPWARHLAPGLTGWNTLQASIGEMTSFFKKTVHEH-------KETFSGDHIRDFVDHYIQEIEATTDPKSSFHQEEGYKHLSATVGDLFQAGAETTSTTLVWAVLYLTSHPTIQEKMQEEIDRVVGNSRLPTLQDRASMPYTESVIFEVLRMSSLVPSGLFHRAIENKEFHGYVIPKGTWIIGNLWSVHNNPEIWGDPENFRPERFLSEDGTKAKKHEALVPFQVGKRACLGEPLARDTIFLFLASIFQKFQVGPDPENPKLDFEPMIGFILVPKPFNVV 489          

HSP 2 Score: 189.119 bits (479), Expect = 5.844e-48
Identity = 115/327 (35.17%), Postives = 175/327 (53.52%), Query Frame = 0
Query:   26 FPPGPPWVPFFGSMPFLPKIGSPLSLSWKEMTERYGKIVGCMLGPFPTVVVYDYNLIKEIFNKDEFCGRQGTFAHMYRMLGKRQGLLFNEGPGWKSHRRFTLKNLRDLGFGKKSMEDNLCFEANQICDKMEATLGKPLEVKHVFNVAVLNILWKLVANRRYDLDDPMLLKCV-SAIDASLQGKNISVITVMPWLRHIAPVRSGWVAYKWFSDELVGYVKDLMKERGGIKTAAKEESDGDFITAYSKHAVQ----SGDPE--FNENA----LMSTIIDMFAAGSDTTANTLAWAVLYMILHPECHEKVQREIDDVL-MGKEPVLDDKA 340
            FPPGP  +P  G+   L ++G  + +  +E  ++YG I    LG    VVV DY L+KEIFN+  F GR      +    G   G++ +EG  W++ RRFTL++LRD GFGK  ME+ +  E  +I D ++   G+ + +   F++AVLN LW + + +RY  +D  L   + S+I A        ++   PW RH+AP  +GW   +    E+  + K  + E        KE   GD I  +  H +Q    + DP+  F++      L +T+ D+F AG++TT+ TL WAVLY+  HP   EK+Q EID V+   + P L D+A
Sbjct:   31 FPPGPRGLPLLGN---LTQVGCRMHVVLREWAKQYGSIFSIQLGLEKIVVVDDYKLMKEIFNEPAFSGRPQNEVFLGMSQGN-YGVINSEGSTWETQRRFTLRHLRDFGFGKNYMENLIQDEVKEILDWLKGEEGRLVNLNRKFSLAVLNALWSITSGKRYPQNDSTLTNMLDSSIRAFNSLSETGLLLFAPWARHLAPGLTGWNTLQASIGEMTSFFKKTVHEH-------KETFSGDHIRDFVDHYIQEIEATTDPKSSFHQEEGYKHLSATVGDLFQAGAETTSTTLVWAVLYLTSHPTIQEKMQEEIDRVVGNSRLPTLQDRA 346          

HSP 3 Score: 72.7886 bits (177), Expect = 1.937e-9
Identity = 36/84 (42.86%), Postives = 51/84 (60.71%), Query Frame = 0
Query:  860 NYGKIVGSMMGSFPVVAVYDYNLIKEIFNKDEFCGRPGTFAHMYRMLGKRQGLLFNEGHSWKSHRRFSLKNLRDLGFGKKSMED 943
             YG I    +G   +V V DY L+KEIFN+  F GRP     +    G   G++ +EG +W++ RRF+L++LRD GFGK  ME+
Sbjct:   61 QYGSIFSIQLGLEKIVVVDDYKLMKEIFNEPAFSGRPQNEVFLGMSQGN-YGVINSEGSTWETQRRFTLRHLRDFGFGKNYMEN 143          
The following BLAST results are available for this feature:
BLAST of probable cytochrome p450 303a1 vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides)
Total hits: 18
Match NameE-valueIdentityDescription
EMLSAG000000023598.172e-7432.88supercontig:LSalAtl2s:LSalAtl2s144:369128:376155:1... [more]
EMLSAG000000051639.645e-6533.94supercontig:LSalAtl2s:LSalAtl2s272:555567:557147:-... [more]
EMLSAG000000077581.366e-5832.06supercontig:LSalAtl2s:LSalAtl2s453:376415:377986:-... [more]
EMLSAG000000068222.052e-5733.07supercontig:LSalAtl2s:LSalAtl2s383:99037:100275:-1... [more]
EMLSAG000000073282.743e-5330.45supercontig:LSalAtl2s:LSalAtl2s412:195302:204629:-... [more]
EMLSAG000000046887.764e-5327.64supercontig:LSalAtl2s:LSalAtl2s245:535864:537578:-... [more]
EMLSAG000000057211.501e-3627.65supercontig:LSalAtl2s:LSalAtl2s309:682709:688189:1... [more]
EMLSAG000000120882.209e-1825.31supercontig:LSalAtl2s:LSalAtl2s865:171159:172708:-... [more]
EMLSAG000000052693.693e-1824.00supercontig:LSalAtl2s:LSalAtl2s281:237457:238966:1... [more]
EMLSAG000000094051.084e-1723.10supercontig:LSalAtl2s:LSalAtl2s5:994028:996076:1 g... [more]

Pages

back to top
BLAST of probable cytochrome p450 303a1 vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|122142141|sp|Q0IIF9.1|CP2U1_BOVIN1.349e-6732.14RecName: Full=Cytochrome P450 2U1[more]
gi|10719967|sp|Q9QYG5.1|CP2DK_MESAU3.666e-6732.64RecName: Full=Cytochrome P450 2D20; AltName: Full=... [more]
gi|3123191|sp|P04167.2|CP2B2_RAT1.302e-6632.88RecName: Full=Cytochrome P450 2B2; AltName: Full=C... [more]
gi|3915646|sp|P12938.2|CP2D3_RAT2.520e-6633.64RecName: Full=Cytochrome P450 2D3; AltName: Full=C... [more]
