cytochrome p450 partial, snap_masked-scaffold133_size323035-processed-gene-1.7 (gene) Tigriopus kingsejongensis

Overview
Namecytochrome p450 partial
Unique Namesnap_masked-scaffold133_size323035-processed-gene-1.7
Typegene
OrganismTigriopus kingsejongensis (Tigriopus kingsejongensis)
Associated RNAi Experiments

Nothing found

Homology
BLAST of cytochrome p450 partial vs. L. salmonis genes
Match: EMLSAG00000005163 (supercontig:LSalAtl2s:LSalAtl2s272:555567:557147:-1 gene:EMLSAG00000005163 transcript:EMLSAT00000005163 description:"augustus_masked-LSalAtl2s272-processed-gene-5.4")

HSP 1 Score: 363.999 bits (933), Expect = 1.266e-118
Identity = 207/517 (40.04%), Postives = 306/517 (59.19%), Query Frame = 0
Query:   38 IALVVVV-LILA---WYVKNRLPANYPPTPPTRLPLFGHSHYLLFTRNSGIEAIDELFHKYSKDGVMAFHLGS-FKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSN--QSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAILAAGIKPSIAFIFPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTD----VDSSFSKTNGDEMILQTLIDLFFAGQPAQ----PFHVLYLIINPEVQTKIHEEIKTVIGLE-----RTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYW-PKPEEFKPERHI---NDEG-KVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNPPPNEGICGITRIPKPFSFNL 529
            +ALV+ V LILA   + +K + P NYPPTPP RLPLFGHS YL     +  E  D +F +++  GV+   + +  ++ +I  FD+LK+  K +D N+R A+  ++     L +   G +G +   G IW +QRRFMLST K+FGFG+S ME M+ +E   F++++ + N    G I+  N+FN  +LN+LW+++AG RF+Y D +L+ I   V +AIL+  +KP+IA IFP+LR I+P ID   +    +  V +FL + V+ H   FDP H RDFID YLL+++ + +     + SF    G   + +TL+DLFFAG         + VL+++ +PE+Q K+ EE+   +        R     DR  LPY +A I EIQR G+  P G+ HA      ++G Y VP+GH      S I ++P+Y+ P P++F P+R +   +D G K + ++ +IPFSIGKR CPGE LA+  IF     +LQRFE+  ID    P  + I GIT IPKPF+  L
Sbjct:    3 VALVITVCLILAXILYEIKWKYPENYPPTPPFRLPLFGHSLYLRSAGKNFQEGFDRIFDRFNVGGVLCLQVAARIRMXMISDFDILKKILKTDDLNYRLAHDFSIDYTKKLYQGI-GVDGXLWSYGXIWKQQRRFMLSTLKNFGFGRSSMEDMLMEEATLFVNFLNEENIQTGGNIRIANLFNIGILNVLWRIVAGTRFEYRDPELQKIVHKVGDAILSTNLKPTIAAIFPFLRTIYPGIDDXQEVTSKVAAVYEFLQTAVKNHEANFDPNHPRDFIDTYLLKIKDSEENPDKENDSFRGELGKLNLSKTLLDLFFAGSETTSSTLSWGVLFMVRHPEIQKKVQEELDLFLHEGDGESFRKARSEDRIHLPYTEAXICEIQRRGNITPMGVPHATYSGDAKVGDYVVPKGHVVNAYLSGIFRNPKYFGPNPDQFNPDRFLEVASDGGVKFIKNEYLIPFSIGKRSCPGENLARMEIFSFFTSILQRFELRSID-GEIPSTDFISGITSIPKPFNIKL 517          
BLAST of cytochrome p450 partial vs. L. salmonis genes
Match: EMLSAG00000002359 (supercontig:LSalAtl2s:LSalAtl2s144:369128:376155:1 gene:EMLSAG00000002359 transcript:EMLSAT00000002359 description:"snap_masked-LSalAtl2s144-processed-gene-3.3")

HSP 1 Score: 237.269 bits (604), Expect = 8.738e-71
Identity = 163/487 (33.47%), Postives = 255/487 (52.36%), Query Frame = 0
Query:   54 RLPANYPPTPPTRLPLFGHSHYLLFTRNSGIEAIDELFHKYSKDGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYI--EKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAILAAGIKPSIAFIFPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNN--PPPNEGICGITRIPKPFSFNLKRR 532
            R  + +PP PP  LP+ G   Y+    ++ +   D  F KY    + +  +G+  LV+I ++ L K+ F  ED ++R+     L +     R      GII   G +W EQRRF +   KDFGFGK+ ++ +I++E  F ++ I  E  N +G ++  + FN  ++NILWQ+IAG RFD D++  K +   + E + + G   SI    P  R  F   D   K +  M   K+F  S ++EH K +D  + RDFID Y+ EM    D D    +   +E ++ T +D F AG         + VLY+ + PE Q K  EEI+ V+G E  P      D+ Y +A+++EIQR+    P  L H      F  G Y +P+G    G+      +P+++P P+ F+PER I + GK+   +   PF +GKR C GE++AK+ +F+   ++LQ+ +I  +  N+  P P     GIT+IPKPF  ++  R
Sbjct:   21 RRKSKFPPGPPN-LPIVGTLPYMNGIGSNAL--TDPKFGKYGD--LYSLFIGNIHLVVINNYQLAKDLFAREDVSYRRETWWTLNV-----RGDGHPLGIINTSGHVWKEQRRFAVRNLKDFGFGKNTLDAVIQNEARFTIEDIIKESKNNNGVLRMESTFNVGIINILWQIIAGYRFDKDNEKTKEMMGHLHE-VYSEGY--SILHYIPAAR-FFIKRD---KRMDDMLRTKEFFRSQIREHMKDYDASNPRDFIDVYIKEM---LDED---RENFHEEQLMTTCLDFFQAGGETSATTLLWSVLYISLYPEAQAKCVEEIEAVLGKE-DPSQEVYKDMVYCNATLMEIQRMASVGPLTLPHVTIKDLFIDG-YCIPRGTEIYGNIIAFHNNPKFFPSPKSFRPERFI-ENGKLKKLEAFAPFGVGKRICMGESMAKNQLFIFFVMMLQKLKI-SVSENHGVPDPEAYTMGITKIPKPFYISVSSR 480          
BLAST of cytochrome p450 partial vs. L. salmonis genes
Match: EMLSAG00000007328 (supercontig:LSalAtl2s:LSalAtl2s412:195302:204629:-1 gene:EMLSAG00000007328 transcript:EMLSAT00000007328 description:"maker-LSalAtl2s412-snap-gene-2.12")

