cytochrome c oxidase, maker-scaffold3945_size7060-snap-gene-0.0 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of cytochrome c oxidase vs. SwissProt
Match: gi|1352177|sp|P98000.1|COXN_BRADU (RecName: Full=Alternative cytochrome c oxidase subunit 1; AltName: Full=Alternative cytochrome c oxidase polypeptide I; AltName: Full=Cytochrome BB3 subunit 1; AltName: Full=Oxidase BB(3) subunit 1) HSP 1 Score: 58.9214 bits (141), Expect = 2.811e-9 Identity = 28/53 (52.83%), Postives = 38/53 (71.70%), Query Frame = 0 Query: 26 MDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 +DA+ YL +T+HG IMV ++LTA G F N LIPL +GARDM ++NM+S Sbjct: 76 IDANQYLQFITMHGMIMVIYLLTALFLGGFGNYLIPLMVGARDMVFPYVNMLS 128
BLAST of cytochrome c oxidase vs. nr
Match: gi|657642639|ref|WP_029447143.1| (cytochrome-c oxidase [Cellulophaga baltica] >gi|730598660|gb|AIZ41455.1| cytochrome C oxidase [Cellulophaga baltica 18]) HSP 1 Score: 157.918 bits (398), Expect = 9.070e-42 Identity = 74/78 (94.87%), Postives = 78/78 (100.00%), Query Frame = 0 Query: 1 MQLAWPGEAFPIFEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 MQLAWPGEAFP+FEA+LGKWAPGGVMDAD+YLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNM+S Sbjct: 62 MQLAWPGEAFPVFEALLGKWAPGGVMDADIYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMVS 139
BLAST of cytochrome c oxidase vs. nr
Match: gi|1188374011|ref|WP_085495279.1| (cytochrome c oxidase subunit I [Arenibacter troitsensis] >gi|1183562883|emb|SMG06780.1| cytochrome c oxidase subunit 1 [Arenibacter troitsensis]) HSP 1 Score: 157.532 bits (397), Expect = 1.101e-41 Identity = 76/78 (97.44%), Postives = 78/78 (100.00%), Query Frame = 0 Query: 1 MQLAWPGEAFPIFEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 MQLAWPGEAFPIFEA+LGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNM+S Sbjct: 61 MQLAWPGEAFPIFEAILGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMVS 138
BLAST of cytochrome c oxidase vs. nr
Match: gi|1119986703|ref|WP_072862834.1| (cytochrome c oxidase subunit I [Arenibacter palladensis] >gi|1110400413|emb|SHF53839.1| cytochrome c oxidase subunit 1 [Arenibacter palladensis]) HSP 1 Score: 157.532 bits (397), Expect = 1.101e-41 Identity = 76/78 (97.44%), Postives = 78/78 (100.00%), Query Frame = 0 Query: 1 MQLAWPGEAFPIFEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 MQLAWPGEAFPIFEA+LGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNM+S Sbjct: 61 MQLAWPGEAFPIFEAILGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMVS 138
BLAST of cytochrome c oxidase vs. nr
Match: gi|738195954|ref|WP_036151889.1| (cytochrome-c oxidase [Maribacter forsetii]) HSP 1 Score: 156.762 bits (395), Expect = 2.014e-41 Identity = 74/78 (94.87%), Postives = 78/78 (100.00%), Query Frame = 0 Query: 1 MQLAWPGEAFPIFEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 MQLAWPGE+FPIFEA+LGKWAPGGVMDADVYLALVT+HGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNM+S Sbjct: 63 MQLAWPGESFPIFEALLGKWAPGGVMDADVYLALVTMHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMVS 140
BLAST of cytochrome c oxidase vs. nr
Match: gi|1124236903|ref|WP_074537132.1| (cytochrome c oxidase subunit I [Cellulophaga baltica] >gi|1086762435|emb|SDE44364.1| cytochrome c oxidase subunit 1 [Cellulophaga baltica]) HSP 1 Score: 156.762 bits (395), Expect = 2.276e-41 Identity = 73/78 (93.59%), Postives = 78/78 (100.00%), Query Frame = 0 Query: 1 MQLAWPGEAFPIFEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 MQLAWPGE+FP+FEA+LGKWAPGGVMDAD+YLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNM+S Sbjct: 62 MQLAWPGESFPVFEALLGKWAPGGVMDADIYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMVS 139
BLAST of cytochrome c oxidase vs. nr