gi|3913320|sp|O55071.1|CP2BJ_MOUSE5.677e-6634.52RecName: Full=Cytochrome P450 2B19; AltName: Full=... [more]
gi|81908683|sp|Q4V8D1.1|CP2U1_RAT9.361e-6632.96RecName: Full=Cytochrome P450 2U1[more]
gi|341940386|sp|P11714.2|CP2D9_MOUSE1.078e-6530.88RecName: Full=Cytochrome P450 2D9; AltName: Full=C... [more]
gi|10719968|sp|Q9QYG6.1|CP2DR_MESAU5.426e-6532.56RecName: Full=Cytochrome P450 2D27; AltName: Full=... [more]
gi|3913341|sp|O54749.1|CP2J5_MOUSE7.199e-6533.94RecName: Full=Cytochrome P450 2J5; AltName: Full=A... [more]
gi|11386674|sp|Q9VW43.1|CP305_DROME1.377e-6430.70RecName: Full=Probable cytochrome P450 305a1; AltN... [more]

Pages

back to top
BLAST of probable cytochrome p450 303a1 vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR)
Total hits: 25
Match NameE-valueIdentityDescription
gi|675803047|gb|AIL94131.1|9.303e-15048.58cytochrome P450 CYP3037A1 [Tigriopus japonicus][more]
gi|820982932|gb|AKH03504.1|4.128e-12746.96cytochrome P450 3037B1 [Paracyclopina nana][more]
gi|1325331159|ref|XP_023347441.1|8.587e-11643.88methyl farnesoate epoxidase-like, partial [Eurytem... [more]
gi|918996737|ref|XP_013390837.1|4.139e-10532.06cytochrome P450 2J6 [Lingula anatina][more]
gi|1041543175|ref|XP_017300863.1|2.900e-10030.66PREDICTED: probable cytochrome P450 303a1 [Diaphor... [more]
gi|1339063427|ref|XP_023720400.1|4.991e-9432.53methyl farnesoate epoxidase-like [Cryptotermes sec... [more]
gi|1139811909|ref|XP_019925087.1|6.180e-9426.74PREDICTED: cytochrome P450 2C5 [Crassostrea gigas][more]
gi|1080064437|ref|XP_018574350.1|3.495e-9332.08uncharacterized protein LOC108913304 [Anoplophora ... [more]
gi|565304710|gb|ETE60167.1|4.829e-9126.95Cytochrome protein, partial [Ophiophagus hannah][more]
gi|1228379904|ref|XP_021951391.1|7.605e-8938.90methyl farnesoate epoxidase-like [Folsomia candida... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold1571_size35388supercontigscaffold1571_size35388:12852..35386 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
maker2018-02-12 .496401
T. kinsejongensis vs L. Salmonis peptides2018-04-19
T. kingejongensis peptided Blastp vs. SwissProt2018-04-19
T. kingsejongensis proteins Blastp vs. NR2018-05-15
Properties
Property NameValue
Note-
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
maker-scaffold1571_size35388-snap-gene-0.6-mRNA-1maker-scaffold1571_size35388-snap-gene-0.6-mRNA-1Tigriopus kingsejongensismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at scaffold1571_size35388:12852..35386+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>maker-scaffold1571_size35388-snap-gene-0.6 ID=maker-scaffold1571_size35388-snap-gene-0.6|Name=probable cytochrome p450 303a1|organism=Tigriopus kingsejongensis|type=gene|length=22535bp|location=Sequence derived from alignment at scaffold1571_size35388:12852..35386+ (Tigriopus kingsejongensis)
ATGTCGATCGCAGTTCTCGCCCTAGTGGGACTCCTTCTCGTGTGGGTAGT GCGAAAGTACTCCAAGCCCCGCAACTTTCCACCCGGTAAGCTCGGTCAAT GCCTCCAAGATCTGATATCCTTGGAGACAATGAGTGGACCTGATGCATTT TCCAGGGCCTCCATGGGTGCCGTTTTTCGGGAGTATGCCTTTCCTCCCCA AAATTGGCTCACCTTTGTCGCTGAGCTGGAAGGAGATGACTGAAAGGTAC GTGAAAACCGTCCTCGCGGGCCACGAATCGGGTTCGGGAAAAGGTAACCA GCCAAGGCCAAAAAAGCTGTTGTGTTGTTGTTTCTAAATGAGGGAAACTG GAGCGAAGCGAAAGATGATCGATGTCTATCTTTTTAATAGGATCGAGCGA AAAACTAAATTTGTCACGGTTGAAAATAATCGAAACGCGGCTATTCGTTT TATAGGTCTCTCAAGATGTAGAAATTTCCCAAGCCTTCTCGTAGTTTTTT ACTCAGTACAGTTTTCTTGTAATATACGTATAACAATCGTAAAAAATCAC TCTTTCCCTTGGAAACTAGAAAGACTTGCAGAAACTAGGCAAAACAGTTA TATATAGCAGCATACAAAGGAAATTCAAGGAAACATGCGGTATACGTTGG GAAAACGATCTACAGGCGTGGTTTTCTATTTTTAGTATACTACTACGACT TGCTTTAGCATGTAAACAACGATGTGAGATCAAATCCAAATTAGGCCGAT TATGCCTACGTCCAGATCACGAAACTCATGGAATGGGGAAGAATCATTAG