HSP 1 Score: 208.379 bits (529), Expect = 1.950e-60
Identity = 148/491 (30.14%), Postives = 234/491 (47.66%), Query Frame = 0
Query:   45 LILAWYVKNRLPANYPPTPPTRLPLFGHSHYLLFTRNSGIEAIDELFHKYSKDG-VMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYI--EKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAILAAGIKPSIAFIFPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQPFHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEG-KVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEI-FPIDPNNPPPNEGICGITRIPKPFSFNLK 530
            + L ++ + R  A +PP P   LPL G   ++     +GI     L   Y K G +    +G   L++I SF L KE +  E+ + R+    +    I +R     + GII   G  W  QRRF L   ++FGFGK  ++ +I++E    +D I  E S   G +   + FN +++N+LWQ++AG+RFD ++   K   E + E +   G   S+    P  R      +   K    M ++K+F   +++EH K  D  + RDFID YL E+ K                          +G+    FH+  LI     Q K  EEIK  +  +  P     ++LPY  A+++E+QRL    P  L          +  Y +P+G     +F    +DP+++P+P EFKPER + ++G +V  D+  +PF +G+R C GE+LA+  + +   ++LQ   I  PI    P P     GITRIP PF   ++
Sbjct:    1 MALGYFKRKRWVARFPPGP-RNLPLVGSIPFM-----NGIGTQGCLNPDYRKFGDLYTLFIGPIPLIVINSFQLTKELYVKEEISSRR----DTWWTINVRGDGKQSLGIINTGGMKWQTQRRFALRQLREFGFGKRSLDSVIQEEAQASIDTILQESSKNDGKVLMASNFNVSIINVLWQIVAGQRFDPEESSTKERMEHLNE-VFRVGY--SVLHYLPIARYFIKKDERRDK----MLSLKEFFREMIREHIKDQDDDNPRDFIDVYLKEVHK--------------------------SGEKPSYFHIEQLI-----QKKCKEEIKDKLQGDEKPTQDCISELPYTHATLMEVQRLASVGPMSLPRYTT-KDIDVNGYSIPEGTEIYSNFMAFHRDPDFFPEPLEFKPERFLTEDGSRVKKDEHFLPFGLGRRICMGESLARHQLIIFFIMILQNLNISVPIGQEKPDPESCFMGITRIPTPFHVQIR 442          
BLAST of cytochrome p450 partial vs. L. salmonis genes
Match: EMLSAG00000007758 (supercontig:LSalAtl2s:LSalAtl2s453:376415:377986:-1 gene:EMLSAG00000007758 transcript:EMLSAT00000007758 description:"maker-LSalAtl2s453-augustus-gene-3.8")

HSP 1 Score: 195.667 bits (496), Expect = 2.152e-55
Identity = 149/485 (30.72%), Postives = 237/485 (48.87%), Query Frame = 0
Query:   61 PTPPTRLPLFGHSHYLLFTRNSGIE--AIDELFHK-YSKDGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGV----GRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYI-EKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAILAAGIKPSIAFIFPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQPFHVLYLI----INPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEI-FPIDPNNPPPNEGICGITRIPKPFSFNLKRR 532
            P  P  LPL G   +L    + GI   A+ E F   Y+ D + +      K+V++  F + K+ F  ED + R   +          R   G +GI  G+    G +W  QRRF L+  K+ GFGK  +E +I +EV    + I E  +    +   ++F+  ++N+LW +IA  RF+Y     + I E +    L  GI  +I FI      IF N  PL ++ + M  +K F+     EH+   +    +DFID YL+EM K+   D  FSK    + ++  L D F AG       +L++I    ++ ++Q K ++EI   IG    P   D   LP+  A+I E+QR  +  P  L+H       ++GKY +P+G +   ++ +   DP+ +P P EF P R      KV   ++ +P+  GKR C G++LAK  +F    +++Q + I  P D   P P +   GIT +P PF  N+++R
Sbjct:   30 PPGPFSLPLVGSLPFLSSQGSPGILDFALGEKFGSIYTVDVIWS------KIVVLNDFGMAKDLFNREDVSGRYQGQ--------WHRFTKGYDGIAYGIINNEGPMWQSQRRFALTNLKNLGFGKKSLESVIYNEVHHLFEVIDEMIDGCSDVLIHDIFHVPIINVLWSIIASHRFEYSQA--REIVEKLGLD-LKKGIHINI-FI-----SIFANYVPLNESDEAMLYMKRFISKNXDEHKNNLEVNAPKDFIDFYLIEMLKSQ--DPYFSK----KQLIVMLFDFFLAGSETTSTTLLWIILLMCLHNDIQLKCYQEISQNIG-NNFPREEDMKMLPFTLATISEVQRYANIAPASLVH-KVLQTIRVGKYLIPKGTSVIANYHKFHMDPKVFPHPHEFNPYRFY----KVPKPEQFVPYGFGKRICMGKSLAKKQLFYFFVMIVQNYIIRVPKDNPRPDPKKCTMGITSVPDPFYVNIQKR 479          
BLAST of cytochrome p450 partial vs. L. salmonis genes
Match: EMLSAG00000004688 (supercontig:LSalAtl2s:LSalAtl2s245:535864:537578:-1 gene:EMLSAG00000004688 transcript:EMLSAT00000004688 description:"maker-LSalAtl2s245-augustus-gene-5.13")

