chorion peroxidase-like, maker-scaffold274_size229011-snap-gene-1.21 (gene) Tigriopus kingsejongensis

Overview
Namechorion peroxidase-like
Unique Namemaker-scaffold274_size229011-snap-gene-1.21
Typegene
OrganismTigriopus kingsejongensis (Tigriopus kingsejongensis)
Associated RNAi Experiments

Nothing found

Homology
BLAST of chorion peroxidase-like vs. L. salmonis genes
Match: EMLSAG00000013035 (supercontig:LSalAtl2s:LSalAtl2s99:469219:492645:-1 gene:EMLSAG00000013035 transcript:EMLSAT00000013035 description:"maker-LSalAtl2s99-augustus-gene-5.19")

HSP 1 Score: 355.14 bits (910), Expect = 2.118e-110
Identity = 211/543 (38.86%), Postives = 305/543 (56.17%), Query Frame = 0
Query:  235 EFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPR--GQMSNDP---TVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYG-GSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTR-YMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRL-KALQLHRH--QLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDN 767
            ++R++ G CNN Q+  WG +     R++  +Y +  S P   GQ    P       LP+PR +S     D ++P    T +L Q+GQF+DHD+T TP    E    + CC        D +  EC PI +S  D F+ +  Q C+E  RS       C+  PR+Q N +T+F+DASNVYGSE   A+ LR+     LR T+   G  LLPL   E          F AGD R +E P L  MH L+LREHNRI   L+  +     E ++QEAR+IVGA++Q+I + E+L  ILG R +  D NL   +S F   YDP + PS +N+FATAAFRFGHS+V+G I+   +  N L +  QL  +   L  +       ++  + GL TQ +Q  D     ++T  LF+E+N+  G DL+A N+QR RDHG+P Y  +R+  GL  +  W+   + + S +    L+R Y S  +IDLF+ G+ E   SGS++G TF C+IG QF+ L+ GDRF+F    Q  SF+ +Q+ ++R+ +L++IICDN
Sbjct:  112 KYRTITGECNNLQNPKWGASFTPFARVIEARYGNDESNPTTVGQHYEKPGCLKSGPLPNPRLLSVNFFKDKNRPLSRATHMLAQFGQFLDHDLTLTP----EAHVDVPCCE-------DPSQEECNPIEVSRKDPFFSKFKQTCLELTRS----EKFCNSRPRQQFNAVTSFVDASNVYGSEEELAKELRVPNSYLLRTTRTKTGKSLLPLIDGE----------FLAGDERSSEMPGLATMHNLFLREHNRIAKLLAEHHGHKSKEEIFQEARRIVGAEMQNIVYGEFLHGILGYRRFHYDLNLK--QSSF---YDPFMNPSTSNSFATAAFRFGHSMVEGSIQRRSISNNALIRTFQLKNNFNNLNEYTAKNGRGMEEIICGLFTQSAQSPDRFIIDDVTRFLFREKNSKFGQDLMARNIQRSRDHGLPPYGAFRQAXGLKPICNWKTRPSSI-SXQNWNLLKRWYKSPNDIDLFVAGVAETPLSGSVLGETFACLIGRQFRALRDGDRFFFTHYGQSGSFTFEQIKSIRKRTLSQIICDN 623          
BLAST of chorion peroxidase-like vs. L. salmonis genes
Match: EMLSAG00000004874 (supercontig:LSalAtl2s:LSalAtl2s256:608070:622038:-1 gene:EMLSAG00000004874 transcript:EMLSAT00000004874 description:"maker-LSalAtl2s256-snap-gene-6.24")

HSP 1 Score: 316.62 bits (810), Expect = 2.614e-93
Identity = 197/562 (35.05%), Postives = 293/562 (52.14%), Query Frame = 0
Query:  233 NLEFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRP---------RGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVT-QYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKA-LQLHRHQLEPFEIYEQNS--IDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNG--DNMQQVQPLVF 779
            N+++R ++G CNN  + ++G     LQR L P+YED  S P          G +S+ P    LP+ R VS  +  D D PS   + ++ QWG FV HD++  P     +     CC      R       C+PI I   D FY      C+ F RS+      C   PREQ N+IT+F+DASNVYGS   E  LL+      ++ T    G ELLP D          +  F  GDAR      L  +HTL++REHNRI  +L+ +N  + +E ++QE R+I+GA +Q+I ++E+LP +LG + M+++ L+     +   Y   I P++ + F  AA+RFGHS++Q  +    +      +   L +         ++N   I+  L GLT  P+Q  D     E+T++LF      +G DL A  + RGRDHG+P Y ++R+ CGL  L  W      + S  I   L+ LYSS  +ID+   G+ E     S++GPT  CIIG QF  LK GDRF+F    +  SF+  Q+ ALR++SL+R++CDN   D +  +  ++F
Sbjct:  100 NMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGP----LPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-----NSHEAKCCEGAKDDR-------CLPIRIYENDLFYSNFNVTCLNFYRSVRF----CSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDG---------KGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNN-GKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEI-SENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIF 627          
BLAST of chorion peroxidase-like vs. L. salmonis genes
Match: EMLSAG00000004679 (supercontig:LSalAtl2s:LSalAtl2s244:668666:671466:1 gene:EMLSAG00000004679 transcript:EMLSAT00000004679 description:"maker-LSalAtl2s244-augustus-gene-5.4")

HSP 1 Score: 303.138 bits (775), Expect = 1.017e-92
Identity = 187/592 (31.59%), Postives = 307/592 (51.86%), Query Frame = 0
Query:  235 EFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSS----LPSPRDVSEALVADHDKPSQ-EFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQ-QCMEFVRSMPARNA------ECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLS-PSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGN--RLKALQLHRHQL--EPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQV----QPLVFKKASGMNQKASCSGKGIPRVNLEAWR 805
            E R+ DGSCN+  +   G++     R+L          P+ +  N     +    LP  RD S  LV   D  +  + +L +M WGQ +DHDM  TP  +      I CC   N       HP+C P+   S D FYG+  +  C   +RS   R +      +C     +  N  +A++DAS +YGS    A  LR  R GR+++ +   +   P  P +  D    +  F  GD R +     T+++ ++LR HN++   +  LN  W+DE++YQE+RKIVGA +QHITF E++P +LG      + L  P + G+   Y P+++ S +  FA+A FR  HS +     W+ L     RLK+ +LH   +   P ++      D  +RG+  QP +E +  ++ E+T+ + +++N   G D+VA+ +QRGRDH + GY  YR+ CG  R  +WR++ N++   ++V R+  +Y +IE+IDL +G ++E    G+ VGPT +C+I DQ  R + GD+F++    +P  F+  QLNA++ S L  ++C   D+M  +       ++K      Q    + +   + ++EAW+
Sbjct:   83 EXRTFDGSCNSVAYPFRGKSETPYVRIL----------PKNKRFNFFQCGNRDKRLPMSRDTSLNLVKRGDSDTHMDLSLYIMLWGQILDHDMVLTPPRKTTSGDFIDCCHKKN-----RNHPDCCPVYAKSNDPFYGKDNRPDCQSVIRSRKIRKSYSKSYNKCDF---DVENANSAWIDASFIYGSTKKRADFLRTFRGGRMKMQRDRYNRFFP--PTKKNDKGSIKMEF--GDIRGDSHLAFTMLNVVFLRFHNKLAKNIYRLNPNWNDEKIYQESRKIVGAIVQHITFTEFVPKVLGK----GSKLHLPYRQGYKDYYKPNVDGSASIEFASAGFRL-HSFISS---WYNLVDKNYRLKS-KLHLRNIFRTPMQLLNNTVYDDIMRGMANQPLREFNNIYTPEMTEWMLRKKNNDFGFDIVAITVQRGRDHLLKGYTAYREKCGFGRAKSWRDLTNLIPY-DLVKRMSNVYRNIEDIDLDIGIVMETPIPGTQVGPTTKCLIEDQLMRSRDGDKFFY---TRPGQFNSRQLNAIQSSCLTDVLCIGSDDMYHMFLPDNSFIYKLNK---QNPLVAXRNRKKFDIEAWK 636          
BLAST of chorion peroxidase-like vs. L. salmonis genes
Match: EMLSAG00000005019 (supercontig:LSalAtl2s:LSalAtl2s260:729964:778752:-1 gene:EMLSAG00000005019 transcript:EMLSAT00000005019 description:"maker-LSalAtl2s260-snap-gene-7.19")

HSP 1 Score: 293.123 bits (749), Expect = 5.067e-87
Identity = 176/448 (39.29%), Postives = 250/448 (55.80%), Query Frame = 0
Query:  338 CCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYG-GSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLS-PSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQLEPFEIYEQNS---IDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFK 780
            CC+       D +   C  ISI S D F+  + Q C+EF RS       C   PREQ N IT+++DASNVYGS+++  R LR      L+ T+   G ELLP   +   D       + AGD R    P L  MHTL++REHNRI +Q+       D E +++EAR+IVGA+ Q++ + ++L  +   + MD   L   SKS     YD  I  +I+N FATAA+RFGHS+VQG I+  GL           +      + YE      ++  + GL  QPSQ  D     ++T+HLF     + G DL+A N+QRGRDHG+P Y  +R+ C L  L  W +   +  S   +  L++LY+S  +IDLF  G+ E  + GS++G TF CI+G QF+ LK GDR++F   NQ +SF+  Q+N +R  +L +IICDN D +Q+V+  VFK
Sbjct:   12 CCT-------DNSQEGCSAISIPSNDPFFSTVSQTCLEFTRS----EHYCDSSPREQFNIITSYVDASNVYGSDSTRLRSLRDDNNYLLKTTKSATGKELLP--KNAAGD-------YIAGDVRATVIPGLAAMHTLFVREHNRIANQILKEFPTMDKETIFEEARRIVGAENQNVVYGQYLSSLFSPKLMDRFGLRMTSKSR----YDSKINAAISNGFATAAYRFGHSMVQGDIQRIGLTAADSNTSFFPKDAFFNMQHYEAKDGLGLEEVILGLLHQPSQSYDRLAIDDITNHLFNG-GKAFGSDLIARNIQRGRDHGLPTYGFWRQHCDLQPLCDWNKKPXIKQSNWDI--LKKLYNSPNDIDLFTAGLAENPSEGSVLGETFSCILGKQFENLKNGDRYFFTHTNQASSFTESQINNIRTRTLGQIICDNTD-IQKVRANVFK 431          

HSP 2 Score: 202.216 bits (513), Expect = 9.658e-55
Identity = 114/329 (34.65%), Postives = 181/329 (55.02%), Query Frame = 0
Query:  231 SANLEFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSS------LPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYG-GSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSIT 552
            +A+ ++R++DG+CNN++++ WG     L RLL  +Y +  S P+ +    P+ ++      LP+ R VS     D D PS   T ++ Q+GQ++DHD++ TP     ++    CC       GD +  EC  ISI S D FY  +G  C+EF RS       C   PR+Q N IT+++DASNVYGS+++   +LR   +  L+ T+   G ELLP         +   Y + AGD R    P+LT +HTL++REHNRI  ++       D E ++QEAR+I+GA+ Q++ F+++L  +   +Y+D   L  +       YDP++   I+
Sbjct:  535 TADSKYRTIDGTCNNKENTSWGATGAPLIRLLEARYGNAASTPKTKGLFTPSDANCAQPGNLPNSRHVSTTFHPDSDVPSTLATHMVTQFGQYLDHDLSLTP-----ENHVFNCC-------GDNSKDECSAISIPSNDPFYSTVGITCLEFTRSQ----QYCDSSPRQQFNAITSYVDASNVYGSDSARLAILRDSNKYLLKTTKTATGKELLP---------TNDFYVYIAGDPRAVVIPELTTIHTLFVREHNRIAKEILETFPSMDKETIFQEARRILGAENQNVVFDQYLASLFSHKYLDRYRLRITSRS---TYDPAVNADIS 835          
BLAST of chorion peroxidase-like vs. L. salmonis genes
Match: EMLSAG00000001223 (supercontig:LSalAtl2s:LSalAtl2s11:367926:374017:-1 gene:EMLSAG00000001223 transcript:EMLSAT00000001223 description:"maker-LSalAtl2s11-augustus-gene-3.9")

HSP 1 Score: 268.085 bits (684), Expect = 9.423e-81
Identity = 185/543 (34.07%), Postives = 267/543 (49.17%), Query Frame = 0
Query:  299 DHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGP-REQVNQITAFLDASNVYGSETSEARLLRLG-RRGRLRVTQYGGSELLPLDPD--ECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLS-LLN------SQWD-DERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIE-----WF--GLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSH--------GMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVP--------RLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFE--EGNQPNS--FSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLE 802
            D ++ S + T L MQ+GQFV HD+T T   +G+ D    CC     +  D   P C  I +   + F G   + CM+F RS    ++ C     REQ+N +T++LD S +YGS     + LR G   G L+   +     LP   D  +    S+ +  F AGD RC     +  MH +W REHNRI + L  LL        +W+ DE ++QE RKIV A+   + ++E+L ++L       NN    +      YDP ++ SI N F TA+FRFGHSLVQ   E     W     FG+   A     H            I+  L G   Q  Q  D   S ELT  L+  +   +        G DL +LN+QRGRDHGIP Y   R  CGLPR+       +   S EI P        +LQ +Y ++++ DLF  G+ E+ + G  +G TF C+I +QFKRLK GDRF+F   E  + NS    +D  N + +   + I+C+N   +++++P VFK     N + SC+    P+++ E
Sbjct:    4 DENRTSDDLTHLYMQFGQFVSHDITKT--TKGDLD----CCDPK--ISTD---PRCFNIDLRGDEYFDGEFNRTCMDFTRS----DSHCQFSEWREQINSVTSYLDCSTIYGSNREXNKELRNGVSDGTLKENSFL-PHFLPTRSDLGQSLYKSQEKDDFVAGDGRCQAHSTILAMHVIWFREHNRIANALGPLLKHYIHHLDEWEQDEIIFQEVRKIVIAEFTTVLYSEYLTILLS------NNCPGIELQPNSKYDPEVDASIMNEFTTASFRFGHSLVQSVFEGVDQPWRLGSFFGDAQFATSFDGH-----------GIEKELVGAAHQSCQNSDRFISKELTKKLYLNKEKLNKTANWKGLGSDLASLNIQRGRDHGIPDYNTIRDKCGLPRVDN-----SYFGSTEIPPQFDEQTWEKLQSIYENVDDFDLFTAGLSEKKSGGKRLGETFHCLICEQFKRLKNGDRFFFTHYENEETNSRGLHIDIQNMIMKRRFSDILCENSIGLEKLKPQVFKNEGENNPELSCNDGSRPKLDFE 508          
BLAST of chorion peroxidase-like vs. L. salmonis genes
Match: EMLSAG00000010106 (supercontig:LSalAtl2s:LSalAtl2s667:295056:305896:1 gene:EMLSAG00000010106 transcript:EMLSAT00000010106 description:"maker-LSalAtl2s667-snap-gene-2.23")