AGATGGGCACGCCTCTGTACCTAGTTGTTAATAGGAAACTCCAGATAACC AGCATCAAAAATGGCAAGCAAAAAAGTGAGTTCATACGTAGTTCTTTAGT CTCCATGGATTGATTGCTTTCCTCTTTAGGGCTTGGCCAAAAACCCTAAT CCAGACCGGATTAGGGTTTTTGGTGGAATGTGCCTAGGTTGCATCAGAGG GATAGCAGTATCGTTTTTTGCCTTTGGGCGTATTTAGAACAGGAACTATT TAATATGTGCAAGGTATTTGTCAATAATAAATATAAGTAGGGTTGGAAAA TTAATGTGTACAACCAATGCCGTACTTGCATTTGTCAAGTAAAGAGAAAA CAGGCACCGATGGTCATATAACAGTTTCCGCCATTTTGATTGGTTGCAAA ATGTCCGATACATATGGGGGCCTTCAGTCCTTCGTTTTGCATGTATTGTA GTAAAATCAAAGAATCAACCATTTATTTCGCTGTTACTTCAAAACAAGTC TTCTAACTGAAAATCGCATGAAAAGGGGCTATGGATGGTCCACCTTATGG TACACACTTCATCGAATATAGGGGCTACTCTTATAAGACTAGTTACACCT TTCTGAAACTTTTCATAGGCTTTACTTTTTAATAGTTGTACTCTCCCACT TGATGGCATTACTGTTGAAATGAAATTAACACAGCTTAGGTCTAGATAGC TGTGCATGTTCCCAGACAGGGCCCATGACTTGAGAAGACATGTTATATTC GTTCGACATAATTTAAGTAGGAGCCCATATCTCTTTGCCCCATCTGGCAA ATCGTCCCATCCTTACAGAATTCGGGTAAATACATCACACCTTGACATCG GCTGGCGACGACAGCGATTGCGCGTCTCTGTGTCTACCCCTTTAGGTTGC ATGGCTCTTGAAGTGATTCTCACCAAGACGCCTGAGCCGCATATGATCGG GAGGCTGTTAAGAAATGTATTAGTGTTGGGAAAGTTTCGGAAATGTATGA TAGCTTTTCCCGATCCCTGCACAGGTATTTTACAATGCATGTTTCTTTGT CAGGTATGGAAAAATTGTGGGGTGCATGTTGGGTCCCTTTCCGACGGTGG TTGTTTACGACTACAACCTTATCAAGGAGATCTTCAACAAGGATGAGTTC TGTGGACGACAAGGAACCTTTGCTCACATGTATCGGATGCTGGGCAAGAG GCAAGGCCTTCTCTTCAACGAAGGTCCCGGTTGGAAGTCGCACAGACGAT TCACCCTGAAGAATTTGCGAGATCTAGGCTTTGGAAAGAAGTCCATGGAG GACAATCTGTGCTTCGAAGCCAATCAGATTTGTGACAAAATGGAGGCCAC CCTAGGCAAGCCCCTGGAAGTGAAGCACGTCTTCAACGTGGCTGTTCTTA ACATCTTGTGGAAATTGGTGGCCAACCGCAGGTAAGCTTGGGCGTGGAAT GCAACACTTTGACGGGATCGCAAGGCAATCAAACCTGACTTTCGTCTTCT TCACAAATAGGTATGACTTGGATGATCCCATGCTGCTCAAATGTGTCAGT GCTATTGATGCATCGCTGCAGGGTAAAAATATCAGCGTCATCACAGTCAT GCCCTGGCTCAGACACATCGCTCCCGTCCGCTCCGGGTGGGTGGCCTACA AATGGGTGAGCAAGTCAAAATACCAGGGCTGCGAATGGTTTCATTGTTTA ATGGGTCAATTTGTCCTCCTAGTTCTCGGACGAACTCGTTGGCTATGTCA AGGACCTAATGAAGGAGCGAGGTGGAATAAAGACAGCCGCTAAAGAGGAG TCCGACGGCGATTTTATCACGGCATACTCCAAACACGCTGTCCAATCTGG GGATCCGGAGTTTAACGGTAATCCTTGCGCAATAAGTGAATGATTGTTCA TACTTGAGCCCACCATGATTGACTATTATCGGTATCGTATTCCAGAGAAT GCCTTGATGTCTACAATCATCGACATGTTTGCGGCTGGCTCGGATACTAC GGCTAACACACTAGCTTGGGCTGTCCTGTACATGATACTTCATCCCGAAT GCCACGAGAAGGTTCAACGAGAGATTGACGATGTCCTGATGGGGAAAGAG CCCGTTCTGGACGACAAAGCCCGGTAAAATTCGGCTCTCAATCCAACCCG CAGACCCTTCCTTCAACTGGCTCTGATCTCTTTGAACAGATTACCATACA CGGAGGCGGTCATTGCAGAGATCCAACGCAAGTCCTGCATTGTTCCCGGC GGGATTCCCCATGTCACTCTCAAAGACACGACGATTGGAAGCTATCCAAT TCCCAAAGGCACGCTCGTGCTTGGTCCTTTGTACTTCATCATGCACGATC CAGACTATTGGAATGAACCCGAGTCCTTCAAGCCCGATCGGTTCATCGAG GATGGCAAGTTCAAGAAAGACGAGCGTCTTACAATCTTCGGCATTGGTGA GGTCAAGTGTTGGTTTCCGGGTATCTTCTGTACTGTATATGTTAACACAC TTACGATGACTTAGGTCAGGGTGTTATTAACTTGGCCATTTCAATCGGTC ATCATTTTCGAGATCCAAACCTTGGGAACTTGAAGGTGATGTTGGATTTT CGTTGAATGTCGCTTTCAAAACTGGCTCACTTTCTGTCTTCCGACTCCTC TTTTATTAAATAATATACCATCCCGACGAAATGAATTTTTGAAAATGTGC TCGCTCTTTTGTACTGTCAAACCGTCTGATCTGGGGTCGGAATGCTTCTC AAGTTCCACTTCCAAAGTCACCCAAAGGGCTGGATTGGAACATTCCTAAA AAAATGTCTCAATAATGTCGCTTTCAAATAGGAAAAAAATGTCTGAAACG TGACCCTTTTCAAGTCGATAGAATGCGCCCAATCGGCCAGTTTCATGGCC AGCCCTAAATCAGACCGTTGGGCGGAATCGGACGGGTTTAAACTCAAAAC ATATATTTCGTGGTAGATATTGACAGTAGAGAAAATTAATAGAAAGACAT GATGACTTTCAATTCAATACATTATTGGCGAGCAGATTCGACTAGCATTC GTCGAATGAGGAGTTGGGACAGTGATGAAACTGAACATGGGTCTGCTGGT TCCCATGACTGATCAGCCTGGGGCTTGGGGTATCTTCAGTTGGGGCCGAA CTTGAAGCCTTCAGTTTTTCTCCTGGTCTCGAAGTCCGCTTTTGGGCTGG CGATCAACAGCGTGGGCCCACCTCGGCTACGGATTGATTCGTATGTCCTT TTCCCGTGCTGCGGCCTTTGAGCTCTGGTCCGAAAGACTTTTTGGGGGAC GGTACCCTAACTGGTGACGCAATTGGGCGATTTCTTGCCACCTGCGTGTC CATAAGGGGGGAGTCAAGTGTAGCACTCAAATCCGGGGTGTGTGGGCCGA GCCGAGGCTGAAGCTTGGGCGTTTGGCCGAGGGCCAGACTCGGCGACAGA CTCGGGCGAGCGGGTCAAATACGCATACTTAATATCAATATTCAACATCA AATACTTATTTCGCAGACGGCAGTTGTTAAAGCCGTTAACTTCCTGACGC