HSP 1 Score: 187.963 bits (476), Expect = 2.876e-52
Identity = 144/534 (26.97%), Postives = 253/534 (47.38%), Query Frame = 0
Query:   24 ITLFFGILHGMLEIIALVVVVLILAWYVKNRLPANYPPTPPTRL--PLFG-------HSHYLLFTRNSGIEAIDELFHKYSKDGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLST---FKDFGFGKSDMERM---IKDEVVFFLDYIEKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAILAAGIKPSIAFIFPWLRDIFPNI-DPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQPFHVLYLII----NPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNP----PPNEGICGITRIPKPFSFNLKRRS 533
            + L   IL G ++ + +++  L L + +K+ L  ++   PP  +  P+ G         H LLF          +   K+ K  +++  +G   +V++  +  +K+ F  +  + R   +    L+ LL     G  GI+   G +W  QR+++L+     K +  G   +E++   +  EV  FL  +E    +  +    +FN AV N++  +I   RF Y D   +    L  E      +  ++ F+ P+L+ + P I D   K  Q  + +  F+  ++ EHR+  DP + +D ID+YL++    +  D  F   + ++ + Q ++DLF A        +L+ I+    NP++ +K+ +E+ +V+G +  P L+D   LPY  A++ EI R    VP G  HA      Q   + +PQ          +  +P+ W  PEEF+PER IN EG +   +  +PF +G+RKC G+ LA+   FL    L+  F++     NNP    P   G  G+T  P  FS ++K R+
Sbjct:    1 MALLTKILSGEIQHLIVLIAFLTLLYILKH-LKKSFKDLPPGPIGYPIVGIIPLIKKEFHLLLF----------DYAMKFGK--IVSLKMGGETVVVLSDYQTIKKAFSCKYFSARPKTE----LSQLL-----GGYGIVNSEGPLWKTQRKYLLNQKLGMKHWKSGAGSLEQIESVVSREVQSFLYTLENDYSNTFVNLTPLFNCAVSNVICSIIXSRRFRYQDPKFQRFMFLFDEGFRLFTMTGAMTFL-PFLK-VLPGISDTCTKLRQNREEMIAFVREIISEHRQELDPQNPKDLIDSYLVQ---ESTPDQFFEDYDPEQQLEQIILDLFSASVETTRTSLLWAIVFMLHNPKILSKVRDELNSVVGEDNLPQLSDMIKLPYTRATLYEIMRRSSVVPMGTTHATD-REVQFEGFVLPQNSHVIPLIHAVHMNPKNWENPEEFRPERFINKEGVLFKPEHFMPFGVGQRKCLGDRLAEQEFFLFFTSLVHVFDL----GNNPEQTMPSLRGTAGVTVTPSEFSVHIKLRN 502          
BLAST of cytochrome p450 partial vs. L. salmonis genes
Match: EMLSAG00000006822 (supercontig:LSalAtl2s:LSalAtl2s383:99037:100275:-1 gene:EMLSAG00000006822 transcript:EMLSAT00000006822 description:"maker-LSalAtl2s383-augustus-gene-2.10")

HSP 1 Score: 179.489 bits (454), Expect = 1.889e-50
Identity = 122/387 (31.52%), Postives = 194/387 (50.13%), Query Frame = 0
Query:  152 GIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSNQS-GPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAILAAGIKPSIAFIFPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEI-FPIDPNNPPPNEGICGITRIPKPFSFNLKRR 532
            GI    G +W  QRRF L   K+ GFGK  +E +I ++++   + IE    S   +   ++F   V+N+LW+++A + +D+ +   + +   V E   AA       F     R   P        +++ Q +++ +D    EH +  D     DF+D YL+EM+K  +VDS+FSK    + +    IDLF AG         + +LY+ +   VQ K  EEI +V+G  R P   D  +LPY  A++ EIQRL +T P  L H N     ++G Y VP+G  F  +      DP  +  P++F P+R ++ +      Q+ +PF  GKR C G +LAK  ++    +L++ F I  P+    P PNE    +T+ P PF  N+ +R
Sbjct:   16 GIASSEGILWQNQRRFSLMKLKNLGFGKKSIEIIIYEQIINLFEMIETQKDSFNDLFIKDIFTIPVVNVLWKIVASKSYDWRNSGERKVXAAVNEVFGAAY---ETNFFLEKFRHFLPYDIADKSTLKLRQIMEELID----EHTQNLDENSPNDFMDVYLIEMKK--NVDSTFSK----KQLASLCIDLFLAGAETTNTTLVWALLYMSLYEGVQEKCAEEINSVLG-SRMPQEEDMKNLPYTIATLNEIQRLCNTAPASLPHKN-LKDIKIGDYVVPKGTLFLANLIGFHHDPNIFENPQQFNPDRWLHYKS---CPQQFVPFGFGKRICMGVSLAKKELYYFFVMLIKMFIIRVPLYHKRPDPNETNVSLTKSPSPFYVNITKR 384          
BLAST of cytochrome p450 partial vs. L. salmonis genes
Match: EMLSAG00000005721 (supercontig:LSalAtl2s:LSalAtl2s309:682709:688189:1 gene:EMLSAG00000005721 transcript:EMLSAT00000005721 description:"maker-LSalAtl2s309-augustus-gene-6.40")