HSP 1 Score: 257.684 bits (657), Expect = 2.707e-78
Identity = 144/392 (36.73%), Postives = 224/392 (57.14%), Query Frame = 0
Query:  407 VYGSETSEARLLRLGRRGRLRVTQYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWF--GLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGL-PRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNS--FSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSG 793
            +YGS+   AR LRL +RG ++  +  G + LP + D C +       F+ GD R NE P L  +HTL++REHNRI  +  L    W+DE+LYQE R++V A+ Q++ + E+LPL+LG+++++D++          DYDP ++ +I  AF+TAAFRFGHSL+   +  +  G   + +   Q+  +      +  +  ID  L G++ QP+  ++   +  + + LF+++  S G DLV+ N+QRGRDH +  Y  YRKLCGL P  +T+     V  + E       LY+  E+I+LF GGM E    G+LVGPTF+C+I +QF+R++ GDR++F   N  ++  +  ++   +R+  L  IICDN D        VF   S  NQ   CS 
Sbjct:    2 LYGSDEKMARDLRLLKRGYMQTNKKLGEKYLPFEKDICPEVIPTM--FSTGDERVNENPGLQSLHTLFMREHNRIAKEFLLRQPNWNDEKLYQETRRLVIAEWQNVVYGEFLPLVLGSKFVEDDD--KMNINVNSDYDPDVDANILTAFSTAAFRFGHSLITNIMHTYENGKQKDTISIAQVFFNTT----MVRRKQIDQILEGMSIQPTHVVNSKIADSVRNFLFKKKGESFGSDLVSRNIQRGRDHELAPYNSYRKLCGLSPLPSTFAHSPPVEFTWETWKIFGELYTEPEDIELFPGGMSEIPARGALVGPTFRCLIAEQFRRVRSGDRYFFTHKNVDDTSGYCHEERRNIRQRKLFDIICDNTDISNMRSRNVFIIGSQFNQ-VQCSS 384          
BLAST of chorion peroxidase-like vs. L. salmonis genes
Match: EMLSAG00000001001 (supercontig:LSalAtl2s:LSalAtl2s116:345938:357083:-1 gene:EMLSAG00000001001 transcript:EMLSAT00000001001 description:"maker-LSalAtl2s116-snap-gene-3.9")

HSP 1 Score: 192.971 bits (489), Expect = 3.487e-53
Identity = 112/289 (38.75%), Postives = 167/289 (57.79%), Query Frame = 0
Query:  471 HTLWLREHNRIVSQLS--LLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQLEPF------EIYEQNSI-------DSFLRGLTTQPSQELDGSFSAELTDHLFQE--RNTSHGMDLVALNLQRGRDHG----IPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWF 738
            + +   EHN+I   L   L      DE +YQE R++V A+ Q+I + E+LP +LG  YM   NL  ++      Y  ++   + N+F TAA+RFGHS++ G  +     G    A +    + + F      E+++  SI       ++ + GL TQ  Q  D  F+ E+TDHLFQ+  R  + G DL+A+N+QRGRDHG    IP Y  YRKLCGL  LT+W      +AS +   +L+ +Y+++++IDL++GG+ E    G +VGPTF CIIG+QF RLK GDRF++
Sbjct:  199 YNILTSEHNKIARGLKKYLPVELRTDEIIYQETRRLVAAEFQNIVYGEFLPTVLGVDYMKKYNLIVTEES---TYRVNVNAGMINSFVTAAYRFGHSMINGMFKLVSQRGISTVA-KTKNSKNDIFWLWRLREVFDGQSIRGATLPIENMIDGLITQKPQTCDAFFTTEVTDHLFQKNSRRQNFGEDLLAINIQRGRDHGRDHGIPSYNNYRKLCGLEVLTSWSRRPKELAS-DYWSQLESVYNNVDDIDLYVGGIAELNVRGGVVGPTFACIIGEQFSRLKDGDRFFY 482          

HSP 2 Score: 95.5153 bits (236), Expect = 1.095e-20
Identity = 60/170 (35.29%), Postives = 86/170 (50.59%), Query Frame = 0
Query:  233 NLEFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQ--QCMEFVRSMPARNAECHLGPREQVNQITA 400
            N  +R++ G CNN  +S WG       RL+   Y+D  S PRG     P  S+LP+PR +S+    D+DKP   FT ++MQ+GQF+DHD++  P  E  D     CC +      ++   +C  I I S D FY  +    QC+  +RS       C    REQ N +T+
Sbjct:   54 NARYRTISGRCNNIHNSEWGSTGSTFNRLIPDAYQDRRSIPRG--GRHP--SALPNPRWISQRNHPDNDKPDHRFTHMVMQFGQFLDHDLSLAPKDESTD-----CCES------EVQRDDCFTIPIPSPDRFYSWVNSSAQCLNLLRSHHV----CGTIIREQYNILTS 204          
BLAST of chorion peroxidase-like vs. L. salmonis genes
Match: EMLSAG00000011299 (supercontig:LSalAtl2s:LSalAtl2s777:83334:122249:-1 gene:EMLSAG00000011299 transcript:EMLSAT00000011299 description:"augustus_masked-LSalAtl2s777-processed-gene-1.1")

HSP 1 Score: 179.489 bits (454), Expect = 1.406e-46
Identity = 160/525 (30.48%), Postives = 242/525 (46.10%), Query Frame = 0
Query:  240 DGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHDKPS--QEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHP-ECMPISISSTDSFYGRL--GQQCMEFVRSM-PARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQ---YG----GSELLPLDPDECADHSKR----QYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLK------ALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVAS--PEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFE 739
            DG  NN  H  WG  +  L R     Y DG+ +  G         S PSPR +S+  +   D  S  +  T L   +GQ V               + IL  S       +L  P E   I I   D  Y     G   M F R+    R  +    PREQ+N++T+++D S +Y ++ +    +R    G L+      +G      + +PL+ +  A H  R    +  F+  D R N+ P    +  ++ R HN    ++   +  W+DE ++Q AR+ V A LQ+I   E+LP  LG        + P +S     Y P I P I++ F +AAFRFGHS +   I       N  K      A++L     +  +   +++++  L GL++Q S++ D    +++ + LF     S   DL ALN+ RGRD+G+  Y   RK  G   + T+ EI   +A+  P+I  RL+ LY  +  IDL++GGMLE   S    GP F  II D+F R++  DRFWFE
Sbjct:   60 DGWYNNLAHPSWGSIDSQLTRKTPASYADGVYKLNGM--------SRPSPRILSQYFMKGVDGLSSLKNRTSLQTFFGQLVS--------------AEILMAS-------ELGCPIEMAKIEIEKCDEMYDEKCEGTAFMPFHRAYYDRRTGQSPNSPREQLNRMTSWIDGSFIYSTKEAWVNTMRTFSNGLLKTNGDAIFGLPTRNKDRVPLE-NRPAPHVLRMLNPERMFS--DPRVNQNPGFLALGIVFYRWHNFQALKILKKHPDWEDEDIFQAARRRVIATLQNIIMYEFLPSFLGKV------IPPYES-----YKPDIHPGISHVFQSAAFRFGHSTIPPGIYRRDRNCNYKKTASGGPAMRLCSTWWDSQDEINEDAVEEILLGLSSQISEKEDAILCSDVRNKLFGPMEFSR-RDLAALNIMRGRDNGLADYNTVRKCNGFSMINTFEEINPKLANEDPDIFVRLRNLYKDVNNIDLYVGGMLE---SVDGPGPLFSKIIKDEFLRIRDADRFWFE 537          
BLAST of chorion peroxidase-like vs. L. salmonis genes
Match: EMLSAG00000013034 (supercontig:LSalAtl2s:LSalAtl2s99:467720:469073:-1 gene:EMLSAG00000013034 transcript:EMLSAT00000013034 description:"maker-LSalAtl2s99-augustus-gene-5.18")

HSP 1 Score: 153.68 bits (387), Expect = 3.010e-41
Identity = 94/229 (41.05%), Postives = 126/229 (55.02%), Query Frame = 0
Query:  310 LLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHP---ECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVT-QYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSP 534
            +L Q+GQF+DHD+T TP    E    + CC           HP   EC PI + + D F+ R  Q C+E  RS       C+  PR+Q N +T+F+DASNVYGSE   A+ LR+     LR+T    G  LLPL   E          F AGD R +E P L  MH L+LREHNRI   L+       +E +++EAR+IVGA++Q+I + E+L  ILG R + D+ L P
Sbjct:    1 MLTQFGQFLDHDLTLTP----EAHVDVPCCK----------HPHQDECNPIEVPTKDPFFSRFKQTCLELTRS----EKFCNSRPRQQFNAVTSFVDASNVYGSEEELAKELRVPNSYLLRITLTKTGKSLLPLIDGE----------FLAGDERSSEMPGLATMHNLFLREHNRIAKLLAENKGHRSNEEIFEEARRIVGAEMQNIVYGEFLYGILGYR-IRDHGLPP 200          

HSP 2 Score: 100.138 bits (248), Expect = 5.305e-23
Identity = 60/160 (37.50%), Postives = 89/160 (55.62%), Query Frame = 0
Query:  633 RNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCS 792
            +N  +G  L  +   R RDHG+P Y  +R+  GL  +  W+   + + S +    L+R Y S  +IDLF+ G+ E    GS++G TF C+I  QF  LK GDRF+F    Q  SF+ DQ++ +R+ +L++IICDN   ++ V   VF   S    K  CS
Sbjct:  177 QNIVYGEFLYGILGYRIRDHGLPPYGAFRQAXGLXPICNWKTRPSSI-SKQNWNLLKRWYKSPNDIDLFVAGISETPLDGSVLGETFTCLITRQFMALKDGDRFFFTHSGQSGSFNYDQIHNIRQRTLSQIICDN-TQIKTVPISVFIHGS---TKVPCS 331          
BLAST of chorion peroxidase-like vs. L. salmonis genes
Match: EMLSAG00000007125 (supercontig:LSalAtl2s:LSalAtl2s401:98982:101147:1 gene:EMLSAG00000007125 transcript:EMLSAT00000007125 description:"maker-LSalAtl2s401-augustus-gene-1.10")

HSP 1 Score: 119.398 bits (298), Expect = 1.860e-28
Identity = 121/477 (25.37%), Postives = 185/477 (38.78%), Query Frame = 0
Query:  383 RNAEC--HLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQ-PQLTVMHTLWLREHNRIVSQLS-------LLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMD----LVALNLQRGRDHGIPGYMEYRKLCGLPRLT----TWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEE------------------------------------------GNQPN--------SFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASC 791
            +N EC  H    E +N+IT+F+D S +YG+    +  LR    G L + Q    E+          H++ +           EQ   + +  TL+  EHNR+ SQ+        ++  + +DE +YQE+R+I+   LQHI ++++LP+ILG+   +   L+  K+ +   YD ++ PSI N F TA              +F +F                                 T+P   +  SFS    D L  + N+   ++    L+A+      DHG   Y  Y+ LCGL   T    TW E+++V    +              IDLF GG +E      L+GPTF CII  QF   K GDR ++                                             + PN         F+ D++N +R  SL  + CDNG      Q   +KK    N    C
Sbjct:  110 KNGECPSHY-EEETLNRITSFIDGSQIYGTTFHVSSSLRKMENGLLHIPQ---EEVQSF-------HTQME----------REQGMSVELFITLFKLEHNRLASQIKDAYKDYGVILGRKEDETIYQESRRIIIGVLQHIIYDKFLPVILGSDLFNRFELTTIKNTY---YDRNLNPSIFNGFLTA--------------FFDIF---------------------------------TEPCDNMTNSFSE---DDLMSDINSIINLNKYPHLIAIFKDFNDDHGT--YQSYKNLCGLANQTISNITWTELLDVFKGNK------------SSIDLFSGGFVEEPVQDGLIGPTFACIIAYQFHLAKAGDRHFYSNVRHGYPSHHNPHTDQTLIQSLQKPKPKKLKKSFIRQIEAKFYKDDPNFNYIRDSYRFNYDEVNEIRHRSLGGLFCDNGRISHTSQFSFYKKEGKWNHIIPC 498          
BLAST of chorion peroxidase-like vs. SwissProt
Match: gi|290457651|sp|Q01603.2|PERO_DROME (RecName: Full=Peroxidase; Short=DmPO; AltName: Full=Chorion peroxidase; Flags: Precursor)

HSP 1 Score: 415.231 bits (1066), Expect = 2.620e-133
Identity = 228/578 (39.45%), Postives = 335/578 (57.96%), Query Frame = 0
Query:  236 FRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSN-GNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHL--GPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYGGSELLPLDPD---ECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNL---SPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAW 804
            +R++DGSCN+ +    G AN    RLL P+Y DGIS P   ++ D     LPS R VS     + D P  EFTL  MQWGQ + HDM+              CC++ G ++  D AH  C  I +   D  Y ++G +C+ FVR++  R++ C    GP EQ+  +T++LD S VYG+   +   +R  + GR+ V +  G++ LPL  +   +C      + C+ +GD R N+ P L ++ T+ LREHNRI   LS LN  +DD  L+QEARKI  AQ Q I++ EWLP+ LG   M  N L   +PS S +  D+DP+I+PS+ N  ATAAFR+ HS ++G+++        L +L L      P  I   ++ DS  RG  TQP +  D +F  ++   LF+ RN   G DL +L++QR RDHG+  Y + R+ CGL R  +W    +++ SP I+ +L+ LY S E++DL +G  LE   +G+L GPTF CI+ +QF R + GDRF+FE G++   F+ DQL  LR++S+AR++CDNG+++  +QP  F+  S  N    CS   IP+V+L  W
Sbjct:  105 YRTLDGSCNHLEQPGLGVANSKYGRLLTPKYADGISAPTRSVTGD----ELPSARLVSLVAFGEQDVPDPEFTLHNMQWGQIMTHDMSMQAGGTQSKKHPTRCCTDDGRLIGLDTAHKTCFAIIVPPHDPAYSQVGTECLNFVRTLTDRDSNCQYQGGPAEQLTVVTSYLDLSLVYGNSIQQNSDIREFQGGRMIVEERNGAKWLPLSRNVTGDCDAVDASEVCYRSGDVRVNQNPGLAILQTILLREHNRIADALSALNPHYDDRTLFQEARKINIAQYQQISYYEWLPIFLGGENMLKNRLIYKAPSGS-YINDFDPNIDPSVLNEHATAAFRYFHSQIEGRLDLLSELRQVLGSLTLSDWFNRPGIIEVGDNFDSLTRGHATQPEELTDINFDRQIKHFLFR-RNMPFGSDLRSLDIQRNRDHGLASYNDMREFCGLRRAHSWEGYGDLI-SPPILEKLKSLYPSHEDVDLTVGASLEAHVAGALAGPTFLCILTEQFYRTRVGDRFFFENGDKLTGFTPDQLEELRKASMARLLCDNGNHISSMQPEAFRTVSHSNPIIPCS--NIPQVDLTKW 673          
BLAST of chorion peroxidase-like vs. SwissProt
Match: gi|229462993|sp|Q9VEG6.3|PERC_DROME (RecName: Full=Chorion peroxidase; AltName: Full=Peroxinectin-related protein; Short=Dpxt; Flags: Precursor)