TCGAGCTGGGGTAAATGGCTTCTAGGTTCTAAGGCGCGGCCGTCCGATGG GTTGGGGTCATGACCACGGCCGCAGGTGGGGGTCAAAGGGCACCGAGACC ACTTTTTTGGTAATGGTGGTGATAAGGCCATGCTGTCTTATCTGGAAGTT GTTGGCGCTTAAATATGAGCGCTGGTGTCAACTGTTGCCTAACCATGCTT TAGATCTGAGGGTGACCGAAACTGACTACCTCATGTATTGAAGTTATCAA CGAACCGGGATTAAAGCTGGTGTATTTATTTACCATCCCTCAGCAGCTAG GCAATGATTGCTTTCTAGGCCAAAATGTATCGAAATGGTGCCGGCCAGGG CCATTTCATCACTCAAGTTTAGTTCATTAGAACGTTAACCCAGTTAGTCT CTAAGTTTGACCATCAAGTAGTCACACTGACAGAACAGCTTAATAGAGGA ACTTGCCAATCTTTTTGTGTGAATGTTGAACTCTACCCACGACGGAAGTT AACCAATTTAATAATGTTTCAAGCTTATGTTCAATAGTTACGATTTGTCA GCGTATGCAGAGCATTGTTCTTATAATTAAAAATGGCAATGTTGAAATAT GCAATATTGAACCTAACGCGTGCCCTGAAAAAACCCTTGACGACCAAGAA TCATATGAAAGTTCCATGCGATGTGTGTCAAAATACATAAAGATGAAAAG TTAAATGGACAATTTTTTAAAATTATTTTTTAATTTTCGAGTGTTTACCA AGACTTTATTATTCACATATCGTATGTTAAGCGGTGGTAGTTCACATGCA CGTGAACTTAATCAAAGTCGGACTTGGCAACGACTGTTCTTATTTCAAGG ATAATATACACATGAGCCGTATATTTATCTATTTAATTTGTTTATATATA CTGGCCAAAACGCCTACCAATTCATACGATATGTGAATAATAAAGTCTTG GTAAACACTCGAAAATTAAAAAATAATTTTAAAAAATTGTCCATTTAACT TTTCATCTTTATGTATTTTGACNGTTTATTATTAAATTTAAATACATGGT TAATGTTAAGTTTACCTGACCTATACATTATGAACTGTTATCATTGATAA TTCTCACATGGTTGCAAAGCATTCTGACACTCTTAACAGCCATGTGGGCC ATATTTATGTATTAACAGGAAGCCTAATACTCTAGTTTTAAACTGATTTG CTAAAGTTCGAGTTTAGCTTAAACTCTTCTTTTGATTGTTTCGTGTGCAA ATCATTGATATTAAACTTTCCATTTTCCAAGAAGTTTTGATTCCATTAGC ATTCCACATGAATCCCAAATTCTGTTTGGGGAGGAATTGTCCATTTAAAT CACAACTTGAACGAGGTACATCTTAGTGGGCAAAAGGTAGATCAGTGAAT AAAACATGCTGGAAGCAATATATTCATACAACAATCAAATCCAGCGGACT GAATTGATTACATTATTCCCCTCATGAGAAATAATGAAAATTTAGTACAT ATCTGCTATACCTGCCGTTTGTTTTTTGGGAGTTTTTTCAGCTGACACCC TTCAGGGCCGACTGCCCAGGCTGCTTTACTCTGGTAATGAAGGTACTCTA ATCCTACCTATCGAACCCGTGTTACACTCATATTTTGTGCAATAGGGGGC GCTTCGAGGTGAGCTTGTGTATAAGTTGAAAATCGAGAGAGTATCACCAT GTTCCATGAAAAAACAGTACCAGAGTTGATTTGCATAGTAATATGGGGAG GGTGTAAGCAATCTATACTATAATGGAGCTTATTCTGTTTGTCCGTTCGT GTGTTTGTGTGTTTGTGTGTTTGTCTGTCCCACGATTTTCTCAACAACGG CGAAATAGATGCGGGTGAAAATTTCAGGGCACCTCCTGCCCGCCCCCAGG ATGTGCCGTTCACTTTTTGTTTTTCAACTTTACACACCTAACCACTTAAA AGTGTGTTTTAAAACATTTTCGGCTCCGTTTGCCCGGAGGGTAAGTTTCG CTCGGCCACGACGGGCGCGAAATTCGAAGCGAGTTCGAGAAGCCAAACTC GGCCGGAGGCCGAGCATGGGCCGGATGCCGGGGATGGGCCGGAGGCCCAA CAAGTGTGTGCGAGAAGTGAAACTTGGTCGAAGGCCGGGGATGGGCCGAA GGCTGGGGATGGGCCGAAGGCCCAACATAGCCTTCCGCAGGAACTAGGAA AAAGACGCCCGTAGGGCGTCCTTTTTGCTAGTGATTGTTAAAGATAGGTG ATCAAAAAATATTCAATGATCAGAAAGATCGAAAATCAACACAAACATAC GCGAGATGGACTGAGCAAACTGTAATTAATGATAATGCTTTATTAAAACG GCAAAAACCGATTATCTTGTACAGGATAAATAAATCCATGTCAAATATAA ACCTAATTAAGTGATGGGCCTTCGGGCTTAGCTTTCCATTACTTTTGTTT AATGGCGCGGTTTGACCACCACGTGGAAAGTTTCGGGGCTGAGGATGAAT CCGGAGATGTATTTGTCCACCGGCGGAGGATGTTCAGGTGAGGCCGTAAT GTGAAGTCGTTGGATGATCCTGATGAAGATGATGAAAAGCTCGTTTCGTG CCAGCTGTTCTCCCAAACAGTATCGCTTGCCTGAGGGAGAAGGAATGCGA GATTGATAAAGTTCCATGCCCGAGCTAATCCAGTGACTATCAAGACTCAA TATGAGAATATGCTTAATTTTCGTCGGGGATATTGGCTTGCAAATTAGTA TAATTAGCCTGTACGTAGTACCCGTCAATAAGAGTATAGGGAAGGATGCT CCAGTTGTCTAACTGTGCGCGATCCTTGTTGGACCAACATCGACCCCTTC AATCACTTGGGATGAGTGTGTCGCCATTTTTTTTACAACTTATGAAATAA CATTGTTAACGCATTTCAGTTTCCATGTGTTTGAACAACACTGGTGGCAA GATAAATCGAAAATGTTGATGTTTTGCAAAAAATATAAGAGTAATTGAAA CATTTGGATTAGTTAACAAGTCAGCGATTGACAGCTGAGCCACAGCCCAC TCGAGGGCTTCCCTAAAGCAGGCCTATAATATAGGCCATACATGAGAATC TCCATCTCTGGAATAAAAGCCTGACTGCAGTCACAAAGAGCAGTAGAATG CCGATTTTCACCTTGTCAAGTTTCCCGCATAAGAATACAAAAATATCACC GGTGTGCTCAACCAGTCATGTTGACATCCCGACGAAATGCCCTATACTAT GAAACCGTCATGATTTCGGCATGAATGTTCTTTTGCTGGTCTCACCTAGC CAACACCGAGAAACTTTTCAGCCAACGGGCTGGATTTGAACATTTCTTTA ATCAGCTGGTGGCCACAAATTTATGTGTACTGTCATAACGTCTTGAATTG AGCACTTAAGTTAGTTTGGCAATCAGAATGAATAACATCCCAGAGGATTG TGTCAAACTGGCAGGATTGAAATATTAAGCGGTGGTAGTTCACATGCACG