HSP 1 Score: 144.05 bits (362), Expect = 6.937e-37
Identity = 132/501 (26.35%), Postives = 217/501 (43.31%), Query Frame = 0
Query:   57 ANYPPTPPTRLPLFGHSHYLL-------FTRNSGIEAIDELFHKYSKDGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIE-KSNQSGPI-KTINM-FNTAVLNILWQMIAGERFDYDDKDLKNIFE----LVTEAILAAGIKPSIAFIFPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPF----VGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEI---FPIDPNNPPPNEGICGITRIPKPFSFNLKRR 532
            +N PP P T  P  G    L+           S I+  D+L   Y +D     H G    +I+ S + ++E     + +FR  NK    L  +    K+   G+  G G  W   RRF  S FK    G S + +    EV   +  +  K+    PI + +N+ F+  +LNI+W ++AG R+ Y D  ++  F+    L+ E  +A       A   P LR I+  I         M + +  L  +V+E RK       R FID +L    +  D D+ +     +E ++    D F AG           +LY+++ P +Q     EI+  I  +      DR  LPY DA ++E++R     P       PF       ++  +  P     Q + + +++    W  P+ F P R +N++G V I    +PF  G+R+C GE +   + FL+++ LL  F+    F  + N+ P N+   GI +  +PF   ++ R
Sbjct:   33 SNAPPGPST-YPFLGAIPSLVKDFWGSDRALKSPIDFFDKLHDIYGED--FRLHNGIEDTIILSSLNGIREFSNHPNASFRPFNK---VLMDIYSDGKDLGMGLGTG-GERWKFLRRFSSSAFKSLSGGASGLNQNFDLEVSEIVAXLRGKAKSPDPIIRNVNIYFDIPILNIIWWLVAGRRYKYGDPAIQKQFDYLKVLLEEPFIAPLTIIPFALYIPPLRKIYNRIR------NAMNSFRILLSKIVEERRKDNFTDEKRGFIDLFL--KAQLDDKDNPYL---SNEDLIMCCQDFFLAGAETSSKTLCTFILYMVLYPNIQENAASEIRDAIQKDTQIKSKDRHLLPYTDAVLMEVRRYATPFP-----ITPFRCSNKDIRVNGFDXPANVPVQVNLNGVLRSKYCWKAPDIFNPSRFLNEKGAVEIPNAFMPFGFGRRRCIGEDIGNISNFLIVSNLLHNFKFSASFSKNKNHLPSNDRFGGIIQGYEPFDVKIELR 510          
BLAST of cytochrome p450 partial vs. L. salmonis genes
Match: EMLSAG00000009405 (supercontig:LSalAtl2s:LSalAtl2s5:994028:996076:1 gene:EMLSAG00000009405 transcript:EMLSAT00000009405 description:"augustus_masked-LSalAtl2s5-processed-gene-10.0")

HSP 1 Score: 76.2554 bits (186), Expect = 9.405e-15
Identity = 120/495 (24.24%), Postives = 204/495 (41.21%), Query Frame = 0
Query:   34 MLEIIALVVVVLILAWYVKNR---------LPANYPPTPPTRLPLFGHS--HYLLFTRNSGIEAIDELFHKYSKDGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVF-FLDYIEKSNQSG-PIKTINMFNTAVLNILWQMIAGERF----DYDDKDLKNIFELVTEAILAAGIKPSIAFIFPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQE---HRKTFDPYHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQPFHVLYLI----INPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFV-GFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFP 503
            ML II+LVV+  ++ +Y+ NR          P   P       P F H+  H+  +T         E F ++ K      + GS   +      ++K+    +  NF     EN+         K+ N+ +    G +W   R+ +   F   G  K  ME ++  E+   FL +IE    SG  IK    F+   L+++     G +     D D + LK+  +L+ +A++   +  S+   F  L ++FP    + K + I  N  + L  +      +R+T +    +DFI+  L+EM K  +     ++   +E+I    +  F AG       +  LI     NPE+Q ++++EI        + +     +  Y  A I E  RL    P   MH        ++   ++  G   +         PE++P PEEFKPER   +    +I     PF  G R C     A   + +V+  L+++FEI P
Sbjct:    2 MLLIISLVVIFSLIYFYL-NRYHGYLENLPFPQEKPFLCFGSPPFFWHNYVHHFYYT---------EAFKRF-KSQTFTRYTGSIPTISTIDPKIIKQVTIKQFNNFHMTFTENV---------KDKNKSLDISHGPLWKLLRKELTPVFTS-GKLKGMMEPLL--EITNDFLFHIESQTTSGKSIKIKQKFHGLTLDVINSCAYGIKTNSSQDSDHELLKHAKKLLEDAVVTKNLPTSM---FILLLNLFPG---MIKYIDIFGNAYEELIKIANSIIANRET-ENIKKKDFINV-LVEMRKNNN--ECPNELLNNEIITAQAVIFFVAGYVTTSHSLCCLIYVLATNPEIQDQLYQEI-------LSSEDQGFDEHSYTSAVIKEALRL---YPPATMHTRVCTHDTEVEGIFIKNGTIIEMPIYASHYYPEFFPNPEEFKPERFFKENNSEIIPDTFRPFGDGNRICIAYRFAMMELQIVIEKLVKKFEIIP 453          
BLAST of cytochrome p450 partial vs. L. salmonis genes
Match: EMLSAG00000011475 (supercontig:LSalAtl2s:LSalAtl2s792:187038:188249:1 gene:EMLSAG00000011475 transcript:EMLSAT00000011475 description:"snap_masked-LSalAtl2s792-processed-gene-0.1")

HSP 1 Score: 60.077 bits (144), Expect = 1.819e-11
Identity = 33/98 (33.67%), Postives = 49/98 (50.00%), Query Frame = 0
Query:  392 ASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIF 489
            A++ EIQ LG TVP  L H N      +  Y  P+G  F  +  +   DP  +  P++F P R    E     D +++PF  GKR C G ++AK  ++
Sbjct:    2 ATLSEIQILGSTVPMSLAHKN-LEDIVIEGYKFPKGTIFVANLRKFHLDPTVFENPQDFNPLRFYKKEA----DAQLVPFGFGKRICMGISMAKKELY 94          
BLAST of cytochrome p450 partial vs. L. salmonis genes
Match: EMLSAG00000005269 (supercontig:LSalAtl2s:LSalAtl2s281:237457:238966:1 gene:EMLSAG00000005269 transcript:EMLSAT00000005269 description:"maker-LSalAtl2s281-snap-gene-2.7")

HSP 1 Score: 65.4698 bits (158), Expect = 2.123e-11
Identity = 81/330 (24.55%), Postives = 143/330 (43.33%), Query Frame = 0
Query:  193 FLDYIE-KSNQSGPIKTINMFNTAVLNILWQMIAGERFDY----DDKDLKNIFELVTEAILAAGIKPSIAFIFPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHI--RDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQPFHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVG-FQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNPPPNEG 514
            F+ YIE +S++   IK  + F    L+I+     G + +     D + L++   L+ ++ +A  +  S+  +   L + FP    ++K V I     D L  +     KT + ++I  +DF++  L++M K      S+S T+   M L  L  +              L  +PE+Q K+++EI +     +  D ++ +   Y  A I E  R+    P   +H    V   ++    +  G   +        +PE++P P EFKPER   +    +I     PF  G R C     A   + L+L  L+++FEI P       P++G
Sbjct:  145 FVAYIETQSSEGKSIKIKHKFQGLTLDIINACAYGIKTNSSEEPDHELLRHSKMLLNDSFIAKNVITSVLIL---LFNSFPG---MFKYVDIFGKANDELIKIANSIIKTRETHNIEKKDFLNV-LVQMRK-----KSYSTTS---MTLCCLTYI--------------LATHPEIQEKLYKEIVS----SQDKDFSEHS---YTSAVIKETLRM---YPPVTLHLRACVKDTEVEGILIKNGTIVEMPIYASHYNPEFFPTPNEFKPERFFQENNLEIIPNTYRPFGDGNRSCIAYRFAMMELQLILEKLVKKFEILPTHETKMVPSKG 435          
BLAST of cytochrome p450 partial vs. SwissProt
Match: gi|341940387|sp|O54750.2|CP2J6_MOUSE (RecName: Full=Cytochrome P450 2J6; AltName: Full=Arachidonic acid epoxygenase; AltName: Full=CYPIIJ6)