HSP 1 Score: 414.075 bits (1063), Expect = 2.269e-131
Identity = 230/588 (39.12%), Postives = 339/588 (57.65%), Query Frame = 0
Query:  229 CRSANLEFRSVDGSCNNR--QHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCS-NGNV-VRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYGGSELLPLDPDE--CADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGN--QPNSFSLDQLNALRESSLARIICDNGD--NMQQVQPLVFKKASGM-NQKASCSGKGIPRVNLEAWR 805
            C +    +RS+DG+CNN   Q S+WG A   ++R+L P YEDGI  PR   S+    + L   R +S  L++D D+P  ++ L++MQ+GQ + HD++ T  +  ED S + CCS  G V +    +H  CMPI +   D F+   G +C+ FVR     + +C L   +Q+ ++T F+DAS VYGS    +R LR  R GRLR+    G +LLPL  D+  C      + CF +GD R N+   L  +  L  REHNR+   L  LN    DE L+QEAR+IV A++QHIT+NE+LP+I+G + M    L P   G++ DY+ ++ P+ITN F+ AA+R GHS V G+ +     G   + + +      P  + ++   D  LR L +QP Q++D S S  L+  LF+  N   G+DL A+N+QRGRD G+  Y +Y +L G P+L ++ +        EI  +L R+Y + ++IDL++GG+LE+   G +VG TF  II DQF R K GDR+++E  N   P +F+  QL  +R+ +LAR++CDN D   +Q V    F +A    NQ   C    +P VNLEAWR
Sbjct:  230 CGNIRSVYRSMDGTCNNPEPQRSLWGAAGQPMERMLPPAYEDGIWTPRAHSSDG---TPLLGARKISRTLLSDVDRPHPKYNLMVMQFGQVLAHDISQTSSIRLEDGSLVQCCSPEGKVALSPQQSHFACMPIHVEPDDEFFSAFGVRCLNFVRLSLVPSPDCQLSYGKQLTKVTHFVDASPVYGSSDEASRSLRAFRGGRLRMMNDFGRDLLPLTNDKKACPSEEAGKSCFHSGDGRTNQIISLITLQILLAREHNRVAGALHELNPSASDETLFQEARRIVIAEMQHITYNEFLPIIIGPQQMKRFRLVPLHQGYSHDYNVNVNPAITNEFSGAAYRMGHSSVDGKFQIRQEHGRIDEVVNIPDVMFNPSRMRKREFYDDMLRTLYSQPMQQVDSSISQGLSRFLFRGDN-PFGLDLAAINIQRGRDQGLRSYNDYLELMGAPKLHSFEQF-----PIEIAQKLSRVYRTPDDIDLWVGGLLEKAVEGGVVGVTFAEIIADQFARFKQGDRYYYEYDNGINPGAFNPLQLQEIRKVTLARLLCDNSDRLTLQAVPLAAFVRADHPGNQMIGCDDPNLPSVNLEAWR 808          
BLAST of chorion peroxidase-like vs. SwissProt
Match: gi|93140516|sp|Q7QH73.3|PERC_ANOGA (RecName: Full=Chorion peroxidase; Flags: Precursor)

HSP 1 Score: 405.216 bits (1040), Expect = 1.479e-128
Identity = 244/583 (41.85%), Postives = 332/583 (56.95%), Query Frame = 0
Query:  236 FRSVDGSCNNR--QHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVE-GEDDSAILCCS--NGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQ---LEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGT-SGSLVGPTFQCIIGDQFKRLKFGDRFWFEEG--NQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPL--VFKKASGMNQKASCSGKGIPRVNLEAWR 805
            +RS+DGSCNN     S WG A    +RLL P YEDG+  PR   S    +  L S RD+S A+  D D+  ++F LLLMQ+GQF+ HD T +  V  G+++  + CC+  +   +RG+ AH  CMPI++S  D FY R G +C+ FVR   AR+ +C LG  +Q+N++T F+D S VYGS  + A  LR    GRLR +   G ELLP      A     + CF AGD R N+   LT MHTL+LREHNR+ + L+ LN  WDDERLYQE R+IVGA +Q I +NE+LP I+G        L  S    T  Y P ++P++ N  + AAFRFGHS V G      L  +R +  +L   Q   L P  + +++  D FL  L  QP Q+LD S +  LT  LF  RN   G DL +LN+QRGRDH +  Y +YR   GL RLT++ +   V A      RL  +Y   +++DL++GG+LE  T  G+L G TF  II +QF RLKFGDR+++  G    P  F+ +QL  L + SLA +IC N D           F++ S  N    C  + +  ++L AWR
Sbjct:  200 YRSLDGSCNNPVPARSSWGAAGYPFERLLPPAYEDGVWAPRVHSSVSGRL--LASARDISVAVFPDVDRRDRKFNLLLMQFGQFMSHDFTRSASVRIGQEE--VQCCNAEHSGALRGEQAHFACMPIAVSPADPFYSRFGIRCLNFVRLALARDGKCRLGYGKQLNRVTHFIDGSAVYGSNEALAASLRTFEGGRLRSSFPTGEELLPFARTRAACEPWAKACFRAGDDRVNQIVSLTEMHTLFLREHNRVATALAALNRHWDDERLYQETRRIVGAVMQKIFYNEYLPSIVGHSKARQYGLLDSHGEQTDFYSPDVKPAVFNELSGAAFRFGHSTVDGAF----LIQHRHRRTELVPIQEVFLNPSRLLQRSFFDDFLFSLMDQPQQQLDDSITFGLTRLLFAGRN-PFGSDLASLNIQRGRDHALRPYNDYRSWAGLERLTSFEQFGPVGA------RLASVYEFPDDVDLWVGGLLEPPTQDGALFGETFAAIISEQFARLKFGDRYYYTNGPRTNPGFFTGEQLRELSKVSLASVICANLDQADGFSAPRDAFRQPSEHNPPVPC--QTLVGMDLSAWR 765          
BLAST of chorion peroxidase-like vs. SwissProt
Match: gi|172045828|sp|Q92626.2|PXDN_HUMAN (RecName: Full=Peroxidasin homolog; AltName: Full=Melanoma-associated antigen MG50; AltName: Full=Vascular peroxidase 1; AltName: Full=p53-responsive gene 2 protein; Flags: Precursor)

HSP 1 Score: 420.624 bits (1080), Expect = 3.556e-128
Identity = 283/707 (40.03%), Postives = 370/707 (52.33%), Query Frame = 0
Query:  140 SRGSLTPVAKHKRLQKTTAKARSLGRKAAKLVEASNQLQQSFNLSPAQGTHALPVFSLVGTSLAVSDEDHAEMCNAIDGSTGFVLEAGQCRSANL----EFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRG----QMSNDPTVSSLPSPRDVSEALVADHD-KPSQEFTLLLMQWGQFVDHDMTHT--PLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLG----------PREQVNQITAFLDASNVYGSETSEARLLR--LGRRGRLR--VTQYGGSELLPL---DPDECA--DHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQI----EWFGLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGL------TTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAWRN 806
            S   L  + ++ R   T  +AR     A ++ E + QL Q          H L V  L GTS   +D    +  N I   +G          +++    ++R+ DG+CNN QH +WG +  A +RLL   YE+G + PRG    ++ N     +LP PR VS  L+      P ++FT +LMQWGQF+DHD+  T   L +        C    NV   D   P C  + I   DS   R G +CM FVRS P     C  G          PREQ+NQ+T+++DASNVYGS   EAR +R     RG LR  + Q  G  LLP     P EC   ++     CF AGD R NEQ  LT MHTLW REHNRI ++L  LN  WD + +Y E RKIVGA++QHIT+  WLP ILG   M          G    YDP I   I NAFATAAFRFGH+LV   +    E F         L LH+    PF I  +  ID  LRGL         PSQ L+     ELT+ LF   +T   +DL A+N+QRGRDHGIP Y +YR  C L    T+ ++ N + +PEI  +L+RLY S   IDLF   ++E    GS +GPT  C++  QFKRL+ GDR W+E    P  FS  QL  ++++SLARI+CDN DN+ +VQ  VF+ A   +   SC    IPRV+L  W++
Sbjct:  653 SPNDLLALFRYPRDPYTVEQAR-----AGEIFERTLQLIQE------HVQHGLMV-DLNGTSYHYNDLVSPQYLNLIANLSGCTAHRRVNNCSDMCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNTPRGINPHRLYNG---HALPMPRLVSTTLIGTETVTPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQHC---SNVCSND---PPCFSVMIPPNDS-RARSGARCMFFVRSSPV----CGSGMTSLLMNSVYPREQINQLTSYIDASNVYGSTEHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLKLNPHWDGDTIYYETRKIVGAEIQHITYQHWLPKILGEVGM-------RTLGEYHGYDPGINAGIFNAFATAAFRFGHTLVNPLLYRLDENFQPIAQ--DHLPLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRVPSQLLN----TELTERLFSMAHTV-ALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAHTFEDLKNEIKNPEIREKLKRLYGSTLNIDLFPALVVEDLVPGSRLGPTLMCLLSTQFKRLRDGDRLWYE---NPGVFSPAQLTQIKQTSLARILCDNADNITRVQSDVFRVAEFPHGYGSCD--EIPRVDLRVWQD 1314          
BLAST of chorion peroxidase-like vs. SwissProt
Match: gi|341941778|sp|Q3UQ28.2|PXDN_MOUSE (RecName: Full=Peroxidasin homolog; Flags: Precursor)

HSP 1 Score: 418.698 bits (1075), Expect = 1.649e-127
Identity = 259/606 (42.74%), Postives = 339/606 (55.94%), Query Frame = 0
Query:  235 EFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSN-DPTVSSLPSPRDVSEALVADH-DKPSQEFTLLLMQWGQFVDHDMTHTPLV-------EGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAEC------HLGPREQVNQITAFLDASNVYGSETSEARLLR--LGRRGRLR--VTQYGGSELLPL---DPDECA--DHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQ----LHRHQLEPFEIYEQNSIDSFLRGL------TTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAWRN 806
            ++R+ DG+CNN QH +WG +  A +RLL   YE+G + PRG  S        LP PR VS  L+      P ++FT +LMQWGQF+DHD+  T +        +G+  S++  CSN          P C  + I   D    R G +CM FVRS P   +         + PREQ+NQ+T+++DASNVYGS   EAR +R     RG LR  + Q  G  LLP     P EC   ++     CF AGD R NEQ  LT MHTLW REHNRI ++L  LN  WD + +Y E RKIVGA++QHIT+  WLP ILG   M          G  + YDPS+   I NAFATAAFRFGH+L+   +  + L  N     Q    LH+    PF I  +  ID  LRGL         PSQ L+     ELT+ LF   +T   +DL A+N+QRGRDHGIP Y +YR  C L    T+ ++ N + SP I  +LQRLY S   IDLF   M+E    GS +GPT  C++  QF+RL+ GDR W+E    P  FS  QL  L+++SLARI+CDN DN+ +VQ  VF+ A   +  +SC  + IPRV+L  W++
Sbjct:  737 KYRTHDGTCNNLQHPMWGASLTAFERLLKAVYENGFNTPRGINSQRQYNGHVLPMPRLVSTTLIGTEVITPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQHCSSV--CSND---------PPCFSVMIPPNDPRV-RSGARCMFFVRSSPVCGSGMTSLLMNSVYPREQINQLTSYIDASNVYGSTDHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIAAELLKLNPHWDGDTVYHETRKIVGAEIQHITYRHWLPKILGEVGM-------KMLGEYRGYDPSVNAGIFNAFATAAFRFGHTLINPLL--YRLDENFEPIPQGHVPLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRIPSQLLN----TELTERLFSMAHTV-ALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAYTFEDLKNEIKSPVIREKLQRLYGSTLNIDLFPALMVEDLVPGSRLGPTLMCLLSTQFRRLRDGDRLWYE---NPGVFSPAQLTQLKQTSLARILCDNSDNITRVQQDVFRVAEFPHGYSSC--EDIPRVDLRVWQD 1311          
BLAST of chorion peroxidase-like vs. SwissProt
Match: gi|172044151|sp|A4IGL7.1|PXDN_XENTR (RecName: Full=Peroxidasin; Flags: Precursor)