TGAACTTAATCAAAGTCGGACTTGGCAACGACTGTTCTTATTTCAAGGAT AATATACACATGAGCCGTATATTTATCTATTTAATTTGTTTATATATACT GGCCAAAACGCCTACCAATTCATACGATATGTGAATAATAAAGTCTTGGT AAACACTCGAAAATTAAAAAATAAGTTTAAAAAATTGTCCATATAACTTT TTATCTTTATGTATTTTGACATAATTTTTTGACATGTATGTCATATGAAA GTTCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNAATTTGCATCTAAAAGGTTAAAGACTTTAAACAAATTA ATTGATCTCAAAAGTTAAAACCTTCAAAAAAGTGCATAACTTAAAAAACT CATACCAAAAAGTTGACTCATTCTACAAAGTCTACTCTTTCTACTCATTC TACGAATTCTACTCATTCTACGAATTCTACAAAGTTTACTCATTCTACAA AGTCAACTTATTCTAAAAAGTGAGTTACTTCTAAGAAGTCGGGTCATTCT TGATGGTAAATATCTTATAAATTTAAATTCATTCCTAATAGTAAATAACT TGTGAAAGTTCACTAATTCTGAAAGGAAATCACTTTTAACAAGATCACTA ATTCTAAAAAGTCAATAACTTTTGATTCATTCACTGACTTTAAAAGGTTT TCTGCAGATTTAACTCATCTCTAAAGGTTAATATATATACAAGGAATACA TTTCAAACTAGTTGTTGACCTTTGTTGACCTCTCAAAGGGTTTAAAATAG AAAAAAAATAAAAAGTAAGAAATCCAATGTTTCTACAGCAACATTTTCCT CTGTTGAATTGAGAGAGATACCCCTCTCTTGGCGATTTTGAATTTGCGGC GCACTTTTCAGTCTGCTGATAAAACTCCCATAGGAGCGAGGTTGCTTTAC TATGGTAATACAGGTACACTAGGTAGGATGATATTCTTTATTGCAAGAGA CACGAGTATATATAGGTGCTGGAGGTGGTGCACCAAGTACAAGCGGGAGC ACCACCTCCAGCGTGACCAGACCACTCACAATGAGCCATTCACAGCTTAC CTCTGTGTGTCTCCCGACCTCGGTTACCATTCGAATATATACTAGTTATA CATTCACATTCCACATGGCGCATTCGGTAGTTTTAGTTTTGTGAACGCGC TCCCACACTGCCCAAAACTGCTTCCCTTCCCTCGCCATCACCGTAGCCCA ACCCCAAGACCTGTGATCCAGTTTGGCCCCCTATGGACCACCCCCAGGAC CTCTGCCTGTTCGCCCCCCATGGCCGTCGCCACGTTCATGGCCCTAGCTA CCTCCGCTGTGGCCCTCTGCCCGATTTGTGGCCATCGCCACCTTCGCCGT GGCCATCGCCACCTCCACCGTCGCCCTTGCCACCATTGTGGCCCTCGCCA CGTGTGGCTCTCGCCGCCTCCACTGTTGCCGTCGTCACCTCCCTATTATA TTCACGTATAAATAATATGTATAAGTATATAATTACGCTAAAATGATTTT TTCAGTTTCATTAATAACAAGGTTATCTATACTATAATGGAGCTGTTTCT GTTTGTACATATGTTTGTTTGTTTGTTTGTTTGTTTGTTTGTTTGTTTGT TTGTTTGTTTGTTTGTTTGTTTGTTTGTTTGTTTGTCTGTCGCACGTTTT CTCAGGATCGGCGGAATAGAGGGAGCCGATTTTTTCAAGGAAGCTCGAGA CTACGACCAAGGTGTACCCTAACACGTTTGGATTTTTAAGGTTACACACG ATGAGGTATAAGATGAGATATGAATTATACTTTATTGAAAGAGACTGACA CTATTTATAGATGGTGGTTAAGGAACAAGAGGGAGCGTGGTCCCAGTGTG ACTAGACCTCACACAGGCCAAAGGCCCAATATAGCCTTCCGCAGGAACTA GGAAAAAGACCTCTGTAGGGCGACCTTTTTGCTAGGGTGGACAAAGCTAC CCACGTGGGGCCGAAAGTGCATCTATGAGGCGTTAAAAACCGACTGCAGT AGGCTAGAAGTTATTTCAAGCGAGCTTGTACAAAATGACAATGTATCTTA TTGGCCCTTATTTCATTAAAAAACATTGCTGGGGTGAAAACCGTAGAGAG GATCGTCCTATTCTAGACAATACTTCATAGATTTTTGAGTTTACACGGAG ATCGAAACTTTCCCGCGGCTCACTGACGTCACGTTCTAGCAGTTCAACAG CAAAAGCTGTTCTCTGCGGGCATACTCGATGTACGCGGGTCCTATCCCAG GTGCCCTATTCACTAACTTTGGAAGATAAAAGATAAAGCCCATGTTTACT TTGCTTTTCGCCTACTTCCATTTTTCACATTCCAAGATCACTACGTTCCG ATGCCTCGACCTGGGTTCCCTTTCAAGTTCTAGTTCAAACGATAATCGAT TCAGTGCAGACCCAGCATGTCGATCGCAGTTCTCACCCTCTTGGGACTCC TTCTCCTGTGGGTGTTACGAAAGTGCTCGAAACCCCGCAACTTCCCACCA GGTAAGTTCGGCCAATGCTGGCAGCGTAAGGTGTCATTTGCAAATGGAAC CATCTGTTCCGTGTTCCAGGGCCTACATGGGTGCCCGTTTTTGGGAGTAT GCCATTCTTCCCCAAAATAGGCTCGCCAACGACGCTGCGATGGAAGTACT TTACGGAAAGGTGCGTGGGATGCTCTTGGGCTGCGATTGTCAGCATTGCA AACTAGTGTACTCTAGTATGTAGCTATATCTCTTGCTTAGGTATGGAAAA ATTGTGGGCTGCATGTTGGGTCCCTTCCCGTCGGTAACAGTTTATGACTA CAACCTTATCAAGGAGATCTTCAACAAGGATGAGTTCTGTGGACGACCTG GGACCTTTGCCCACATGTATCGGATGTTGGGCAAGAGGCAGGGCCTTCTC TTCAACGAAGGCCACAGTTGGAAGTCTCACAGACGATTTTCCCTGAAGAA TTTGAGGGATCTGGGCTTTGGGAAGAAATCCATGGAGGACAATCTGTCCT TCGAAGCCAATCAGATTTGCGACAAGATGGAGGCCAGCCAAGGCAAGCCC CTGGAAGTGAGGCATGTCTTCAACGTGGCTGTTCTAAACATCCTGTGGAA ATTGGTGGCCAACCGCAGGTAAGCTTGGGCGTGGAATGCAACACTTTGAC GGGATCGCAAGGCAACCAAACCTGACTTGGGTCTTCTTCACAAAAAGGTA TGACTTGGATGATCCCATGCTGCTCAAATGTGTCAGTGCCATTGATGCAT CCGTCCAAGGTGAAAAAATCATGCTCATCACCCTAATGCCCTGGCTCAGA CACATCGCTCCAGTCCGCTCCGGGTGGGTGGCCTACAAAAAGGTATGGAG CACAAAACACCAAGGCTGCAAATGGTTTCATTGTTTAATGGGTCCNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCAAGGTGAAAA AATCATGCTCATCACCCTAATGCCCTGGCTCAGACACATCGCTCCCGTCC