HSP 1 Score: 251.906 bits (642), Expect = 1.662e-74
Identity = 167/499 (33.47%), Postives = 258/499 (51.70%), Query Frame = 0
Query:   24 ITLFFGILHGMLEIIALVVVVLILAWYVKNRLPANYPPTPPTRLPLFGHSHYLLFTRNSGIEAIDELFHKYSKDGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAI-LAAGIKPSIAFIFPWLRDIFP-NIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNPPPNEGIC 516
            +   +  LH    ++A  V  L+LA Y KNR P NYPP P   LP  G+   L F +     +I  L  KY    + + +LG    V+I    L+KE     + N       N  L+++  R  N N G+I   G+IW EQRRF L T ++FG GK  +E  +++E    ++ I +  +  P       N AV NI+  +  GERFDY D   + +  L+ E + L   +   +  IFPW+    P +   +++N    + +K F+  ++ +HRK ++P   RDFIDA+L EM K  +  +SF++ N   +I  TL DLFFAG         + +LY+ + PEVQ K+  EI  VIG +R   LADR  +PY +A I E+QR+G+ +P  +      +   L  +++P+G     + + + +DP+ W  P+ F PE H  + G+    +  +PFS+GKR C GE LA+S +F+    L+Q+F        NPP NE + 
Sbjct:    9 LATIWAALHPRTLLVA-AVTFLLLADYFKNRRPKNYPPGP-WGLPFVGNIFQLDFGQPH--LSIQPLVKKYG--NIFSLNLGDITSVVITGLPLIKEALTQMEQNIM-----NRPLSVMQERISNKN-GLIFSSGQIWKEQRRFALMTLRNFGLGKKSLEERMQEEASHLVEAI-REEEGKPFNPHFSINNAVSNIICSVTFGERFDYHDSRFQEMLRLLDEVMYLETTMISQLYNIFPWIMKYIPGSHQKVFRN---WEKLKLFVSCMIDDHRKDWNPDEPRDFIDAFLKEMTKYPEKTTSFNEEN---LICSTL-DLFFAGTETTSTTLRWALLYMALYPEVQEKVQAEIDRVIGQKRAARLADRESMPYTNAVIHEVQRMGNIIPLNVPREVA-MDTNLNGFHLPKGTMVLTNLTALHRDPKEWATPDVFNPE-HFLENGQFKKRESFLPFSMGKRACLGEQLARSELFIFFTSLMQKFTF------NPPINEKLS 479          
BLAST of cytochrome p450 partial vs. SwissProt
Match: gi|1706096|sp|P52786.2|CP2J1_RABIT (RecName: Full=Cytochrome P450 2J1; AltName: Full=CYPIIJ1; AltName: Full=Cytochrome P-450IB)

HSP 1 Score: 245.358 bits (625), Expect = 3.726e-72
Identity = 166/492 (33.74%), Postives = 248/492 (50.41%), Query Frame = 0
Query:   41 VVVVLILAWYVKNRLPANYPPTPPTRLPLFGHSHYLLFTRNSGIEAIDELFHKYSKDGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAI-LAAGIKPSIAFIFPWLRDIFPNI-DPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQP---FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNPPPNEGIC-----GITRIP 522
             V  L  A+++K R P NYPP P  RLP  G+  + L    S ++ + +   KY    +    L    +VI+    L+KE     D NF      N  +  +  RS   N G+I   G++W EQRRF L T ++FG GK  +E  I++E     + +EK     P       N AV NI+  +  GERF+Y D   + + +L  E + L A +   +  IFPW+    P     L+ N    + ++ F+  +++ H+K ++P   RDFIDAYL EM K     S+ S  N + +I  TL DLF AG        + +L++ + PE+Q K+H EI +VIG  + P +A R  LPY +A I E+QR+G+ +P  +      V   L  Y++P+G     + + + +DPE W  P+ F PE H  + G+    +  IPFSIGKR C GE LAKS +F+    L+Q+F         PP +E +      GIT  P
Sbjct:   25 AVAFLFFAYFLKTRRPKNYPPGP-WRLPFLGNL-FTLDMEKSHLQ-LQQFVKKYG--NLFCLDLAGKSIVIVTGLPLIKEVLVHMDQNFI-----NRPVPPIRERSFKKN-GLIMSSGQLWKEQRRFALMTLRNFGLGKKSLEERIQEEARHLTEAMEKEG-GQPFDAHFKINNAVSNIICSITFGERFEYHDGQFQELLKLFDEVMYLEASMLCQLYNIFPWIMKFLPGAHQTLFSN---WKKLELFVSRMLENHKKDWNPAETRDFIDAYLKEMSKYPG--SATSSFNEENLICSTL-DLFLAGTETTSDMRWGLLFMALYPEIQEKVHAEIDSVIGQWQQPSMASRESLPYTNAVIHEVQRMGNILPLNVPREVT-VDTTLAGYHLPKGTVVLTNLTALHKDPEEWATPDTFNPE-HFLENGQFKKKEAFIPFSIGKRACLGEQLAKSELFIFFTSLMQKFTF------KPPSDEKLTLNFRMGITLSP 490          
BLAST of cytochrome p450 partial vs. SwissProt
Match: gi|74913029|sp|Q6R7M4.1|C15A1_DIPPU (RecName: Full=Methyl farnesoate epoxidase; AltName: Full=Cytochrome P450 CYP15A1; Flags: Precursor)