HSP 1 Score: 407.912 bits (1047), Expect = 1.279e-123
Identity = 260/698 (37.25%), Postives = 368/698 (52.72%), Query Frame = 0
Query:  140 SRGSLTPVAKHKRLQKTTAKARSLGRKAAKLVEASNQLQQSFNLSPAQGTHALPVFSLVGTSLAVSDEDHAEMCNAIDGSTGFVLEAGQCRSANL----EFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHD-KPSQEFTLLLMQWGQFVDHDMTHTPLV-------EGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAEC------HLGPREQVNQITAFLDASNVYGSETSEARLLR--LGRRGRLR--VTQYGGSELLPL---DPDECA--DHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKA--LQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGS--FSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAWRN 806
            S G L  + ++ R   T  +AR     AA++ E + QL Q    S         +  L GTS   +D    +  N I   +G          +N+    ++R+ DG+CNN QH +WG +  A +RLL   YE+G + PRG          LP PR VS  L+  H   P ++FT +LMQWGQF+DHD+  T +        +G+D S +  C+N            C PI +   D    R   +CM  VRS P   +         + PREQ+NQ+T+++DASNVYGS   E+  +R     RG L+  + Q  G  LLP     P EC   ++     CF AGD R NEQ  LT MHTLW REHNRI ++L  LN  WD + +Y E RKIVGAQ+QHIT++ WLP I G   M          G  + YDP++   I N FATAAFRFGH+L+   +         +    + LHR    PF I  +  ID  LRGL    ++    S   + ELT+ LF   +    +DL ALN+QRGRDHGIP Y ++R  C L  + T+ ++ N + +P++  +L+RLY S   IDLF   M+E    GS +GPT  C++  QF+ ++ GDRFW+E    P  F+  QL  ++++SLAR++CDNGDN+ +VQ  +F+ A   +   SC  K I +++L  W++
Sbjct:  643 SPGDLLALFRYPRDPYTVEQAR-----AAEIFERTLQLIQDHVQSGL-------MVDLNGTSYHYNDLVSPQYLNMIANLSGCATHRRINNCSNMCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNLPRGISGRIYNGFPLPLPRLVSTTLIGTHTITPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQDCSVV--CTND---------APCFPIMVPPNDPRV-RNNARCMSMVRSSPVCGSGMTSLLMNSVYPREQMNQLTSYIDASNVYGSSDHESNEIRDSASHRGLLKQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLRLNPHWDGDTIYHETRKIVGAQMQHITYSHWLPKIFGDVGM-------KMLGEYKSYDPNVNAGILNEFATAAFRFGHTLINPILYRLDEKFEPIPQGHVPLHRAFFSPFRIVNEGGIDPLLRGLIGVAAKMRVTSQLLNTELTEKLFSMAHAV-ALDLAALNVQRGRDHGIPPYHDFRVFCNLSTVQTFDDLRNEIKNPDVREKLKRLYGSPLNIDLFPALMVEDLIPGSRLGPTLMCLLTTQFRNIRDGDRFWYE---NPGVFTAAQLTQIKQTSLARVLCDNGDNITKVQHDLFRVAEFPHGYVSC--KNIAKMDLRVWQD 1303          
BLAST of chorion peroxidase-like vs. SwissProt
Match: gi|74871953|sp|Q9VZZ4.1|PXDN_DROME (RecName: Full=Peroxidasin; Flags: Precursor)

HSP 1 Score: 387.111 bits (993), Expect = 8.644e-116
Identity = 231/599 (38.56%), Postives = 330/599 (55.09%), Query Frame = 0
Query:  236 FRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSND-PTVSSLPSPRDVSEALVADHD-KPSQEFTLLLMQWGQFVDHDMTHT-PLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLG----------PREQVNQITAFLDASNVYGSETSEARLLR--LGRRGRLRVTQY--GGSELLPLDPDECADHSKRQY------CFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKA--LQLHRHQLEPFEIYEQNSIDSFLRGLTTQPS--QELDGSFSAELTDHLFQERNTSH--GMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAWR 805
            +RS+DG+CNN QH  WG +  A +RL  P YE+G S P G       +  + PS R VS +LVA  +  P    T ++MQWGQF+DHD+ H  P V  E    I C  +  +       P C PI +   D       ++C++ VRS    +A C  G           REQ+NQ+T+++DAS VYG  T+ A+ LR    + G LRV  +     ++LP    +     +R        CF +GD R NEQ  L  MHT+W+REHNRI S+L  +NS WD + LYQEARKIVGAQ+QHITF +WLPLI+G   M+         G  Q Y+P + PSI N FATAA RFGH+++   +         +    L LH+    P+ +  +  +D  +RG    P+  +  D + + ELT+ LFQ   T+H   +DL A+N+QRGRDHG+PGY  YRKLC L     + ++   ++S EI  +++ LY   + +D++LGG+LE    G  VGP FQC++ +QF+RL+ GDR ++E    P  FS +QL  +++++  R++CD GDN  QV   VF  A        C  + I  +NL  W+
Sbjct:  777 YRSIDGTCNNLQHPTWGASLTAFRRLAPPIYENGFSMPVGWTKGMLYSGHAKPSARLVSTSLVATKEITPDARITHMVMQWGQFLDHDLDHAIPSVSSESWDGIDCKKSCEMA------PPCYPIEVPPNDPRV--RNRRCIDVVRS----SAICGSGMTSLFFDSVQHREQINQLTSYIDASQVYGYSTAFAQELRNLTSQEGLLRVGVHFPRQKDMLPFAAPQDGMDCRRNLDENTMSCFVSGDIRVNEQVGLLAMHTIWMREHNRIASKLKQINSHWDGDTLYQEARKIVGAQMQHITFKQWLPLIIGESGME-------MMGEYQGYNPQLNPSIANEFATAALRFGHTIINPILHRLNETFQPIPQGHLLLHKAFFAPWRLAYEGGVDPLMRGFLAVPAKLKTPDQNLNTELTEKLFQ---TAHAVALDLAAINIQRGRDHGMPGYNVYRKLCNLTVAQDFEDLAGEISSAEIRQKMKELYGHPDNVDVWLGGILEDQVEGGKVGPLFQCLLVEQFRRLRDGDRLYYE---NPGVFSPEQLTQIKQANFGRVLCDVGDNFDQVTENVFILAKHQGGYKKC--EDIIGINLYLWQ 1348          
BLAST of chorion peroxidase-like vs. SwissProt
Match: gi|122119348|sp|Q1ENI8.1|PXDN_CAEEL (RecName: Full=Peroxidasin homolog; Flags: Precursor)

HSP 1 Score: 381.719 bits (979), Expect = 4.085e-115
Identity = 255/746 (34.18%), Postives = 375/746 (50.27%), Query Frame = 0
Query:  110 DIQQANFGAEQRLQVRRQIEAGLRQAGLVISRGSLTPVAKHKRLQKTTAKAR-----------SLGRKAAKLVEASNQLQQSFNL--SPAQGTHALPVFSLVGTSLAVSDEDHAEMCNAIDGSTGFVLEAGQCRSANLE------FRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRP----RGQMSNDPTVSSLPSPRDVSEALVADHD-KPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFY--GRLGQQCMEFVRSMPARNAECHLGP----------REQVNQITAFLDASNVYGSETSEARLLR--LGRRGRLR--VTQYGGSELLPLDPDECADHSKRQY-------CFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKA--LQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGS--FSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAW 804
            D +    G E R     QI+  L +A    +R ++    +  R Q T  K             S  ++A +L +A    ++S  L     +    L V  L   +++     H     A+ G +G     GQ ++   +      +RS DG CNN+   + G + + L+RLL P YE+G + P    +G++ N      LP+ R+VS  LVA  +  P  + + ++MQWGQFVDHD+THT         A     N      D     C  I +S  D     G     C+EF RS     A C  G           REQ+N +T+FLDASNVYGS   +A+ LR      G LR  +T   G E LP + D   D  +R +       CF AGD R NEQ  L   HT+++REHNRI  +L  +N  WD E +Y E RKIVGA +QHIT+  W+P+I G +   +  +     G  Q YDP ++ S+TNAFATAAFRFGH+++   +   G     +K   + LH+    P  +  Q  +D  LRGL   P +    +   + EL + LF  +     +DL  +N+QR RDHG+P Y EYRK C LP    W ++   +    I+ +L+ LY   + IDL++GG++E      L GPTF CIIG+QF++++ GDRFW+E   +   F+ +QL  +++ +LAR+ CDNGDN+ ++Q  VF    GM+++   + +    +NL AW
Sbjct:  491 DAKLTVIGGETRKAAAPQIDEELLRAIAQKARQNVENAVEKTRKQLTQDKVTNTNDLKRLFRFSTPKQAVELSKAREIYEESVRLVREHVEKGLILNVDELHPKNVSYESVLHVTHVQALMGLSG--CHTGQYKNPCTDTCFHHRYRSFDGQCNNKNKPMTGVSLMPLRRLLKPVYENGFNTPVGWEKGRLYNG---YPLPNVREVSRQLVATENITPHSKLSSMVMQWGQFVDHDLTHTVTALSRHSYATGAFCNRTCENLD----PCFNIPLSPNDPRVKSGSAKYPCIEFERSA----AVCGSGETSLVFNRVTYREQMNALTSFLDASNVYGSNEVQAQELRDTYNNNGMLRFDITSEAGKEYLPFEKDSNMD-CRRNFSEENPIRCFLAGDLRANEQLALAATHTIFIREHNRIAKKLKSMNGNWDGEIIYHETRKIVGAMMQHITYKHWMPIIFGGQAQMNKFV-----GTYQGYDPDVDASVTNAFATAAFRFGHTIINPSLFRLGNDFMPIKEGHIALHKAFFTPELVLTQGGVDPLLRGLFASPLKHPMPTQLLNMELIEKLFM-KGHEVSLDLAVMNIQRSRDHGLPSYTEYRKFCNLPVPVQWEDMKGYIKDDMIIQKLRGLYGVPQNIDLWVGGIVEEKLENGLFGPTFACIIGEQFRKIRDGDRFWYE---KDGVFTPEQLREIKKITLARLFCDNGDNIDRIQKDVF-MYPGMDKENYGTCQETEMMNLRAW 1212          
BLAST of chorion peroxidase-like vs. SwissProt
Match: gi|317373515|sp|A1KZ92.3|PXDNL_HUMAN (RecName: Full=Peroxidasin-like protein; AltName: Full=Cardiac peroxidase; AltName: Full=Vascular peroxidase 2; AltName: Full=polysomal ribonuclease 1; Short=PRM1; Flags: Precursor)

HSP 1 Score: 378.637 bits (971), Expect = 5.429e-113
Identity = 238/604 (39.40%), Postives = 322/604 (53.31%), Query Frame = 0
Query:  230 RSANLEFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALV-ADHDKPSQEFTLLLMQWGQFVDHDMTHT-PLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLG----------PREQVNQITAFLDASNVYGSETSEARLLRLGR--RGRLRVT---QYGGSELLPLD---PDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLIL---GTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKA--LQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSF--SAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAWRN 806
            R  + ++R+ DG+CNN Q   WG A  A  RLL P Y DGI  PRG      +   LP PR V+     A    P   +T +LM WG F++HD+ HT P +     S    CS+  V   D   P C P++    D         CM F RS PA    C  G           REQ+NQ TA++D SNVYGS   E++ LR     RG L+        G  LLP     P ECA   +   CF AGD R NE   L  MHTLW REHNR+ ++LS LN  W+   +YQEARKIVGA+LQHIT++ WLP +L   GTR +          G+ + Y+P++   I N+FATAAFRFGH+L+   +         +    L  H+    P  I ++  ID  LRGL    ++    S+  S ELT  LF     S  +D  A  +QRGRDHGIP Y+++R  C L  +  + ++ N +   EI  +L++LY S  +IDL+   M+E    G+ VGPT  C+   QF+RL+ GDRFW+E    P  F+  QL  L+++SL+R++CDNGD++QQVQ  VF KA       +CS   IP+V+L  W++
Sbjct:  721 RCFHAKYRAHDGTCNNLQQPTWGAALTAFARLLQPAYRDGIRAPRGLGLPVGSRQPLPPPRLVATVWARAAAVTPDHSYTRMLMHWGWFLEHDLDHTVPALSTARFSDGRPCSS--VCTND---PPCFPMNTRHADPRGTH--APCMLFARSSPA----CASGRPSATVDSVYAREQINQQTAYIDGSNVYGSSERESQALRDPSVPRGLLKTGFPWPPSGKPLLPFSTGPPTECARQEQESPCFLAGDHRANEHLALAAMHTLWFREHNRMATELSALNPHWEGNTVYQEARKIVGAELQHITYSHWLPKVLGDPGTRML---------RGY-RGYNPNVNAGIINSFATAAFRFGHTLINPILYRLNATLGEISEGHLPFHKALFSPSRIIKEGGIDPVLRGLFGVAAKWRAPSYLLSPELTQRLFSA-AYSAAVDSAATIIQRGRDHGIPPYVDFRVFCNLTSVKNFEDLQNEIKDSEIRQKLRKLYGSPGDIDLWPALMVEDLIPGTRVGPTLMCLFVTQFQRLRDGDRFWYE---NPGVFTPAQLTQLKQASLSRVLCDNGDSIQQVQADVFVKAEYPQDYLNCS--EIPKVDLRVWQD 1297          
BLAST of chorion peroxidase-like vs. SwissProt
Match: gi|172048149|sp|A8WQH2.1|PXDN_CAEBR (RecName: Full=Peroxidasin homolog; Flags: Precursor)

HSP 1 Score: 375.17 bits (962), Expect = 1.290e-112
Identity = 241/728 (33.10%), Postives = 374/728 (51.37%), Query Frame = 0
Query:  123 QVRRQIEAGLRQAGLVISRGSLTPVAKHKRLQKTTAKARSLGRKAAKLVEASNQLQQSFNL--SPAQGTHALPVFSLVGTSLAVSDEDHAEMCNAIDGSTGFVLEAGQCRSA------NLEFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRP----RGQMSNDPTVSSLPSPRDVSEALVADHD-KPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPEC--------MPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGP----------REQVNQITAFLDASNVYGSETSEARLLR--LGRRGRLR--VTQYGGSELLPLDPDECADHSKRQY-------CFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFG--LFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGS--FSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAW 804
            + R+ +E+ + +    +++  +T     KRL +      S  ++A +L +A    ++S  L     +    L V  L   +++     H     A+ G +G     GQ ++       + ++RS DG CNN+   + G + + L+RLL P YE+G + P    +G++ N      +P+ R+VS  LVA     P ++ + ++MQWGQFVDHD+THT          +   S  +   G   +  C        +P+S S            C+EF RS     A C  G           REQ+N +T+FLDASNVYGS   +A+ LR      G+LR  +T   G E LP + D   D  +R +       CF AGD R NEQ  L   HT+++REHNRI  +L  +N  WD E +Y E RKI+GA +QHITF  WLP++ G +   D  +     G  Q YDP+I+ S+TNAFATAAFRFGH+++   +   G      +   + LH+    P  +  +  ID  LRGL   P +    +   + EL + LF  +     +DL  +N+QR RDHG+P Y EYR+ C LP    W ++   +    I+ +L+ LY   + IDL++GG++E      L GPTF CIIG+QF++++ GDRFW+E   +   F+ +Q+  +++ +LAR++CDNGD + ++Q  VF    G  ++     +    ++L+AW
Sbjct:  519 KARQNVESAVEKTRKQLNQDKITNTNDLKRLFRF-----STPKQAVELSKAREIYEESVRLVREHVEKGLILNVDELHPNNVSYESVLHVTHVQALMGLSG--CHTGQFKNPCTDTCFHNKYRSFDGQCNNKNKPMNGVSLMPLRRLLKPVYENGFNTPVGWEKGKLYNG---YPMPNVREVSRQLVATETITPHRKLSSMVMQWGQFVDHDLTHT----------VTALSRHSYATGAFCNRTCDNLDPCFNIPLSPSDPRVISESAKYPCIEFERSA----AVCGSGETSLVFNRVTYREQMNALTSFLDASNVYGSNEVQAQELRDTYNNNGQLRYDITSAAGKEYLPFEKDSNMD-CRRNFSEENPIRCFLAGDLRANEQLALAATHTIFVREHNRIAKKLKKMNGNWDGEVIYHETRKIIGAMMQHITFKHWLPVVFGGQEQMDKFV-----GKYQGYDPAIDSSVTNAFATAAFRFGHTIINPTLFRLGNDFMSIKQGHIALHKAFFTPELVLTEGGIDPLLRGLFASPLKHPMPTQLLNMELIEKLFM-KGHEVSLDLAVMNIQRSRDHGLPSYTEYRQFCNLPVPARWEDMKGYIKDDMIIQKLRGLYGVPQNIDLWVGGIVEEKLENGLFGPTFACIIGEQFRKMRDGDRFWYE---KDGVFTPEQMKEIKKVTLARLLCDNGDEIDRIQKDVF-MYPGKEKENYGRCEDTEMMDLKAW 1211          
BLAST of chorion peroxidase-like vs. nr
Match: gi|1325312039|ref|XP_023337651.1| (peroxidase-like [Eurytemora affinis] >gi|1325312041|ref|XP_023337652.1| peroxidase-like [Eurytemora affinis])