GCTCCGGGTGGGTGGCCTACAAATGGGTGAGCAGCACAAAATACCAGGGC TGCGAATGGTTTCATCCTTTAATGGGTCCATTTGTCCTCCTAGTTCTCGG ACGAACTCGTTGGCTATGTCAAGGACCTAATGAAGCAGCGAGGTGGAATA GAGACAGCCGCCAAAGAGGAGTCCGACGGTGACTTCATCACAGCATACTC CAAACACGCGGTCCAATCTGGCGACCCAGACTTTAACGGTAATCCTTGCA CAATAAGTGCTTAGTGTTTAATTGCTTAGTACGAGATGAATTGTTTTGGC TCTCATGTTCCTTCCAGAAAACGCCTTGATGGCCACGGTCATTGACATGT TTGCGGCTGGCTCTGATACAACGGCGAATACGCTATCCTGGGCCGTCCTG TACATGGTTCTCCATCCTGAATGCCAGGAGAAGGTTCAACGAGAGATTGA CGATGTCCTGATGGGGAAAGAGCCCGTTCTGGATGACAAAGCCAGGTGAG ATTCGGCTCTCAATCCAATCCCAGACCCTCCTAAAAGCTGGATCGATCTC TTTGAACAGATTACCATACACGGAGGCGGTCATTGCAGAGATTCAACGGA AGTCCTGCATTGTTCCCAGCGGGATTCCCCATGTCACTCTCAAGGACACG ACGATTGGAAGCTATCAAATTCCCAAAGGCACTTTTGTAATTGGGCCTCT CTACTTCTTCATGCACGATCCCGACTATTGGAATGAACCTGAGTCCTTCA AGCCCGATCGGTTCATCAAGGATGGCAAGTTCAAGAAAGACGAGCGTCTT ACAATCTTCGGCATTGGTGAGTTCATAATGCGTGAAAATGTGTCCAATAG TGTGACCCACGCCCTCCTTTTCCCGGCCTTTGACCTTTTCTGCTGCATAT TCACATACATATTGACCCACGCTCTCCATTTGTTGATTTAGACGCTCAGA TAATACATGCATGACTTGTATGTGCCTAATCACCTATTAGTTTGCTACAG ATTTACTGGAGAGTTTGCCTTAACGTCTTATTTTTGGGATCAGGAGGGAA GCAGGGGGTGTCCCACTTAAATTGAGCCTCGCACATGTGTTCATAACCTG ATGAGGCACTCGTCAAAATGAACACTTTTTAATTTATGAGGGTAAGGAAA CCCGCGACGACTGCTTTATAACCCCCCAAGCTATTATGTTACGGGGTGCG TATGTTATATTAGGTGCGTACGGGGCTTTGTCCTCTATAGAAGACAGTGA AAAATCCAAATTAGAGGACAAATAAGGAGTTTTTTTCGGTTGCAGGGGAA CTCATTCGCAATAGTCCATTTGAAAAAAGCTGTGTCGAATCTCAGCACGT AATTTACAGTATGTTATAAAATTCTTTTTTCGGGTTAAACTTCGGTCTTT TTCCAATTTTTTCTTTTCTAATAGTCTGACAGACAATCCAACTACTGTAC ATAAAAAATGTTGTCCTTTATGAAACAAATGTAATATTTTGAGAAAAAGG GTTACCATTGTGGGGAAAAATATATTGTTGAAAGGGACCAGATAAGCCCA TTTTGATATAAACAAAAGTTTATTACTGCAAACCAAATGTGACACGCACA GTTCTGTTCGTTTCTCAATGTCGAATATTTGACGTATTATCAAGTAATAT TCGACACTTTTTTAGATTTTTCGAATTCTGAACCACCAATTTTAGTCAAA TCCAAAACATTTTCGTTGCTTTTGGTAGATCTTCTTTTACTCAATTCACA TGTGTTTTTTTTCTTTAGCAGGCTACTACACAAATAGTCCTAGAAAAAAG TTATCATGTTTACATCCCTTTTATTTGTTTCAAAACTGTCGTTTTCCAAC AATTTCTTCGAGTCCTACTTTTTACTTGATGTTAATGCGCATACATATCA GTCATAAATATTAATTCTCGAAAAACAATTTGAACACATTTTGAATTGGG ATATTTTTTCGTGAGTTCCTTCGTCAGTGTCGTCAGTTGCATCCTCCCAT GGTGGGCTATTTTTGTGACTTGGCGATTTTTTTCGAGGTTTCACTCTTTT TTTCCCTGGAAGGCTCCTTTTTCAGTCTTTTTTGCTTGTTCAATTTATTT TTTCGGGTGTTTCCAGCGCTTCTTTGGGCATTTACTCCTTTTTTACACCA CTTCTTATGACATTGCATCTATTCAGGCCCAAACAATGCTAAAAAAACAA TCATAAAAGCCATTTTTGAGGTGGTATTGTTAGCAAAAGCCAATCCATCG GTTAATTCCACATATTCACACATTTTGCCACTTCGTCTCGCCGAGTATGA CATATCTGCCTTTTTTGCGTCCCCGTTACGCACATTTTTTTCTGTAGGTC GAAATACGTTGTTTACGTATTCCCTGGGGATAGCACACAGGTACAACAAG GGTAAAAAATGCGTACAGTAGGTTTGCATTTTTAAGTGGGAGTGTCGTCT AACTCGAGCTGAGCATCTTGCTCGAACTGCCGGATATAAATGCATGCATA TATCTTGACACCCACTACCTTGCTTAGACCATGGAGTACTAGAATCACCT GGAGGTTGCACAGAACGTAAAATGTGTCCAAAGACGGCATGGTTCAGGAA GCTCAAAACCCGTTAATGCCATCAATTGACAGGCGGGATTTACGGGGACA TTTCACCCAGTTCTTTAGGGTTTCAGAGTGACTAGTTGATGGACTCTTAA ACCCTACAGAACTGGTAGAAATGTCATGGGCACCTCCAGTCCGTCAAATG ATTACATTAACGGCTTTCGAGCTATCTGAACCATGCCGTAATTGGACACA TTTTTCGTTCTGTGCAACCTCCAGGTGATTCTAGTACTCCATGCTTTGAC CCACTCAATCAATCTCATATTTCTTCTGCCTCAGGCAAGCGATACTGTTT GGGAGAACAGTTGGCGCGAAACGAGCTTTTCATCATCTTCATCAGGATCA TGCAACGACTTGACATTACGGCCTCACCCGAACATCCTCCGCCAGTGGAC AAATATATCACCGGATTCATCCTCAGTCCCGAAACATTCCACGTGGTGGT CAAACCGCGCCATTGAGGAACACTAATGGAAAGCCTAGCTTGAAAGGATT GATTTATCCTATGCAATATTTAATGCTTACTTTATCCTTGGCATTCAACT TTGATTTTTAATCATTCACAATTTTGTGCGTTTACTTAGCCCCCCATGAA ACGGCATCATTGTACATATGCTTGGATTCTTTTTCTTGCATTTACGCGCA TTCCAATCGAGACGGACTTTTTGCCAAATTAGAAACCGGGCGCAAAAACC TTTCGAGGTTTAAAAGTCGCTGGGATGTAAACAACGAAGGCGCTGATAAT TCGTGATACAACCAAAGTCCTCAATCTTGATGGTTATCCATAAATGAGTG CAGCAAAACAACTCTTATTAGAAGTGATACCAAGGCGAACCTGAGCGATT TGAACCTAAGCGACCCTCAGGCCTGGCCAACAATAGTAAATGTAATACTC ATAATAATATTTTAAGTATACTTACATAATAAAAAGTAGGCCGCTGGTTA