HSP 1 Score: 243.047 bits (619), Expect = 2.875e-71
Identity = 161/505 (31.88%), Postives = 251/505 (49.70%), Query Frame = 0
Query:   37 IIALVVVVLILAWYVKNRLPANYPPTPPTRLPLFGHSHYLLFTRNSGIEAIDELFHKY--SKDG-VMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSNQSG--PIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAILAAGIKPSIAFI--FPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKT-TDVDSSFSKTNGDEMILQTLIDLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNPPPNEGICGITRIPKPFSFNL 529
            +IAL+V+++ L      + P  YPP P   LP+ G   YL F R         L      S+ G V    LG+  +V+   +D +++    ++ + R              R+     G++   G +W EQRRF +   +  G G   ME  I++E    +  + + +  G   I   ++F+  VLN LW M+AG RFD DD+ L ++ ++V +      I PS   +   P LR I P        +  +  + +FL   + +HRK+F+  ++RD ID +L EME +    +SSF     D  ++   +DLF AG         F VLY+++ P+VQ ++ +E+   +G +R P L DR  L YL+A ++EIQR     P+G+ H        L  + +P+G T       + +D ++W  PE F+PER I+  G +  D   +PF IGKR+C GETLAK+++FL  + LL  F I P   +  P  EG  G+T  PKPFS  L
Sbjct:    2 VIALIVIIIFLVCLDVIK-PRGYPPGP-VWLPVVGS--YLWFRREKSRVGYYHLVWSSLSSRYGPVTGMRLGTDYIVVACGYDAIRDILLRDEFDGRPDG------YFFRLRTFGKRMGVVFTDGPVWQEQRRFCMQHLRKLGLGSRSMEAHIEEEARDLVASLHRRSNGGLTAIPMHDVFDICVLNSLWAMLAGHRFDLDDQRLVDLLDIVHKCFRM--IDPSGGLLNQMPPLRFIAPRHSGYTNLMTHLNRIWNFLRETIDDHRKSFNADNMRDLIDLFLREMETSKCQNNSSFE----DLQLVSLCLDLFMAGSETTSNTLGFAVLYMLLYPQVQRRVQDELDRCVGTDRQPTLQDRRSLRYLEAVLMEIQRHATIAPSGIPH-KALKNTVLMGHTIPKGTTVLVSMWSLHRDVQHWGDPEVFRPERFISGNGNIKQDDWFMPFGIGKRRCIGETLAKASLFLFFSTLLHNFSILPSSESPLPSLEGYDGVTLSPKPFSAKL 489          
BLAST of cytochrome p450 partial vs. SwissProt
Match: gi|1706098|sp|P51590.1|CP2J3_RAT (RecName: Full=Cytochrome P450 2J3; AltName: Full=CYPIIJ3)

HSP 1 Score: 237.654 bits (605), Expect = 3.670e-69
Identity = 170/516 (32.95%), Postives = 263/516 (50.97%), Query Frame = 0
Query:   28 FGILHGMLEIIALVVVVLILAWYVKNRLPANYPPTPPTRLPLFGHSHYLLFTRNSGIEAIDELFHKYSKDGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAI-LAAGIKPSIAFIFPWLRDIFP-NIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTD-VDSSFSKTNGDEMILQTLIDLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNPPPNEGICGITRIPKPFSFNLKRRSSIP 536
            + +LH  + ++A  V  L LA ++K+R P NYPP P  RLPL G   +L         ++ +   KY    V++    +   V++    L+KE F   + NF   N+       LLR+      G+I   G+ W EQRRF L T ++FG GK  +E+ I++E    ++ I K     P       N AV NI+  +  GERF+Y D   + +  L+ EA+ L + +   +  IFP +    P +   L+ N    + +K F+  +++ HR+ +DP   RDFIDA+L EM K  D   +SF++ N   +I  TL DLFFAG         + +L + + PEVQ K+  EI  VIG  R P+LADR  +PY +A I E+QR+G+ +P  +      V   L  + +P+G     + + + +DP+ W  P+ F PE H  + G+    +  +PFS+GKR C GE LA+S +F+ +  L+Q+F         PP NE +    R+    S    R  +IP
Sbjct:   13 WTVLHLRILLLA-AVTFLFLADFLKHRRPKNYPPGP-WRLPLVGCLFHL--DPKQPHLSLQQFVKKYG--NVLSLDFANIPSVVVTGMPLIKEIFTQMEHNF--LNRP----VTLLRKHLFNKNGLIFSSGQTWKEQRRFALMTLRNFGLGKKSLEQRIQEEAYHLVEAI-KDEGGLPFDPHFNINKAVSNIICSVTFGERFEYHDSQFQEMLRLLDEAMCLESSMMCQLYNIFPRILQYLPGSHQTLFSN---WRKLKLFISDIIKNHRRDWDPDEPRDFIDAFLKEMAKYPDKTTTSFNEEN---LICSTL-DLFFAGTETTSTTLRWALLCMALYPEVQEKMQAEIDRVIGQGRQPNLADRDSMPYTNAVIHEVQRIGNIIPFNVPREVA-VDTYLAGFNLPKGTMILTNLTALHRDPKEWATPDTFNPE-HFLENGQFKKRESFLPFSMGKRACLGEQLARSELFIFITSLIQKFTF------KPPVNEKLSLQFRMSVTISPVSHRLCAIP 500          
BLAST of cytochrome p450 partial vs. SwissProt
Match: gi|21264413|sp|P51589.2|CP2J2_HUMAN (RecName: Full=Cytochrome P450 2J2; AltName: Full=Arachidonic acid epoxygenase; AltName: Full=CYPIIJ2)