HSP 1 Score: 783.867 bits (2023), Expect = 0.000e+0
Identity = 397/807 (49.19%), Postives = 537/807 (66.54%), Query Frame = 0
Query:    4 QKTLPV---IGLLGVLVSLISTEVRGQSVGFCTTLHGKQGQCKPLVKCVRFVHEIPLLQNQPCQLLTGEVGVCCPHIVIGTATFRKPRRNTVLRRPPRPP-VPLPPIRTNDIQQANFGAEQRLQVRRQIEAGLRQAGLVISRGSLTPVAKHKRLQKTTAKARSLGRKAAKLVEASNQLQQSFNLSPAQGTHALPVFSLVGTSLAVSDEDHAEMCNAIDGSTGFVLEAGQCRSANLEFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCC-SNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAWR 805
            Q+T+P      L GVLVS  + +V G     C+  +G  G C+ L++CVRFV EI LL + PC L  GE GVCCPH +I       P++ + + +PP  P V +P IR +DI  A   A + +  R ++   L    +   RG  T     +R + T  ++ + G+KAA  +E S QL   FNLS AQGT ALP FSL G+   + D       N  D                  +R +DGSCNN+  ++WG+AN  LQRLL  +YEDG+ +PR        +S+LPSPR VS +  +  D+P  ++TL+LMQWGQFVDHD+THTP V+G ++  I+CC S+G+++  +  H EC+PI I   D FY + GQ+CMEFVRSMPA    C+ GPREQVNQITA++D SNVYGSE  EAR LRL   GRLRVT+  G +LLPL+P++C +  + +YCFAAGD RCNEQ  LTV HT+W+REHNRI  +L  LN+ WDDE+LYQEAR+IV AQLQHIT+NEWLP+ILG +YMD  N+ P  SG++++YDPS+ P+ITN F TAAFRFGHSL+QGQIE F  FG  +K + L + Q  P+++Y+  ++++F+RGLTTQ SQ LD +FS E+  HLF++ N   GMDLVALN+QRGRDHG+P YM++R+LC L    +W+++  +  S E V RLQ LY ++ +IDLF+G +LE    G ++GPTFQC++GDQF RLK GDRFW+E  N+ N F+ DQL  LR SSLAR++C+N +++  +QPLVF +    N++A C  + IPR+NL  WR
Sbjct:   60 QRTVPFQRDSSLGGVLVS--NKQVAGPE---CSARNGVLGDCRTLIRCVRFVFEIDLLLSAPCILPHGERGVCCPHTLI----VHTPKQTSNIIQPPEEPFVVIPNIRASDISAAVDIAFKNINKREKVAESLFNKQIFAQRG--TAAFSAQRFKSTNRQSVAEGKKAALGLETSVQLSARFNLSEAQGTFALPQFSLKGSR--IEDTCPTPPLNCPDSL----------------YRKIDGSCNNKNQTLWGRANTPLQRLLPSKYEDGLDKPR--------ISNLPSPRAVSSSTTSSQDQPHGKYTLMLMQWGQFVDHDVTHTPTVKGANEVGIICCGSDGSLLPKNNLHRECLPIEIPENDRFYSKFGQRCMEFVRSMPAPRTSCNFGPREQVNQITAWIDGSNVYGSEDEEARKLRLLAGGRLRVTKVQGRDLLPLNPNDCENEKQHRYCFAAGDLRCNEQLDLTVTHTVWMREHNRIAKELQRLNNNWDDEKLYQEARRIVIAQLQHITYNEWLPIILGNKYMDKWNMHPKDSGYSENYDPSVNPTITNVFGTAAFRFGHSLIQGQIESFNTFGTNVKTISLTKTQFAPYDLYDNLTLETFVRGLTTQKSQSLDTAFSEEIVGHLFEQDNEGFGMDLVALNIQRGRDHGLPPYMDWRELCNLDTFDSWKDLATIFPSME-VARLQALYQTVNDIDLFVGALLESSEEG-ILGPTFQCLLGDQFARLKTGDRFWYE--NKENGFTSDQLMELRHSSLARVLCENVEDIGSIQPLVFLQPDVNNRRAGCESEMIPRINLSKWR 825          
BLAST of chorion peroxidase-like vs. nr
Match: gi|1339090953|ref|XP_023706652.1| (peroxidase-like [Cryptotermes secundus] >gi|1330917018|gb|PNF34740.1| Chorion peroxidase [Cryptotermes secundus])

HSP 1 Score: 729.169 bits (1881), Expect = 0.000e+0
Identity = 377/780 (48.33%), Postives = 507/780 (65.00%), Query Frame = 0
Query:   32 CTTLHGKQGQCKPLVKCVRFVHEIPLLQNQPCQLLTGEVGVCCP---HIVIGTATFRKPRRNTVLRRPPRPPVPLPPIRTNDIQQANFGAEQRLQVRRQIEAGLRQAGLVISRGSLTPVAKHKRLQKTTAKARSLGRKAAKLVEASNQLQQSFNLSPAQGTHALPVFSLVGTSLAVSDEDHAEMCNAIDGSTGFVLEAGQC-RSANL---EFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAW 804
            C+TL G+ G C+PLVKC+ F  ++P L+ QPC+L   E+GVCCP      +  A   +P    ++  PP   V  P      +  A   A +R++ R Q  A L    +++  G  TP A H+   +TT      G +A K VEAS  L   F LSP QG  ALP FS++ T +A S                       C R AN    ++RS DGSCNN Q+  WG+A  ALQR+L P+Y DG++ PR       T   LPSPR +S     + D PS+ +TLLLMQWGQF+DHD+THTP+  G+  S + CC +G++++ +L HP+C PI++   D  + RLGQ+CMEFVRS+PA   EC+ GPREQ+NQIT + D SN+YGS  S  R LR GR GRL +   GG +LLP +  EC D ++R  CF AGD R NEQ +L VMHTLW+REHNR+ ++L+ LN  W DE L+QEAR+IV A++QHIT+NE+LPLILG  YM+   LSP  SG T+ YD S+ PSITN FATAAFRFGH+L+Q +I  F  FGN  + L+L +HQ  PF +YE   +D+ +RGL+TQ SQ  D  FS +LTDHLFQ  +   G+DLVALN QRGRDHG+P Y ++R++CGLPR  +W  +++V+ S + V  LQ LYSS++EIDLF+  + E+   G+L+G TF C++GDQF RL+ GDRF++EEG QP+SFS  QL  LR++SLARI+CDN D++  +QPL F +AS +NQ+ +C+ + IPRV+L AW
Sbjct:  133 CSTLSGEAGLCRPLVKCITFYAQVPELRRQPCKLQGQELGVCCPLKKRPTVVPAGLDRPNHGVLVPPPPPSVVIPP-FSPEQLNNAAVVALERIRQRLQFVASLFANNVIVQVG--TPAAWHQEFFQTTNATLQQGEEAQKGVEASVSLVNEFQLSPDQGRFALPTFSILNTVIADS-----------------------CPRPANCTPRKYRSADGSCNNLQNERWGRAGTALQRILPPKYGDGVNSPRVAA----TGRELPSPRLISTQFATERDAPSENYTLLLMQWGQFLDHDLTHTPISRGQSGSGLSCCRDGDIIKPELRHPDCFPITLPRNDHIFARLGQRCMEFVRSLPAPRPECNFGPREQMNQITGYQDGSNIYGSSLSAQRELREGRGGRLAIQNVGGRQLLPANRGECTDDAERLACFKAGDTRVNEQVELVVMHTLWMREHNRVAAELAKLNPSWGDEALFQEARRIVVAEMQHITYNEFLPLILGRDYMEKFELSPRDSGATRLYDESLNPSITNVFATAAFRFGHTLIQSRILGFSRFGNVRENLELSQHQFAPFVLYENGVLDNLVRGLSTQSSQRFDRFFSNQLTDHLFQG-DLDFGLDLVALNTQRGRDHGLPPYNDWREVCGLPRARSWDSLLDVMDS-QSVAALQELYSSVDEIDLFVAAVAEKPLPGALLGQTFVCLVGDQFARLRRGDRFYYEEGGQPSSFSPQQLVQLRKASLARILCDNSDDIALMQPLAFFRASFVNQRVACASESIPRVDLSAW 880          
BLAST of chorion peroxidase-like vs. nr
Match: gi|985416330|ref|XP_015373617.1| (PREDICTED: peroxidase-like [Diuraphis noxia])

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 369/787 (46.89%), Postives = 496/787 (63.02%), Query Frame = 0
Query:   30 GFCTTLHGKQGQCKPLVKCVRFVHEIPLLQNQPCQLLTGEVGVCCPHIVIGTATFRKPRRNT------------VLRRPPRPPVPLPPIRTNDIQQANFGAEQRLQVRRQIEAGLRQAGLVISRGSLTPVAKHKRLQKTTAKARSLGRKAAKLVEASNQLQQSFNLSPAQGTHALPVFSLVGTSLAVSDEDHAEMCNAIDGSTGFVLEAGQCRSANLEFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAW 804
            G C T  G+ G C+PLV C+ F  E+P L+ QPC+L   E GVCCP         R P  N+            V+R PP PPV +P      +  A   A QRL  RR +   L    +++  GS    A H+ L  TT +  + G +A K V+AS  L   FNL+  QGT ALP FS++ T L        + C      T F      C+    ++RS DGSCNN +H +WG+A+ ALQR+L P+Y DG++ PR +  N    S LPS R VS     D D PS+ +T+LLMQWGQF+DHD THTP+  G+  S I CC NG  +   L HP+C  I I   D  +   G++CMEFVRS+PA   EC+ GPREQ+NQITA+LD SN+YGS  +  + LR  R G L+     G +LLP +P EC+D + R  CF AGD R NEQ  L ++HT+WLREHNRI  +LS LN +W DE ++QE R+IV AQLQHIT+NE+LP+ILG  YM    LSP++SG+T++YDP +   ITNAFA AA+RFGH+L+QG I  +G FGN  + L L +    PF +Y++ + D F+RG++ Q SQ  D  F+ E+TDHLFQ  N + G+DLVALN+QRGRDHG+P Y E+R++CG  +  +W ++   +  P+ + RL RLY S++EIDL++GG+ E+    +LVGPTF CIIGDQF RL+ GDRF++EEG  P+SF   QL  LR+SSLAR++CDN D+M  +QPL F K S +NQ+ +C+   IP+++L AW
Sbjct:  140 GSCKTASGESGTCRPLVSCLSFYAELPELKKQPCKLAVNEFGVCCP------PKNRNPAANSQQTTSAATTVTGVIRAPPPPPVDIPSFTPEQLNVAAANALQRLNERRVLVTSLFTKRILVPTGSA--AAWHQELFPTTNETLTQGEQAQKSVDASVGLVNDFNLTRDQGTFALPSFSILDTVLG-------DTC----PRTSF------CQPH--KYRSTDGSCNNIKHELWGRASTALQRILPPKYGDGVNSPRSRAVNG---SPLPSARQVSVTFTQDVDSPSENYTMLLMQWGQFLDHDTTHTPISRGQMGSGISCCRNGREIENSLRHPDCFQIEIPRNDHMFAPFGERCMEFVRSLPAPRPECNFGPREQMNQITAYLDGSNIYGSSLATQQSLRTFRGGTLQSQNIRGRQLLPGNPSECSDDTGRSACFKAGDGRVNEQIDLALLHTIWLREHNRIAFELSRLNPRWSDEAIFQETRRIVIAQLQHITYNEFLPIILGRSYMTKFGLSPAESGWTRNYDPELNAGITNAFAAAAYRFGHTLIQGNIHGYGKFGNIRENLVLSKQHFAPFNLYKEGAFDDFIRGISFQSSQNFDRFFTKEITDHLFQG-NLNFGLDLVALNVQRGRDHGLPPYNEWRQVCGYEKARSWNDLEEYM-DPQTITRLARLYGSVDEIDLYIGGVSEKPMKDALVGPTFVCIIGDQFSRLRRGDRFFYEEGGHPSSFDQVQLQELRKSSLARLLCDNSDDMALIQPLAFSKPSFLNQRVACASSSIPKMDLRAW 894          
BLAST of chorion peroxidase-like vs. nr
Match: gi|328700364|ref|XP_001946672.2| (PREDICTED: peroxidase [Acyrthosiphon pisum])