GCTTCCCTAATCCTCCGCCAAGCATTGACATACTGCCACAACCCTACTGA AATGGAATCTATTTGTTTCTTGTGGGATGCAATTGCCAGCATTTGTCGTT TTTTTGTTGACGGTTTCAATAGTGACATTTTTTGTCCGTGTGTGTTATCG CGTTACCGGAGAATTTCTGTGGGCCGGGAATTCATGGAACCACCAACAGG TGGAAGGGGGAATCCGCGAGGGAGGCGAAAGGAACCAAGAAGACCGATAA AAAGGCCCGAGATCCAGGCAGAACCCTGTCAGTCTGAGTCAAACAGGTTC TGGTGAGACACTCGGGACTGAAAAGATATTGATCAGGAACTTACTCTCTC GGAACGACACTCCCAAGAGGAAATCTAAAGGTGAGTTTTCCAATTATGCC TACTGATATTACTTGAGACCACACGGCTACTTGGCCCATATGATCCGCCT GAGTCGGTAGCAAACCTGCTTGAATGGTTTCATGTCTTTGTCTTCACATC GCCAGGTGTTGTGTTCTCGCACCTTCCGGTGGTTTCGTGTTCACACCATG GACAGGCATCCATGGGAACACAGGGCCCACTGATGTTAGTAGCTAATTTA GCTAGTCGCCGTGCAGCCCCGTACAATCCAGCTCCAACCACTACTTGAAT TTGTGGGGAACCAGAAGGGACCCTTCCTCAAGATGTGGCCGCACCTGTGT GTTTAGTAGAAAAACGCATTTTTATGAGTATGTGCAACAGAATGCAAGAA CGGATTTTGGTAATGTGCTACTTTAGCCCCAAGAGCTTCCGTGGGATATT TTCCCCCATTGCGCAGTGAGCGTGACCACTTAGAGTGGCCTAAAATCTAC CAACCTTCCCCGGCAATTTTAAACATCCTAGTGCCTTCTTCTTTTTTCTC GTCCAAAGAACGAGGAGATTTGTGACAGGCTAGTAGGTATTGTGGGGAAT GGCCAGTTACCAAGATTGGTCCAGAACACGCACTCAAACTGAGTAATCTT TACATAGATGGGATGAAAATGTCTTGGGGTCTTTCATTACTGGAAGAAAG TGTTCTTTGAGCTCAAAGTTTAACCAGCTGAGGATAAATTCTGGGGTTGG ATTATCTCATTAAATTCGTGATCATGATAATCACTTGGTGAGATGCTCAC AAACTATAGGCCAACGCCATAAATGAAGAATTGGTAACAGGAATGGCCAA GATTTGGACGGAGGTGAAGGGGTAGATGGGAATCTGAACCTCTTTTTTCA GACTCGATCGATCCCCGGTCACTCGGATAATAACAACGTTGGTCTCGCAG GTCACAGTACCTAGGCACGCAATGTGGGAATATCTCTCGCACAACCTCTT GGGGCTCAACTAGAACTTTACCCGGATTTTTCTCAATATGGCAATTGGTG TGAAGATTTCTCCTCGGAGTGGACGGTATACTGTTTTGGGTCCAGAATCC TTCGGGAAGGGGCACAAAACACGTCCGGCTATCACTCGTCTATTTTGTCT CTGTTCAATCACTAGCAAGGCAATCAATTTGTGGGAGCATCTAAAACAAT TATAGGGAATTGGCACGGGGGTTCTGGGATTCCAATAGACTGTCATATTT CGTCCATCCAACACTAGTAGGGTAGTTGAGACTACAGAACTAGATATGCT ACAAATTGGCCAGCTGGACATGGTCAAATGCCAGGCAGCTGATCTGTATG ATGACCCAAACAGTTCTTTTACTCCCAAAGAGCGTGAGTGCGAAGTGTGA ACATGCATCAAAGTACTCATGGTCAATCTTGGTAACCATTCAGTGGCATG CCAAATCTATTTCTGTTTTGAAATGTTTTTGGGCTTGGGAGACGCTTTAG TTTAATGTTCATTCTCTAACATAGGGCAAGATGGCCACAATTCGAACATT TGATGACATGAGGTTGCACGAGGAACGACTTGGAAATACCGAAACCATCA TTCATTTGATCTGGGGTGGCACTCTAGATCACAAAGCAGTAATAATATTG ACATGCCACTGTATGATTTCCAAGATTGACCATCTACTTTGATGCATGTT CACACTTAGCACTCACCCTCTTTGAGAGTAAAGGAATTCGCAATTCAGCT GAGGATCGAATCAGTGGTACGTTCACAGACAGAATGAAAGAGCACCGCTA TACCGCGGATGGGCAACCTTTTAGATGCCGCCCGGGCAAAACAATTCAGT TTCCATACAGTCATGGAACCCTGTACATCTGGAAGTATTACTCACGACTG TACATTGTCAGACTTGGGGCCAAACTCAAAAGTGACCCAATTTTCACATT CGAAATCTAGCATTAAAAAGCTGGAGCTGGTCGAAGTTTCCAATAACGAA AACGAATGTCAGATAATATTGCTAACTCTGGGCACTCTGGGAAGCTCTCA GCGATGCCAGGCTGGCCATATTCAGCCTATTAATGCTGCATTAGTTGTGA TTATCTTCTTTTGCAGCCAACTTTGACCTGAATGCATCTGCATTTCCGAT TTGAAAATCTGGTCACTTTTGACGTTGGCCCAAAGTCTGGCCAGCGTACG TAATTCTTCCATGTGTACAGGGTTCCATGATACAGTATACATATCCAGAA CTCCTACATGTTGACATTAGGGATTCTTATTCAGGAAAATGACGTAGGGA ACGCTTGTCCTTTTTTTGTAAATCGAGCTACCACAGATCAAGACTTGAGA TATTTTCTTAGTTATGTACATAAATACTCGCTGAGTGACGGCTGAGCAGT AGCAAATGAGCGAGTCATGTGTACCCTGTCAGACTCCGAGTCGATCTGGA GCGGAGCGCAAAATAATACGGAGCAACCTACTTAGAAGTTGTCATTGGGG CCCATTTTCTCGGGATCTCCTCGAAGCAACGATTTCTGCAAAACGATGAA CTTTATGAGGACGAACAAAAGGTGTTTTATTCTCAAACTAGCCCAAAATA TACTGTAATTGCTTAGGACCAACACAAAATAGGTAAGATATATATATTTT AGCTCTCATCTCATCAGGTAAGAATTATGAGGGCATCTCTGTTGCTCAAT GGTGGAAAGACAAAAGATCATACCGGTTTGATATGAAGAAAAGCAGAACA CCAAAATTTTGCGAAACATATCGATGCATCAAATGTCGATCCAACTCAAT ATCTATGCCCCGGAAATGAAGGTGATGAGAAACTTGCAAAAAGGGATTAT TTACGGTGGTCAAAAATGGCTTAAAAGGTGAACATTCCGGTGAAAATGTC AAATGTATTTGGACCCTTTTATTGAGCTTTTATGGACTATTTTCGCTGTT GTAAAAAATTATTGCATAACCTATTTTTGGCAAATATTATCCGATAATAT CTCAAAATGAATGAATTCTTCTGTAACTCCTCCTGCTCATCTTGAGGGGG TTCCTGACCTTTTCTTTCAACCAATTCACCTTTGTCGCGGCTGCCATTGT GAGTCCTGGGCAAACTGACAAGGAAAGGCTACTTGGTCCTGATTTTGGCT