HSP 1 Score: 236.884 bits (603), Expect = 6.759e-69
Identity = 161/475 (33.89%), Postives = 241/475 (50.74%), Query Frame = 0
Query:   41 VVVVLILAWYVKNRLPANYPPTPPTRLPLFGHSHYLLFTRNSGIEAIDELFHKYSKDGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAI-LAAGIKPSIAFIFPWLRDIFPN-IDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEK-TTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNN 508
             V  L+ A ++K R P NYPP P  RLP  G + +L+    S +E   +LF K     + +  LG    V+I    L+KE     D NF   N+        +R       G+I   G+ W EQRRF L+  ++FG GK  +E  I++E     + I++ N   P       N AV NI+  +  GERF+Y D   + + +L+ E   L A     +  +FPW+    P     L+ N    + +K F+  ++ +HRK ++P   RDFIDAYL EM K T +  SSF + N   +I  TL DLFFAG         + +LY+ + PE+Q K+  EI  VIG  + P  A R  +PY +A I E+QR+G+ +P  +      V   L  Y++P+G     + + + +DP  W  P+ F P+ H  + G+    +  +PFSIGKR C GE LA++ +F+    L+Q+F   P  PNN
Sbjct:   25 TVAFLLAADFLKRRRPKNYPPGP-WRLPFLG-NFFLVDFEQSHLEV--QLFVK-KYGNLFSLELGDISAVLITGLPLIKEALIHMDQNF--GNRP----VTPMREHIFKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEEN-GQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFLPGPHQTLFSN---WKKLKLFVSHMIDKHRKDWNPAETRDFIDAYLKEMSKHTGNPTSSFHEEN---LICSTL-DLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMPYTNAVIHEVQRMGNIIPLNVPREVT-VDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDTFNPD-HFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRP--PNN 476          
BLAST of cytochrome p450 partial vs. SwissProt
Match: gi|3913341|sp|O54749.1|CP2J5_MOUSE (RecName: Full=Cytochrome P450 2J5; AltName: Full=Arachidonic acid epoxygenase; AltName: Full=CYPIIJ5)

HSP 1 Score: 233.802 bits (595), Expect = 9.807e-68
Identity = 156/499 (31.26%), Postives = 252/499 (50.50%), Query Frame = 0
Query:   24 ITLFFGILHGMLEIIALVVVVLILAWYVKNRLPANYPPTPPTRLPLFGHSHYLLFTRNSGIEAIDELFHKYSKDGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAILAAGIKPSIAFI-FPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVP-NGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNPPPNEGIC 516
            +T F+  LH +  ++  VV  L L   +++R P NYPP P  RLP  G + + + T+ + +  + +   KY    V +  LG   +V++    L+KE F   D NF   N+        +R    G  G++   G+ W EQRR  L   ++FG GK  +E  I++E    ++ I +         + + N AV NI+  +  GERFDY+D   + + +L+ E +   G      +  FP +    P   P  K  +    +K F+  +V++H K ++P   RDFIDA+L+EM+K  D  +SF++ N    ++ T +DLF  G         + +LY+   PE+Q  +  EI  VIG +R   L+DR  +PY +A I E+QR+G+ VP N        V  +   +++P+G     + + + +DP+ W  PE F PE H  + G+    +  +PFS+GKR C GE LAKS +F+  + L+Q+F         PP NE + 
Sbjct:    9 VTTFWEALH-LKTLVLAVVTFLFLINILRSRHPKNYPPGP-WRLPFVG-NFFQIDTKQTHL-VLQQFVKKYG--NVFSLELGQSPVVVVSGLPLIKEMFTHLDQNF--VNR----FMTPVRERITGKNGLVVSNGQTWKEQRRLALMALRNFGLGKKSLEERIQEETHHLVEAIREEGGQPFNPHLKLIN-AVSNIICSVTFGERFDYEDCQFQELLQLLDETMHLMGSSAGQLYNGFPCIMKYLPG--PHQKIFRNWGKLKLFVSHIVKKHEKDWNPDEPRDFIDAFLIEMQKDPDRTTSFNEEN----LISTTLDLFLGGTETTSSTLRWALLYMSSYPEIQENVQAEIDRVIGHKRQVSLSDRESMPYTNAVIHEVQRMGNIVPLNSSREVT--VDTKFNGFHLPKGTMILTNLTALHRDPKEWATPEVFNPE-HFLENGQFKKRESFLPFSMGKRACLGEQLAKSELFIFFSALMQKFTF------KPPINEKLS 479          
BLAST of cytochrome p450 partial vs. SwissProt
Match: gi|150438887|sp|Q9CX98.2|CP2U1_MOUSE (RecName: Full=Cytochrome P450 2U1)

HSP 1 Score: 231.106 bits (588), Expect = 1.679e-66
Identity = 148/503 (29.42%), Postives = 258/503 (51.29%), Query Frame = 0
Query:   50 YVKNRLPANYPPTPPTRLPLFGHSHYLLFTR--------NSGIEAIDELFHKYSK------DGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGII-EGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAI-LAAGIKPSIAFIFPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNPPPNEGICGITRIPKPFSFNLKRR 532
            +++ +     PP P  R PL G+  +LL  R         SG +      H Y          + +F +G   +V++  F  ++E    +   F  +++  + L  ++ + K    GI+    G IW +QRRF  ST + FG GK  +E  I +E  +  + ++K  ++ P     + + AV NI+  +  G+RFDY +K+ K + + ++  + +    +  +  I PW    +    P  +  QI +++  FL ++++EH+++ D  + +DFID YLL ME+  +  +S   +  ++ +   + DLF AG         + +LY+ +NP+VQ K+HEEI+ VIG +R P L D+A +PY +A+I+E+QRL   VP  + H         G + +P+G     +   + +DP  W KP++F P R ++D+G+++  +  IPF IGKR C GE LAK  +FL+   L+Q F     + +  P   G  G+T  P PF+  + +R
Sbjct:   41 WLRRQRACGIPPGPKPR-PLVGNFGHLLVPRFLRPQFWLGSGSQTDTVGQHVYLARMARVYGNIFSFFIGHRLVVVLSDFHSVREALVQQAEVF--SDRPRMPLISIMTKEK----GIVFAHYGPIWKQQRRFSHSTLRHFGLGKLSLEPRIIEEFAYVKEAMQKHGEA-PFSPFPIISNAVSNIICSLCFGQRFDYTNKEFKKVLDFMSRGLEICLHSQLFLINICPWF--YYLPFGPFKELRQIERDISCFLKNIIREHQESLDASNPQDFIDMYLLHMEE--EQGASRRSSFDEDYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPDVQKKVHEEIERVIGCDRAPSLTDKAQMPYTEATIMEVQRLSMVVPLAIPHMTSEKTVLQG-FTIPKGTVVLINLWSVHRDPAIWEKPDDFCPHRFLDDQGQLLKRETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQTFTFALPEGSEKPVMTGRFGLTLAPHPFNVTISKR 530          
BLAST of cytochrome p450 partial vs. SwissProt
Match: gi|81908683|sp|Q4V8D1.1|CP2U1_RAT (RecName: Full=Cytochrome P450 2U1)