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 368/779 (47.24%), Postives = 497/779 (63.80%), Query Frame = 0
Query:   30 GFCTTLHGKQGQCKPLVKCVRFVHEIPLLQNQPCQLLTGEVGVCCP----HIVIGTATFRKPRRNTVLRRPPRPPVPLPPIRTNDIQQANFGAEQRLQVRRQIEAGLRQAGLVISRGSLTPVAKHKRLQKTTAKARSLGRKAAKLVEASNQLQQSFNLSPAQGTHALPVFSLVGTSLAVSDEDHAEMCNAIDGSTGFVLEAGQCRSANLEFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAW 804
            G C T+ G+ G C+PLV C+ F  E+P L+ QPC+L   E GVCCP    +  I            V+R PP PPV +PP  +  +  A   A QRL  RR +   L    +++  GS    A H+ L  TT +  + G +A K V+AS  L   FNL+  QGT ALP FS++ T L        + C      T F      C+    ++RS DGSCNN +H +WG+A+ ALQR+L P+Y DG++ PR + +N    S LPS R VS     D D PS+ +T+LLMQWGQF+DHD THTP+  G+  S I CC NG  +   L HP+C  I I   D  +   G++CMEFVRS+PA   EC+ GPREQ+NQITA+LD SN+YGS  S  + LR  R G L+     G +LLP +P EC+D + R  CF AGD R NEQ  L ++HT+WLREHNRI  +LS LN +W DE ++QE R+I+ AQLQHIT+NE+LP+ILG  YM    LSP++SG+ ++YDP +   ITNAFA AA+RFGH+L+QG I  +G FGN  + L L +    PF +Y++ ++D F+RG++ Q SQ  D  F+ E+TDHLFQ  N + G+DLVALN+QRGRDHG+P Y E+R++CG  +   W ++   +  P+ + RL RLY S++EIDL++GG+ E+    +LVGPTF CIIGDQF RL+ GDRF++EEG  P+SF   QL  LR+SSLAR++CDN D+M  +QPL F K S +NQ+ +C+   IP+V+L AW
Sbjct:  142 GSCKTVSGESGTCRPLVSCLSFYAELPELKKQPCKLAVNEFGVCCPPKNRNPAINQPMTAATTVTGVIRAPPPPPVDIPPFTSEQLNVAAANALQRLNERRVLVTSLFTKRILVPTGSA--AAWHQELFPTTNETLTQGEQAQKSVDASVGLVNDFNLTREQGTFALPSFSILDTVLG-------DTC----PRTSF------CQPH--KYRSTDGSCNNIKHELWGRASTALQRILPPKYGDGVNSPRSRAANG---SPLPSARQVSVTFTQDVDSPSENYTMLLMQWGQFLDHDTTHTPISRGQMGSGISCCRNGREIENSLRHPDCFQIEIPRNDHMFAPFGERCMEFVRSLPAPRPECNFGPREQMNQITAYLDGSNIYGSSLSTQQSLRTFRGGTLQSQNIRGKQLLPGNPSECSDDTGRSACFKAGDGRVNEQIDLALLHTIWLREHNRIAFELSRLNPRWSDEAIFQETRRIIIAQLQHITYNEFLPIILGRSYMAKFGLSPAESGWARNYDPELNAGITNAFAAAAYRFGHTLIQGNIHGYGKFGNIRENLVLSKQHFAPFNLYKEGALDDFIRGISFQSSQNFDRFFTKEITDHLFQG-NLNFGLDLVALNVQRGRDHGLPPYNEWRQVCGYEKARNWNDLEEYM-DPQTITRLARLYGSVDEIDLYIGGVSEKPMKDALVGPTFVCIIGDQFSRLRRGDRFFYEEGGHPSSFDQVQLQELRKSSLARLLCDNSDDMALIQPLAFLKPSFLNQRVACASSSIPKVDLRAW 894          
BLAST of chorion peroxidase-like vs. nr
Match: gi|1229904861|ref|XP_022173288.1| (peroxidase-like [Myzus persicae])

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 370/779 (47.50%), Postives = 497/779 (63.80%), Query Frame = 0
Query:   30 GFCTTLHGKQGQCKPLVKCVRFVHEIPLLQNQPCQLLTGEVGVCCPHIVIGTATFRKPRRNT----VLRRPPRPPVPLPPIRTNDIQQANFGAEQRLQVRRQIEAGLRQAGLVISRGSLTPVAKHKRLQKTTAKARSLGRKAAKLVEASNQLQQSFNLSPAQGTHALPVFSLVGTSLAVSDEDHAEMCNAIDGSTGFVLEAGQCRSANLEFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAW 804
            G C T +G+ G C+PLV C+ F  E+P L+ QPC+L   E GVCCP      A  ++    T    V+R PP PPV +PP     +  A   A QRL  RR +   L    +++  GS    A H+ L  TT +  S G +A K V+AS  L   FNLS  QGT ALP FS++ T L        + C      T F      C+    ++RS DGSCNN +H +WG+A+ ALQR+L P+Y DG++ PR +  N    S LPS R VS     D D PS+ +T+LLMQWGQF+DHD THTP+  G+  S I CC NG  +   L HP+C  I I   D  +   G++CMEFVRS+PA   EC+ GPREQ+NQITA+LD S++YGS     + LR  R G L+     G +LLP +P EC+D + R  CF AGD R NEQ  L ++HT+WLREHNRI  +LS LN +W DE ++QE R+I+ AQLQHIT+NE+LP+ILG  YM    LSP++SG+T++YDP +   ITNAFA AA+RFGH+L+QG I  +G FGN  + L L +    PF +Y++ ++D F+RG++ Q SQ  D  F+ E+TDHLFQ  N + G+DLVALN+QRGRDHG+P Y E+R++CG  +   W ++   +  P+ + RL RLY S++EIDL++GG+ E+    +LVGPTF CIIGDQF RL+ GDRF++EEG  P+SF   QL  LR+SSLAR++CDN D+M  +QPL F K S +NQ+ +C+   IP+V+L AW
Sbjct:  146 GSCKTANGEPGTCRPLVSCLSFYAELPGLKKQPCKLAVNEFGVCCPPKNRNPANNQQTAAATTVTGVIRAPPPPPVDIPPFTPEQLNIAATNALQRLNERRVLVTSLFTKRILVPTGSA--AAWHQELFPTTNETLSQGEQAQKSVDASVGLVNDFNLSRDQGTFALPSFSILDTVLG-------DTC----PRTSF------CQPH--KYRSTDGSCNNIKHELWGRASTALQRILPPKYGDGVNSPRSRAVNG---SPLPSARQVSVTFTQDVDSPSENYTMLLMQWGQFLDHDTTHTPISRGQMGSGISCCRNGREIESSLRHPDCFQIEIPRNDPMFAPFGERCMEFVRSLPAPRPECNFGPREQMNQITAYLDGSHIYGSSLVTQQSLRTFRGGTLQSQNIRGKQLLPGNPSECSDDTGRSACFKAGDGRVNEQIDLALLHTIWLREHNRIAFELSRLNPRWSDEAIFQETRRIIIAQLQHITYNEFLPIILGRSYMAKFGLSPAESGWTRNYDPELNAGITNAFAAAAYRFGHTLIQGNIHGYGKFGNIRENLVLSKQHFAPFNLYKEGALDDFIRGISFQSSQNFDRFFTKEITDHLFQG-NLNFGLDLVALNVQRGRDHGLPPYNEWRQVCGYEKARNWNDLEEYM-DPQTITRLARLYGSVDEIDLYIGGVSEKPMKDALVGPTFVCIIGDQFSRLRRGDRFFYEEGGHPSSFDQVQLQELRKSSLARLLCDNSDDMALIQPLAFLKPSFLNQRVACASSSIPKVDLRAW 898          
BLAST of chorion peroxidase-like vs. nr
Match: gi|1227978872|ref|XP_021921010.1| (peroxidase-like [Zootermopsis nevadensis])

HSP 1 Score: 701.819 bits (1810), Expect = 0.000e+0
Identity = 362/778 (46.53%), Postives = 500/778 (64.27%), Query Frame = 0
Query:   32 CTTLHGKQGQCKPLVKCVRFVHEIPLLQNQPCQLLTGEVGVCCPHIVIGTATFRKPRRNTVLRRPPRPPVPLP-----PIRTNDIQQANFGAEQRLQVRRQIEAGLRQAGLVISRGSLTPVAKHKRLQKTTAKARSLGRKAAKLVEASNQLQQSFNLSPAQGTHALPVFSLVGTSLAVSDEDHAEMCNAIDGSTGFVLEAGQCRSANLEFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAW 804
            C+T+ G+ G C+PLVKC+ F  E+P L+ QPC+L   EVGVCCP                + +RP   P  L      P     +  A   A +R++ R Q  A L  + +++  G  TP A H+   +TT      G +A K VEAS  L   F LSP QG  ALP FS++ T +A       + C               CR    ++R+ DGSCNN Q+  WG A  ALQR+L P+Y DG++ PR   + +     LPS R +S     + D P + +TLL+MQWGQF+DHD+THTP+  G+  S + CC +G+V++ +L HP+C PI +   D  + + G++CMEFVRS+PA   EC+ GPREQ+NQ+TA+LD SN+YGS     R LR GR GRL +   GG +LLP +  EC D ++R  CF AGD R NEQ +LTVMHT+WLREHNR+ ++L+ LN +W DE L+QEAR++V A++QHIT+NE+LPL+LG  YM+   LSP   GFT+ YD S+ PSITNAFATAAFRFGHSL+Q  ++ F  FGN  + L+L  HQ  PF +YE   +D F+RGL+TQ  Q  D  FS +LTDHLFQ  +   G+DL ALN+QRGRDHG+P Y ++R++CGLPR  +W  +++V+ S + V  L+ LY S++EIDL+   + E+   G+L+G TF C++GDQF RL+ GDRF++EEGNQP++FS  Q+  LR +SL+RI+CDN D++  +QPL F +AS +NQ+ +C+ + IPRV+L AW
Sbjct:  171 CSTVSGEPGLCRPLVKCITFYAEVPELRRQPCRLQGQEVGVCCP----------------LRKRPSVVPAGLDRPNHGPFSPQQLNAAAALALERVRQRLQFVASLFASNVIVQVG--TPAAWHQEFFQTTNATLQQGEEAQKGVEASVSLVNEFQLSPDQGRFALPTFSILNTVIA-------DTCR----------RPANCRPD--KYRTADGSCNNLQNERWGLAGSALQRVLPPKYGDGVNSPRVAANGE----ELPSARLLSTQFAQEADIPYENYTLLVMQWGQFLDHDLTHTPISRGQSGSGLSCCRDGDVIKSELRHPDCFPIPLPRNDHIFAKFGERCMEFVRSLPAPRPECNFGPREQMNQVTAYLDGSNIYGSSQDAQRGLREGRGGRLAIQNVGGRQLLPENRGECTDDTERLACFKAGDTRVNEQVELTVMHTVWLREHNRVAAELARLNPEWSDEALFQEARRVVVAEMQHITYNEFLPLVLGLDYMEKFELSPRDGGFTELYDESLNPSITNAFATAAFRFGHSLIQSHMQGFSRFGNVRENLELSHHQFAPFVLYENGVLDDFVRGLSTQTCQRFDRFFSKQLTDHLFQG-DLDFGLDLFALNIQRGRDHGLPPYNDWREVCGLPRARSWDNLLDVMDS-QSVEVLRGLYKSVDEIDLYAAAVAEKPLPGALLGQTFVCLVGDQFARLRRGDRFYYEEGNQPSAFSPKQVEQLRRASLSRILCDNSDDIAVMQPLAFFQASFVNQRVTCASESIPRVDLNAW 905          
BLAST of chorion peroxidase-like vs. nr
Match: gi|1228407835|ref|XP_021963148.1| (peroxidase-like isoform X1 [Folsomia candida])

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 356/783 (45.47%), Postives = 504/783 (64.37%), Query Frame = 0
Query:   32 CTTLHGKQGQCKPLVKCVRFVHEIPLLQNQPCQLLTGEVGVCCP----HIVIGTATFRKPR-----RNTVLRRPPRPPVPLPPIRTNDIQQANFGAEQRLQVR-RQIEAGLRQAGLVISRGSLTPVAKHKRLQKTTAKARSLGRKAAKLVEASNQLQQSFNLSPAQGTHALPVFSLVGTSLAVSDEDHAEMCNAIDGSTGFVLEAGQCRSANLEFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAW 804
            C+T  G+QG CKPL +C  F  EIP L  +PC+   G+ GVCCP      V+G    +KP+      N VL  PP P V +P +   +++     +  + Q R  +I   L    + I +GS  P A H++  +TT +    G  A   +EAS  +    NLSP QGT  LP  ++ GT +  S       CN                  N  +R++DGSCNN+Q+  WG++  A QR+L P+Y DGI+ PR Q +  P    LPS R +S+  + D ++P    TL++MQWGQF+DHD+THTP+V+G +   I CC NG  +  +L HP+C PI ISS DSFY R  Q+CMEFVRS+PA   EC+ GPREQ+NQITA++D SNVYGS  + AR LR G  GRL V     +ELLP + +EC++ ++ ++CF AGD R NEQ +L +MHT+WLREHNRI   L  LN  W DE LYQE R+IV A+L+HIT+NE+LPLILG  YM    + P + G+T+ Y+  I+ SITNAF+TAA+RFGHS+VQG I+ F  FG+  + +   + Q +PF++Y+  S+D  +RGLT Q SQ +D   S  +T+HLF E ++  G+DL+ALN+QRGRDHG+P Y ++R++C L ++ +W+E+V V+     V  L +LY S++EIDLF+GG+ ER  SG+++GPTF CI+GDQF RL+ GDRF++EE +  + F+  QL+ +R+ SLARIICDN D++  +QPLVF++AS +NQ+  C+ + IP+++L+ W
Sbjct:   48 CSTPDGRQGFCKPLAQCAIFYAEIPTLLERPCETKAGQKGVCCPIDNAQQVVGPR--QKPQGTGVGANGVLTAPPPPQVVIPRLSRKELENIAERSVAKFQERVERISDLLFNKRVTIPKGS--PAAAHQKFFETTNQVLDKGNDAQLNIEASQNIVNDLNLSPEQGTFGLPQITVRGTKVE-STCPPVSRCNP-----------------NFPYRTMDGSCNNKQNPDWGKSQTAFQRILPPKYGDGINSPRAQANRQP----LPSARTISDRFITDENRPYNNLTLMVMQWGQFLDHDLTHTPIVKGNNSVGISCCQNGQPLPENLRHPDCFPIEISSEDSFYRRFTQRCMEFVRSLPAPRRECNFGPREQMNQITAYIDGSNVYGSSDNRARSLREGVGGRLLVQTNQRTELLPANSNECSNAAQDRFCFRAGDLRVNEQVELALMHTIWLREHNRIARILQGLNPTWSDEILYQETRRIVIAELEHITYNEFLPLILGPDYMRTFEMQPRQKGYTRLYNEEIDASITNAFSTAAYRFGHSMVQGIIQTFSKFGSS-RTMPFAKTQFQPFQLYD--SLDDLVRGLTNQESQRMDHFVSEAITNHLF-EGSSGFGLDLMALNIQRGRDHGLPSYNDWREVCSLKKIGSWQELVGVMDD-SAVRILSQLYPSVDEIDLFVGGIGERPQSGAVLGPTFVCIVGDQFSRLRRGDRFFYEEVS--SRFTEAQLDQIRKVSLARIICDNSDDISVIQPLVFQQASFLNQRQPCNTEVIPKLDLKFW 797          
BLAST of chorion peroxidase-like vs. nr
Match: gi|1228407837|ref|XP_021963149.1| (peroxidase-like isoform X2 [Folsomia candida])