Match: gi|646944944|ref|WP_025615940.1| (MULTISPECIES: cytochrome-c oxidase [Cellulophaga] >gi|694994128|gb|KGK31909.1| cytochrome C oxidase [Cellulophaga sp. E6(2014)] >gi|723619715|gb|AIY13087.1| cytochrome C oxidase [Cellulophaga baltica NN016038]) HSP 1 Score: 156.762 bits (395), Expect = 2.300e-41 Identity = 73/78 (93.59%), Postives = 78/78 (100.00%), Query Frame = 0 Query: 1 MQLAWPGEAFPIFEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 MQLAWPGE+FP+FEA+LGKWAPGGVMDAD+YLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNM+S Sbjct: 62 MQLAWPGESFPVFEALLGKWAPGGVMDADIYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMVS 139
BLAST of cytochrome c oxidase vs. nr
Match: gi|1119875683|ref|WP_072764375.1| (cytochrome c oxidase subunit I [Arenibacter nanhaiticus] >gi|1110164717|emb|SHJ11218.1| cytochrome c oxidase subunit 1 [Arenibacter nanhaiticus]) HSP 1 Score: 156.377 bits (394), Expect = 2.420e-41 Identity = 75/78 (96.15%), Postives = 78/78 (100.00%), Query Frame = 0 Query: 1 MQLAWPGEAFPIFEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 MQLAWPGEAFP+FEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGF+NM+S Sbjct: 61 MQLAWPGEAFPLFEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFMNMVS 138
BLAST of cytochrome c oxidase vs. nr
Match: gi|670494433|ref|WP_031442394.1| (cytochrome-c oxidase [Arenibacter algicola] >gi|1220432899|gb|ASO05729.1| alternative cytochrome c oxidase subunit 1 [Arenibacter algicola] >gi|1331526414|dbj|GBF20847.1| alternative cytochrome c oxidase subunit 1 [Arenibacter sp. C-21]) HSP 1 Score: 156.377 bits (394), Expect = 2.521e-41 Identity = 75/78 (96.15%), Postives = 78/78 (100.00%), Query Frame = 0 Query: 1 MQLAWPGEAFPIFEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 MQLAWPGE+FPIFEA+LGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNM+S Sbjct: 61 MQLAWPGESFPIFEAILGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMVS 138
BLAST of cytochrome c oxidase vs. nr
Match: gi|1134307257|ref|WP_076547287.1| (cytochrome c oxidase subunit I [Maribacter ulvicola] >gi|1131912963|emb|SIQ23572.1| cytochrome c oxidase subunit 1 [Maribacter ulvicola]) HSP 1 Score: 156.377 bits (394), Expect = 2.600e-41 Identity = 75/78 (96.15%), Postives = 78/78 (100.00%), Query Frame = 0 Query: 1 MQLAWPGEAFPIFEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 MQLAWPGEAFPIFEA+LGKWAPGGVMDADVYLALVT+HGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNM+S Sbjct: 63 MQLAWPGEAFPIFEALLGKWAPGGVMDADVYLALVTMHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMVS 140
BLAST of cytochrome c oxidase vs. nr
Match: gi|639136383|ref|WP_024481863.1| (cytochrome-c oxidase [Cellulophaga baltica]) HSP 1 Score: 156.377 bits (394), Expect = 2.736e-41 Identity = 73/78 (93.59%), Postives = 78/78 (100.00%), Query Frame = 0 Query: 1 MQLAWPGEAFPIFEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 MQLAWPGE+FP+FEA+LGKWAPGGVMDAD+YLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNM+S Sbjct: 62 MQLAWPGESFPVFEALLGKWAPGGVMDADIYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMVS 139 The following BLAST results are available for this feature:
BLAST of cytochrome c oxidase vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 0
BLAST of cytochrome c oxidase vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 1
BLAST of cytochrome c oxidase vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold3945_size7060:214..1131- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold3945_size7060-snap-gene-0.0 ID=maker-scaffold3945_size7060-snap-gene-0.0|Name=cytochrome c oxidase|organism=Tigriopus kingsejongensis|type=gene|length=918bp|location=Sequence derived from alignment at scaffold3945_size7060:214..1131- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'cytochrome c oxidase' has the following synonyms
Add to Basket
|