AAAATGGGATATTTTGGCAGATATTTTTTAATGGCAAAATTGTACGCGAT AGGGGGTGGAAAACGGGATTTTTTATCGCATTGTTACCAATAACGTTGAT TTATGCCATCATTCGCAACAAAATAGGCATTTTGGGTGAATGTGTCCTAA AAACTTGGTGAACACATTTTTCCCGGTGATTCACCTTCCAATCCGGGGCT TACTAGTTTCGAATATTGGCTATCGAAATTGGTAATGCTGATTCGATAAT CGATTTCGGCAGAGCCTTGGCAAATTATTCTGAAAAAAATCCCTGACTTC CACAGTTACAAGTTACAATTAGAGTTCGAACTATAATGTCAAGAAATCAA CAAAATATGCACAGTGAGACAAAACAAAACACGGAATATGTAGCTAAAGT GGCAAAATATGTTAATCATGTCCTCGTTGATATATTCCTTCGAACACCTG GTATAGCAATAGTGGGCGCAAATGTTAATGATGCATGAAAGCATTAATGA TGTTGCCAGATCCATTTTGGGCAAAAAGAGGACGGACCATATTAACGTAT CTTCTCTATTGCAGCGGGCAGGTTTGTCTTGCCTCAATGAGCTCACTGTG CATGCAGTGGCCATGGAGACGTGGCGAGCCTTCCACAGTCAAGATGGGCC AGATGGTTCGAGGAACGCCCTCGGCCAGGTTCTCTTCCCCTCCAACGTCG CCACGAGGTCTACCAGGTCGGAGACAGCAGGAGTTGTCTCACCGCATCTT CCCTACGCAGCCAACACCCTGGTAGACAACGGAATCGCCATGTGGAATAA GTTCCCAGCCCTGCGAGAAGCCAGTACCAGGCGGATGGCTTCAAGCGTGG CCAAGTCAATATCTAGATCGGCCCCCATATGATCGATGTTATTCAGTTCT GTTTTGGGCTGATGTTGGTACCTCCATTTGTACGATTTTTNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNGATGTTGGTACCTCCATTTGTACGATTTTTGCGATATTTGCGC TTTTTATTCTTTAGTGCCTTTTGTTGAGTTTAATTAGTTGTTGCTGTCTA AATATTGTTTGCCTTTTGTATTCTAATGTGTACGATTTTTCTCAGTTTGA ATTTTATAGTTTTGTAACCAACCATTGTCTGGTTAAGTTTCGCTAGCATT TATTGCGTATTGTTTAGTTCTTGTGTTTTTTGTTTGTTAGAAACATTTAT TGATTTGTATTCGCTGGCAAACATAAATTGTCTTTTTCGTATTGTACTAT TGTTTTGTTTTGTATGGTTTGCTCCAATGTTGTTCTGTTCCTGTTACTAC TTAATGTGTATATTTATATAAATGGCCCTAACACTATTGACTACAGTAGT ATTCGTATGCTAAGTGTTGACTCTGGGGCAAATAAACCTATTTCTTTTGT ATGTAGGAAACAAACGATTACACACAGTAGGCTAACACATCATTCAGGCT GCACACTTGGCATCTTGATCCAAGTTTCTAGCCTTCCTACAATTTTTTTT TTGTGGTTACTGTGAGGTAATTTAGTAATTTGCCCTTCCGGTCTAGCATA CCGAAGTGATACTCATCCGCTCCATCTCAAGCACAGGGCAGGTGAATGGA GGTTTGGTCCTTTTCCAGATACAGGGCACATTGCGGAGAGGCACTCCGCC AGTGTGCCAGGTGTGCCGCGAACAAGCCGTGTCCAGTGCTCATTTGGACC AATGCACTGAGTTTCCACCGAGAAAATTGAATCAGGTGCTTGAGATTAGG GCTAGGCGTGGTTATTAGAGTCTTAGTGACCTTACAAGGCGCTTTCGAGT CCCACCTCCTCTGCCAAACTCTCTTTAAGTGGTGTGATACACAGGTTCGT GCCCTACTTTTGGAAATACCCACCCTGCTCCCTGCTGGTGGTTGGTCTAG CCAATCCACCCCTAGCCAATCGATCGGCCACCTCATTCCCGGAACGGTTA GCGTTTCCCCTAATCCACGCGATCTGAACAGGGGCTATCTGTTTTTTTAT GAGGTACTTGACTGAACCAACGAGTTCACTTGTCACATATTTGCCCCGAG AGCTCCCTGGCCCGACTGAGAGTCAGTTGCCAACTAGTGTCAAACTTAGC TAAAACACGTAAAAAATAACAGAATCATTCGGCAGTGAAAGTTAAGAATT CTGGGATTCAAGGATTTATTTATCGCTCAATTCATCATCTTCTCTATACG ATTTACCACCTTTGATCGCATCAAGTTGCATCTGCGTTGGCTCTTCATTC GCAAGGCTGAATCTAACTTTGTACTTTCAACAGGAGTGTATAACGTATAT AGATGGACAACAAAATAGCACTCGAGTGGGATCGTCAAAGGTGGTCAAGG CCGGCCAACGGAGATCAGTTTTCCTAAACATCATGTCAACGACACTAATC GATATGATAGCTGACATGACGTAAAGTGGGAAATTTATTGACTTTAACAC ACCTTTGATGAAGAGGCTCCCAATCTCGCCCCGAGGACGACTCCCTTGTC TACGTCAATGGGGTGCAGATCATATTGGGCCAGATGTCCGGCTAACTGGA TGCATATAAGAGGGCGCCTTCGGAGAAATGGGTGGAACTCACACACGTCC GTACTTTGGTGCCCGGAATGAATAAAATAGCTCTACAAGTGAATATGTTG GGAAGATAAAGCCTATGTAGCCTATGTAGCGCTTTAACGATCCGAGGGGC CGGTGTCCATGAGTAATTTTGTTATTGGTAGGGAAGCAAGTCTTTATAAA GGGAGACCTAGCCCCTTTCGGTCAGTTCTAATTCAAACGATAATCGAATC AGTTCCGACAACGCAGGATGTCGATCGCAGTTCTCGCCCTTGTGGGCCTC CTACTGGTGTGGGTGGTACGAAAGTACTCCAAACCCCGCAACTTTCCCCC CGGTAAGCTCGGTCAGTGCTGCCAATAACGGAAGGAGCATTTTTTGAGAA TGGACCCAAATCGTGTTCCAGGTCCTCCCTCGCTGCCAATTGTCGGTAGC ATGCCATTCTTTCCCAAAATCGGCTCACCTTTATCGCTTGGATGGAAGCA CTTTACTGAAAAGTACGTTATAACTTTATAAGGCAGCCTGGGGTTGGGCT AGGTTACAATAACCGACATGGCTCTTCCTTAGCTATGGGAAAATTGTGGG GTCCATGATGGGCTCCTTCCCGGTGGTGGCAGTCTATGACTACAACCTTA TCAAGGAGATCTTCAACAAGGATGAGTTCTGTGGACGACCTGGGACCTTT GCCCACATGTATCGGATGTTGGGCAAGAGGCAGGGCCTTCTCTTCAACGA AGGCCACAGTTGGAAGTCTCACAGACGATTTTCCCTGAAGAATTTGAGGG ATCTGGGCTTTGGGAAGAAATCCATGGAGGACAAT
back to top
Synonyms
The feature 'probable cytochrome p450 303a1' has the following synonyms
Synonym
Tk07363
Add to Basket