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 364/823 (44.23%), Postives = 518/823 (62.94%), Query Frame = 0
Query:    4 QKTLPVIGLLGVLVSLISTEVRGQSVGF------------CTTLHGKQGQCKPLVKCVRFVHEIPLLQNQPCQLLTGEVGVCCP----HIVIGTATFRKPR-----RNTVLRRPPRPPVPLPPIRTNDIQQANFGAEQRLQVR-RQIEAGLRQAGLVISRGSLTPVAKHKRLQKTTAKARSLGRKAAKLVEASNQLQQSFNLSPAQGTHALPVFSLVGTSLAVSDEDHAEMCNAIDGSTGFVLEAGQCRSANLEFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAW 804
            Q + P I LL V +S I  ++   ++              C+T  G+QG CKPL +C  F  EIP L  +PC+   G+ GVCCP      V+G    +KP+      N VL  PP P V +P +   +++     +  + Q R  +I   L    + I +GS  P A H++  +TT +    G  A   +EAS  +    NLSP QGT  LP  ++ GT +  S       CN                  N  +R++DGSCNN+Q+  WG++  A QR+L P+Y DGI+ PR Q +  P    LPS R +S+  + D ++P    TL++MQWGQF+DHD+THTP+V+G +   I CC NG  +  +L HP+C PI ISS DSFY R  Q+CMEFVRS+PA   EC+ GPREQ+NQITA++D SNVYGS  + AR LR G  GRL V     +ELLP + +EC++ ++ ++CF AGD R NEQ +L +MHT+WLREHNRI   L  LN  W DE LYQE R+IV A+L+HIT+NE+LPLILG  YM    + P + G+T+ Y+  I+ SITNAF+TAA+RFGHS+VQG I+ F  FG+  + +   + Q +PF++Y+  S+D  +RGLT Q SQ +D   S  +T+HLF E ++  G+DL+ALN+QRGRDHG+P Y ++R++C L ++ +W+E+V V+     V  L +LY S++EIDLF+GG+ ER  SG+++GPTF CI+GDQF RL+ GDRF++EE +  + F+  QL+ +R+ SLARIICDN D++  +QPLVF++AS +NQ+  C+ + IP+++L+ W
Sbjct:    5 QTSTPGIVLLLVSLSQIHGQIAFDTIVIQFDDAVTTNAPACSTPDGRQGFCKPLAQCAIFYAEIPTLLERPCETKAGQKGVCCPIDNAQQVVGPR--QKPQGTGVGANGVLTAPPPPQVVIPRLSRKELENIAERSVAKFQERVERISDLLFNKRVTIPKGS--PAAAHQKFFETTNQVLDKGNDAQLNIEASQNIVNDLNLSPEQGTFGLPQITVRGTKVE-STCPPVSRCNP-----------------NFPYRTMDGSCNNKQNPDWGKSQTAFQRILPPKYGDGINSPRAQANRQP----LPSARTISDRFITDENRPYNNLTLMVMQWGQFLDHDLTHTPIVKGNNSVGISCCQNGQPLPENLRHPDCFPIEISSEDSFYRRFTQRCMEFVRSLPAPRRECNFGPREQMNQITAYIDGSNVYGSSDNRARSLREGVGGRLLVQTNQRTELLPANSNECSNAAQDRFCFRAGDLRVNEQVELALMHTIWLREHNRIARILQGLNPTWSDEILYQETRRIVIAELEHITYNEFLPLILGPDYMRTFEMQPRQKGYTRLYNEEIDASITNAFSTAAYRFGHSMVQGIIQTFSKFGSS-RTMPFAKTQFQPFQLYD--SLDDLVRGLTNQESQRMDHFVSEAITNHLF-EGSSGFGLDLMALNIQRGRDHGLPSYNDWREVCSLKKIGSWQELVGVMDD-SAVRILSQLYPSVDEIDLFVGGIGERPQSGAVLGPTFVCIVGDQFSRLRRGDRFFYEEVS--SRFTEAQLDQIRKVSLARIICDNSDDISVIQPLVFQQASFLNQRQPCNTEVIPKLDLKFW 794          
BLAST of chorion peroxidase-like vs. nr
Match: gi|939629643|ref|XP_014275345.1| (PREDICTED: peroxidase-like [Halyomorpha halys])

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 346/775 (44.65%), Postives = 491/775 (63.35%), Query Frame = 0
Query:   32 CTTLHGKQGQCKPLVKCVRFVHEIPLLQNQPCQLLTGEVGVCCPHIVIGTATFRKPRRNTVLRRPPRPPVPLPPIRTNDIQQANFGAEQRLQVRRQIEAGLRQAGLVISRGSLTPVAKHKRLQKTTAKARSLGRKAAKLVEASNQLQQSFNLSPAQGTHALPVFSLVGTSLAVSDEDHAEMCNAIDGSTGFVLEAGQCRSANLEFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAWRN 806
            C    G++G C+PLVKC+ F  ++P L+ QPC L   + GVCCP +     +   P  + VLR PP PPV +PP+   +++ A     + ++ R Q    L   G+++  G  TP   H     TT +  ++G +A K ++AS  L   F+LSPAQGT ALP FSL+ T LA             D    F+    +C +A  ++R++DGSCNN  +  WGQA  ALQR+L P+Y DG++ PR           LPSPR ++     D + PS  +T+++MQWGQF+DHD+THTP+  G   S I CC  G V+  +L HP+C PI +   D  +   G++CMEF RS+PA   EC+ GPREQ+NQIT +LDASN+YGS    AR LRL R G LR     G   LP +P+EC D + R  CF+AGD R NEQ  L ++HT+WLREHNRI S L  ++ +W DE ++QEA++IV A+ QHIT+NE+LP++LG  YM+ ++L+P   G+T  YDP++   ITN FATAAFRFGHS +Q  +  +G FGN  + L++ ++   PF +Y + ++D  LRGL  QP Q +D  FS ++TDHLFQ  N   G+DLV+LN+QRGRDHG+  Y ++R++CGL R   W ++   +  P  +  + RLY ++++IDLF+G M E    G+++GPTF C+IGDQF RL+  DRF++EE NQP+SFS DQL  +R++SLARI+CDN D++ ++QPL F + S +NQ+  C  + IP ++L AW N
Sbjct:  144 CNMETGEEGLCRPLVKCLSFYADVPELRKQPCPLGKNQ-GVCCP-LKTPKVSGGGPTSSGVLRSPPPPPVQIPPLTPQNLETAAETGVEAIKDRFQFLVNLFSRGIIVQPG--TPAKWHLDFFPTTNETLAVGDQAQKNIQASKALVDEFSLSPAQGTFALPKFSLLNTVLA-------------DTCPPFI----RCFAA--KYRTMDGSCNNLANPHWGQAGTALQRILPPKYADGVNAPRTG-----EFGPLPSPRLITLFYATDVEFPSNNYTMMVMQWGQFLDHDLTHTPISRGASGSGISCCREGQVISPELRHPDCFPIDLPRNDRVFAPFGERCMEFARSLPAPRPECNFGPREQMNQITGYLDASNIYGSNRDTARSLRLFRGGFLRAQNVRGRAYLPGNPNECTDRTNRLACFSAGDGRVNEQVDLALIHTVWLREHNRIASILQRIHPEWSDEAIFQEAKRIVIAEYQHITYNEYLPILLGRAYMEKSSLAPKDKGWTTLYDPNLNGGITNVFATAAFRFGHSQIQSFLHGYGRFGNIRQNLEMSKNHFAPFMLYSEGAVDDMLRGLAAQPMQNVDRHFSNQITDHLFQG-NLDIGLDLVSLNIQRGRDHGLAPYNDWREVCGLRRAQRWEDLEEHM-EPSTIEVIARLYQNVDDIDLFVGAMGENPVQGAILGPTFLCLIGDQFARLRRADRFFYEEANQPSSFSSDQLTEIRKTSLARILCDNSDDLARIQPLAFIQPSFLNQRIPCDSRAIPSMDLRAWIN 888          
BLAST of chorion peroxidase-like vs. nr
Match: gi|1101353630|ref|XP_018902871.1| (PREDICTED: peroxidase-like [Bemisia tabaci])

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 352/775 (45.42%), Postives = 489/775 (63.10%), Query Frame = 0
Query:   32 CTTLHGKQGQCKPLVKCVRFVHEIPLLQNQPCQLLTGEVGVCCPHIVIGTATFRKPRRNTVLRRPPRPPVPLPPIRTNDIQQANFGAEQRLQVRRQIEAGLRQAGLVISRGSLTPVAKHKRLQKTTAKARSLGRKAAKLVEASNQLQQSFNLSPAQGTHALPVFSLVGTSLAVSDEDHAEMCNAIDGSTGFVLEAGQCRSANLEFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRPRGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVTQYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKALQLHRHQLEPFEIYEQNSIDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNGDNMQQVQPLVFKKASGMNQKASCSGKGIPRVNLEAWRN 806
            CTT  G+ G CK LVKCV    E+  L++QPC L   E GVCCP         R P +  +L  PP P V +PP+ T+D++QA   A  +++ R  +++ L    +++  GS  P A H+ L  TT      G+KA K +EAS  L + FNLSP Q T ALP FS++ T +A       + C           E  QC    L++RS+DG CNN  +  WG+   A QR+L P+Y DGI+ PR   SN      LPS R VS  +  D D P    TL++MQWGQF+DHD+THTP+  G+  S I CC  G V+   L HP+C PI I   D  + + G+ CMEFVRS+PA   EC+ GPREQ+NQI+ +LDAS +YGS     + LRL R GRLR     G ELLP +P EC+  S+R  CF AGD R NEQ +L +MHT+W+REHNR+  +L  ++  W DE L++E+R+IV A+LQHIT+NE+LP++LG  Y++   L+P + G T +YDP++   ITN FA AAFRFGHS +QG    +G FG+  +  QL +   +PF +Y   +ID F+RGL+ Q SQ+ D  F+ E+TDHLFQ  N   G+DLVA N+QRGRDHG+  Y ++R++CGL RL  W +  +V+ S + + RL  +Y SI+++DL++G + E    G+++GPTF C++GDQF RL+ GDRF++EEG   +SFS  QLN +R++SLAR++CDN D++  +QPL F K S +N++  C+   IP +NL AW+N
Sbjct:  199 CTTRRGRPGVCKALVKCVTHYLEVSELRSQPCALSPTEWGVCCPR---RPDDGRVPTKTGILEPPPPPKVEIPPLTTSDLRQAAKAAVTKVRDRLTLQSSLLNNRILVEPGS--PTASHQELFPTTNATLEQGQKAQKTIEASVSLSKDFNLSPDQSTFALPQFSILNTVIA-------DACP----------EKLQC--PRLKYRSIDGVCNNLVNGHWGRVGTAYQRVLPPKYTDGITSPR---SNGIDGRELPSARLVSSIVAQDADVPDANHTLMVMQWGQFLDHDLTHTPISRGQGGSGIACCRGGKVIDKRLRHPDCFPIGIPRNDPVFAQFGETCMEFVRSLPAARPECNFGPREQMNQISGYLDASMIYGSTFDTQQRLRLFRGGRLRAQVVRGKELLPDNPSECSS-SQRLSCFQAGDGRVNEQIELALMHTIWMREHNRVAEELFNMHPDWSDEALFEESRRIVIAELQHITYNEFLPIVLGRAYVEKFRLTPREVGHTHNYDPNLNGGITNVFAAAAFRFGHSQIQGNFHGYGKFGHIRENFQLSKQHFQPFVLYADGAIDDFVRGLSFQSSQKFDRFFTREVTDHLFQG-NQRFGLDLVAFNIQRGRDHGLQPYNQWREVCGLRRLRNWNDAESVMDS-QTIGRLANVYGSIDDVDLYIGAVSENPLPGAILGPTFVCLVGDQFARLRAGDRFFYEEGGDLSSFSTAQLNEIRKTSLARVLCDNSDDIVLMQPLAFWKPSYLNKRVPCNSPNIPAMNLRAWQN 943          
The following BLAST results are available for this feature:
BLAST of chorion peroxidase-like vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides)
Total hits: 23
Match NameE-valueIdentityDescription
EMLSAG000000130352.118e-11038.86supercontig:LSalAtl2s:LSalAtl2s99:469219:492645:-1... [more]
EMLSAG000000048742.614e-9335.05supercontig:LSalAtl2s:LSalAtl2s256:608070:622038:-... [more]
EMLSAG000000046791.017e-9231.59supercontig:LSalAtl2s:LSalAtl2s244:668666:671466:1... [more]
EMLSAG000000050195.067e-8739.29supercontig:LSalAtl2s:LSalAtl2s260:729964:778752:-... [more]
EMLSAG000000012239.423e-8134.07supercontig:LSalAtl2s:LSalAtl2s11:367926:374017:-1... [more]
EMLSAG000000101062.707e-7836.73supercontig:LSalAtl2s:LSalAtl2s667:295056:305896:1... [more]
EMLSAG000000010013.487e-5338.75supercontig:LSalAtl2s:LSalAtl2s116:345938:357083:-... [more]
EMLSAG000000112991.406e-4630.48supercontig:LSalAtl2s:LSalAtl2s777:83334:122249:-1... [more]
EMLSAG000000130343.010e-4141.05supercontig:LSalAtl2s:LSalAtl2s99:467720:469073:-1... [more]
EMLSAG000000071251.860e-2825.37supercontig:LSalAtl2s:LSalAtl2s401:98982:101147:1 ... [more]

Pages

back to top
BLAST of chorion peroxidase-like vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|290457651|sp|Q01603.2|PERO_DROME2.620e-13339.45RecName: Full=Peroxidase; Short=DmPO; AltName: Ful... [more]
gi|229462993|sp|Q9VEG6.3|PERC_DROME2.269e-13139.12RecName: Full=Chorion peroxidase; AltName: Full=Pe... [more]
gi|93140516|sp|Q7QH73.3|PERC_ANOGA1.479e-12841.85RecName: Full=Chorion peroxidase; Flags: Precursor[more]
gi|172045828|sp|Q92626.2|PXDN_HUMAN3.556e-12840.03RecName: Full=Peroxidasin homolog; AltName: Full=M... [more]
gi|341941778|sp|Q3UQ28.2|PXDN_MOUSE1.649e-12742.74RecName: Full=Peroxidasin homolog; Flags: Precurso... [more]
gi|172044151|sp|A4IGL7.1|PXDN_XENTR1.279e-12337.25RecName: Full=Peroxidasin; Flags: Precursor[more]
gi|74871953|sp|Q9VZZ4.1|PXDN_DROME8.644e-11638.56RecName: Full=Peroxidasin; Flags: Precursor[more]
gi|122119348|sp|Q1ENI8.1|PXDN_CAEEL4.085e-11534.18RecName: Full=Peroxidasin homolog; Flags: Precurso... [more]
gi|317373515|sp|A1KZ92.3|PXDNL_HUMAN5.429e-11339.40RecName: Full=Peroxidasin-like protein; AltName: F... [more]
gi|172048149|sp|A8WQH2.1|PXDN_CAEBR1.290e-11233.10RecName: Full=Peroxidasin homolog; Flags: Precurso... [more]

Pages

back to top
BLAST of chorion peroxidase-like vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR)
Total hits: 25
Match NameE-valueIdentityDescription
gi|1325312039|ref|XP_023337651.1|0.000e+049.19peroxidase-like [Eurytemora affinis] >gi|132531204... [more]
gi|1339090953|ref|XP_023706652.1|0.000e+048.33peroxidase-like [Cryptotermes secundus] >gi|133091... [more]
gi|985416330|ref|XP_015373617.1|0.000e+046.89PREDICTED: peroxidase-like [Diuraphis noxia][more]
gi|328700364|ref|XP_001946672.2|0.000e+047.24PREDICTED: peroxidase [Acyrthosiphon pisum][more]
gi|1229904861|ref|XP_022173288.1|0.000e+047.50peroxidase-like [Myzus persicae][more]
gi|1227978872|ref|XP_021921010.1|0.000e+046.53peroxidase-like [Zootermopsis nevadensis][more]
gi|1228407835|ref|XP_021963148.1|0.000e+045.47peroxidase-like isoform X1 [Folsomia candida][more]
gi|1228407837|ref|XP_021963149.1|0.000e+044.23peroxidase-like isoform X2 [Folsomia candida][more]
gi|939629643|ref|XP_014275345.1|0.000e+044.65PREDICTED: peroxidase-like [Halyomorpha halys][more]
gi|1101353630|ref|XP_018902871.1|0.000e+045.42PREDICTED: peroxidase-like [Bemisia tabaci][more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold274_size229011supercontigscaffold274_size229011:190991..196124 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
maker2018-02-12 .496401
T. kinsejongensis vs L. Salmonis peptides2018-04-19
T. kingejongensis peptided Blastp vs. SwissProt2018-04-19
T. kingsejongensis proteins Blastp vs. NR2018-05-15
Properties
Property NameValue
Note-
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
maker-scaffold274_size229011-snap-gene-1.21-mRNA-1maker-scaffold274_size229011-snap-gene-1.21-mRNA-1Tigriopus kingsejongensismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at scaffold274_size229011:190991..196124+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>maker-scaffold274_size229011-snap-gene-1.21 ID=maker-scaffold274_size229011-snap-gene-1.21|Name=chorion peroxidase-like|organism=Tigriopus kingsejongensis|type=gene|length=5134bp|location=Sequence derived from alignment at scaffold274_size229011:190991..196124+ (Tigriopus kingsejongensis)
TCGAGATGAGACAACAGAAGACTTTGCCTGTGATCGGTTTACTTGGCGTG TTGGTGTCACTAATCAGTACCGAGGTCAGAGGACAGTCGGTAGGATTCTG CACCACGCTCCACGGAAAACAGGGTCAATGCAAGCCGCTCGTGAAGTGTG TGAGATTTGTCCACGAAATCCCTCTTTTGCAAAACCAACCATGTCAGCTC TTGACTGGTGAAGTTGGCGTATGTTGTCCCCACATCGTCATTGGGACCGC CACATGTGAGTAGTAGTGTATACGGTAAAAAGTGCACTGGAGCCCGGCTA AGGTACCGCACTCCCAACAATTGAGCAGATTGTCTGACAAGTCCGACAGA ACAATCTCCCTGGGTCCAACATTCATTTGGCTGATTGGGGTCCCCGTTTT TGATGGGCGCCATGACTTCTGACGGAGGTCGTAAAACGTCCCAGATCCAT CCGAAAGCCTAATCCAGTGCACTTGGACTCCTACTCGAATGAATAATAAC ATCCTTCTCTTCTTTTTATTGTTTATTCTCAGACATTCACCATTCATTGA AAAGGCACAGATACGTGATTAGCTCCCTGTACAGAACATTCCCTTACCTT TTAGTTCGGAAACCCCGGCGGAACACTGTACTTCGCCGACCCCCAAGACC CCCTGTTCCTTTGCCCCCCATTCGAACCAATGACATTCAACAGGCCAACT TTGGAGCCGAACAAAGGCTTCAAGTCCGACGTCAAATCGAGGCTGGGCTC CGACAAGCCGGCCTCGTTATCTCCAGAGGGAGTCTCACTCCCGTGGCCAA GCACAAGCGCTTGCAAAAGACCACGGCCAAGGCCAGATCGCTCGGGCGGA AGGCCGCCAAGTTGGTCGAGGCATCGAACCAGCTTCAACAGAGGTAAACA GACTTTGGTGGTGAATTACAAATGGGATTGGTAGATTTGAGAAATGACTG TGTGCCAAAATCAGGAGCGCTTAATACTAGGAAGGCCTCAAAATCCCTCT CGCAGACTTTGGTCATTTCGGTAAAAATTTAGAAAGTCAAAGCTTCAACC TAAAATCGAAATAAGCAATCGGAAGATGTACTGACAAAGAAAATTGAATG TCGTACATTTAAGACATATTGCCTTTATGTGACAACTTTTATTTTCATAG CAAAAGCAACATCTATTAACAGGTATGAAAATTAAAAAGAACACTTGTGA AACAAGTTTCAGCGCAGTTCTTGTATCACCGAATCTAAGAGCGACCCTCC ACAGATTCAACTCTGCCCCTCGCAATAGAATGGATCCACCATCTGATTTC ATTCAAAGTTGCTATTGATCGGACTGAAGGTCCAACATACCGAAGCCATC TCAGATCGGGACTTGGCTTTCCGCTCAATGGAATTTATTGAATTGCGCCG GATGAGAATTATAATTCTCCATGTAGGCACAAAACGTATCGAGGGTTGCC AAAAGTGCTTCTCGGGATGAAACTTTGAGTTTGTTAATCCTTTCAGGATT CAAGCATATGTCTCTCGATCGAGATATCGCACACGGAATGGAATGCACAA TCGCGTGCTTTGGCTATTGACTGGGTGTGTCATATGATGCCAACCAACGA AATGGGTAATGGGACGGGGATATTGTCTCCTGCCATTAGGGATAAACAAG TTTACGACCGTCTTTTGCTGAAGCAACAATGTGACACGAAAAGTGTGTTC CAAAAGACTTCTCCACCTTGGCCCAAATTGAGCATGTGGATCAGCTGCGG GAAAAGTTAGGGCTTCAAAGAACGATGTTTTGTATCCTCCAATTGTGTTC ATTGCTCTAATTCGCAATTGTCGTGTCTCCAAGCAACCTTGTTCTTTAAA CACCAAACTTTTACCTCCTTACAGCTTCAATCTTTCTCCCGCCCAAGGGA CTCACGCACTTCCCGTCTTCTCGCTCGTTGGCACGTCCTTAGCTGTGAGC GATGAGGACCACGCAGAGATGTGCAATGCCATAGATGGGAGTACGGGTTT TGTCCTCGAGGCTGGGCAATGCCGCTCGGCGAATTTGGAATTCAGATCCG TGGATGGATCTTGCAATAACAGACAGCATTCCATTTGGGGACAAGCCAAC ATTGCTTTACAGCGCTTGCTCCATCCGCAATACGAAGATGGTAAACGCGT CAGGCACTCGGGACGACTAAACCTAAGTGTAATCTCCTCCTCTTGGCAGG AATCTCCAGGCCCAGAGGACAAATGAGCAATGATCCAACGGTGAGCTCGC TGCCCTCCCCGAGAGACGTAAGCGAGGCTTTGGTGGCCGATCATGACAAA CCCAGCCAGGAGTTCACTCTGCTCCTCATGCAGTGGGGACAATTTGTGGA CCATGACATGACTCATACGCCGTTGGTGGAAGGTACTATGAGTTCTGGGC CATCACCCCCAATGCATCTTCGGCGGACGGAAATTTATGTCGTATTGGTT TGAAGAAACACACCTCTAGGAGGTTTTTCCTTCTAGGCGAGGATGACTCA GCCATTCTCTGCTGCTCTAATGGGAACGTGGTGAGAGGTGACTTGGCCCA TCCTGAATGTATGCCCATTAGCATTTCTTCAACGGACTCCTTTTATGGGA GGTTGGGACAACAGTGCATGGAATTTGTGAGGTCCATGCCAGCCAGGAAC GCCGAGTGCCATCTGGGACCGCGGGAACAGGTTGGGAACAAAAACAAAAG TGACCCTCTCCGCTTTGGCGTAGGCCACACGACATGCACATTTCCCACGG GCTTTTAGGTGAACCAGATTACTGCCTTCCTGGACGCCAGCAACGTGTAT GGATCGGAAACCTCGGAGGCCCGTTTGCTCAGATTGGGTCGTCGAGGACG ACTCCGAGTCACGCAATATGGAGGCTCAGAGCTGCTCCCTCTGGACCCGG ATGAATGTGCCGATCATTCCAAGAGACAGTACTGTTTCGCCGCAGGTGGG TGGATGGCTGAAGCGTGGGCAATGAAACTGCTTCGTGTACGATAATGCAA CCAGGCCAGCTCCGAGTGCCAAATTTTGAGAGCTGGAATAAGGGACCTGC TAGTCGTTCCAGTTGGGAAAATTTGAATTTCTCATCGCCAACTCGTTTAA GAAGACCTACGTTCGTAGATTGTCAAGCGTGTCGTGGGAGGCTGTCTCGC ATTCTTCATTCCACGCTGGGTAGGACTGATTAAGAGGGCTGGGAAGAATG ACTCAGACAAGAGTTGTGTGGGTGACAAAATATGTCACTTTTTTGCGTCG CAAATCGAAACGTTTCAGAAACGGGTTGGAATGATTGCCCGGGTTCGAGC GAAAAAGTGCATCCCCAATCACTTAGGCCATGCACTCGGATGCTTACATG GTGGTGTTTTTTTTCCAGGCGATGCCAGATGCAATGAGCAGCCTCAGCTG ACTGTCATGCACACGCTTTGGTTGCGGGAACACAATCGAATTGTTTCTCA ACTCTCCTTGCTCAATTCCCAGTGGGACGACGAGAGGCTCTACCAGGAGG CGAGGAAGATCGTGGGCGCCCAATTGCAGCACATCACCTTCAATGAATGG CTACCTCTTATTCTCGGTGTGATCGTTGACTTTCAGTGGGTTGAATTGGG AACTAAATGAATCTGTCTGGCTTCTAGGAACTCGTTATATGGACGACAAT AACCTGAGCCCCTCAAAATCTGGTTTCACCCAGGACTACGACCCCTCCAT TGAGCCCTCCATCACCAATGCTTTTGCCACGGCGGCCTTCCGATTCGGAC ACAGCCTGGTGCAAGGCCAAATTGAGTGGGTGCATCCTCTTTGAGCGAAT TGGTTCCGGTTTTTTTTCTCTCGACAACGTTTTAATTCCAACTGGTTCCA GGTGGTTTGGATTGTTTGGAAACCGTCTGAAGGCCCTCCAATTACATCGC CATCAATTGGAGCCCTTCGAGATCTATGAGCAAAACTCCATCGACAGCTT CCTTCGTGGTCTTACCACTCAACCCTCACAGGAGCTGGATGGGAGCTTCT CCGCCGAGGTGCGCTTCACGTTCCTGCCTAGGCGGAAGAGGAGTTCCTTA GTGGTCCCAGCTGCTCTCAGTGTGTTTTTTATGAACTTCTAGCTCACCGA CCATCTATTTCAAGAGAGGAACACGAGCCATGGCATGGACCTGGTGGCTC TCAACCTTCAGCGAGGACGCGATCATGGCATCCCCGGGTACATGGAGTAC CGGAAACTTTGTGGCCTACCTCGACTCACCACATGGAGGGAGATTGTTAA CGTCGTCGCCTCGCCCGAGGTGAGTAGGGTCATCGGGATCCACCTCGGCT ATGGACACAATTGAACTTGAATTACTAACATGCAATCCTCCTGTTTGGAC GACACCGGATGTGCGACTCTGTCCACTCTTTGGGGAGTCTTTTAACACTC TCGACTGCCATTAGTTGAAAAGACGATGTCAGCTTCAGAGAATGTCCCAA CTCCCCGAGGGGAATAAGACAAGTTGAAGGATCCAACTCCTTCCCCTTGC AAGACGGAAAAAGAGGACCAATAAATATTTGGACTGTTTTTGCAGATCGT ACCTCGTCTCCAACGGCTGTATTCTTCTATCGAGGAGATTGATCTGTTCC TAGGAGGAATGCTGGAGCGAGGGACGAGTGGGTCACTGGTGGGACCCACA TTCCAATGCATCATCGGGGATCAGTTTAAGCGGCTCAAATTTGGAGACAG GTTCTGGTTTGAGGAGGGCAACCAACCGAACTCTTTCAGCTTAGGTGGGC ATGATCCATCCCAAAAATAGTTATGACGAGGTTTTCAACATTTCGTGTAT TCTCTCTGCAGATCAATTGAATGCCTTGAGAGAGAGCAGTTTGGCTCGGA TCATTTGCGACAATGGAGATAATATGCAACAAGTGCAGCCTCTGGTATTC AAAAAGGCCAGTGGGATGTGAGTACATGGACGTAATGTATAGACAAATGT CAACCCCAATCCTCATTGAACATGTATACATTTTAGGAACCAAAAGGCCA GCTGCAGCGGGAAAGGCATTCCCAGGGTCAATCTGGAAGCCTGGAGGAAT GCCAACTAAAAGCAGGCCACCTGGAGACCGTGAATACTCTATTGATGAGA CTATGTATATCCTAAATAAAGCGCTATTTCGGTC
back to top
Synonyms
The feature 'chorion peroxidase-like' has the following synonyms
Synonym
Tk02572
Add to Basket