HSP 1 Score: 230.335 bits (586), Expect = 3.019e-66
Identity = 157/506 (31.03%), Postives = 254/506 (50.20%), Query Frame = 0
Query:   48 AWYVKNRLPANYPPTPPTRLPLFGHSHYLLFTR--------NSGIEAIDELFHKYSK------DGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGII-EGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAI-LAAGIKPSIAFIFPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLI-DLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNPPPNEGICGITRIPKPFSFNLKRR 532
             W  + R     PP P  R PL G+  YLL  R         SG +      H Y          + +F +G   +V++  F  ++E    +   F  +++  + L  +L + K    GI+    G IW +QRRF  ST + FG GK  +E  I +E  +    ++K  ++ P     + + AV NI+  +  G+RFDY +K+ K + + ++  + +    +  +  + PW    +    P  +  QI +++  FL ++++EH+++ D  + +DFID YLL  ++  D       TN DE  L  +I DLF AG         + +LY+ +NP VQ K+HEEI+ VIG +R P L D+A +PY +A+I+E+QRL   VP  + H         G Y +P+G     +   I +DP  W KP++F P R ++D+G+++  +  IPF IGKR C GE LAK  +FL+   L+Q F     + +  P   G  G+T  P PF+  + +R
Sbjct:   40 VWLQRQR-AGGIPPGPKPR-PLVGNFGYLLLPRFLRLHFWLGSGSQTDTVGRHVYLARLARVYGNIFSFFIGHRLVVVLSDFQSVREALVQQAEVF--SDRPRMPLISILTKEK----GIVFAHYGPIWKQQRRFSHSTLRHFGLGKLSLEPRIIEEFAYVKAEMQKHGEA-PFSPFPVISNAVSNIICSLCFGQRFDYTNKEFKKVLDFMSRGLEICLHSQLFLINLCPWF--YYLPFGPFKELRQIERDITCFLKNIIKEHQESLDANNPQDFIDMYLLHTQEEKD---KCKGTNFDEDYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPGVQKKVHEEIERVIGRDRAPSLTDKAQMPYTEATIMEVQRLSMVVPLAIPHMTSEKTVLQG-YSIPKGTVVLPNLWSIHRDPVIWEKPDDFCPHRFLDDQGQLLKRETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSFTFALPEGSEKPIMTGRFGLTLAPHPFNVTVSKR 530          
BLAST of cytochrome p450 partial vs. SwissProt
Match: gi|74762432|sp|Q7Z449.1|CP2U1_HUMAN (RecName: Full=Cytochrome P450 2U1)

HSP 1 Score: 229.565 bits (584), Expect = 9.243e-66
Identity = 150/511 (29.35%), Postives = 257/511 (50.29%), Query Frame = 0
Query:   50 YVKNRLPANYPPTPPTRLPLFGHSHYLLF-------------TRNSGIEA--------IDELFHKYSKDGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAI-LAAGIKPSIAFIFPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEME--KTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNPPPNEGICGITRIPKPFSFNLKRR 532
            +++ R     PP P T  PL G+  ++L              TR +GI+         +  L   Y    + +F +G + +V++  F  ++E    +   F  +++  + L  ++ + K     +    G +W +QR+F  ST + FG GK  +E  I +E  +    ++K  +  P    ++ + AV NI+  +  G+RFDY + + K +   ++  + +    +  +  I PWL   +    P  +  QI +++  FL  ++++H+++ D  + +DFID YLL ME  +  + +SSF     +E +   + DLF AG         + +LY+ +NP+VQ K+HEEI+ VIG  R P L D+A +PY +A+I+E+QRL   VP  + H        L  Y +P+G     +   + +DP  W KPE+F P R ++D+G+++  +  IPF IGKR C GE LAK  +FL+   L+Q F     + +  P   G  G+T  P PF+  + RR
Sbjct:   50 WLRRRRARGIPPGP-TPWPLVGNFGHVLLPPFLRRRSWLSSRTRAAGIDPSVIGPQVLLAHLARVYG--SIFSFFIGHYLVVVLSDFHSVREALVQQAEVF--SDRPRVPLISIVTKEKGV---VFAHYGPVWRQQRKFSHSTLRHFGLGKLSLEPKIIEEFKYVKAEMQKHGED-PFCPFSIISNAVSNIICSLCFGQRFDYTNSEFKKMLGFMSRGLEICLNSQVLLVNICPWL--YYLPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFIDMYLLHMEEERKNNSNSSFD----EEYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPDVQEKVHEEIERVIGANRAPSLTDKAQMPYTEATIMEVQRLTVVVPLAIPHMTS-ENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLDDQGQLIKKETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSFAFALPEDSKKPLLTGRFGLTLAPHPFNITISRR 544          
BLAST of cytochrome p450 partial vs. SwissProt
Match: gi|122142141|sp|Q0IIF9.1|CP2U1_BOVIN (RecName: Full=Cytochrome P450 2U1)

HSP 1 Score: 222.631 bits (566), Expect = 2.806e-63
Identity = 149/511 (29.16%), Postives = 254/511 (49.71%), Query Frame = 0
Query:   49 WYVKNRLPANYPPTPPTRLPLFGHSHYLLF-------------TRNSGIEAIDELFHKYSKD------GVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGII-EGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAI-LAAGIKPSIAFIFPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLL--EMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNPPPNEGICGITRIPKPFSFNLKRR 532
            W    RLP    P  P   P+ G+  ++L               RN G+ A  +       D       + +F +G + +V++  F  ++E    +   F  +++  + L  ++ + K    GI+    G +W +QR+F  ST + FG GK  +E  I +E  +  + ++K   + P     + N AV NI+  +  G RFDY + + K +   ++ A+ +    +  +  I  WL   +    P  +  QI +++  FL  ++++HR++ D  + +DFID YLL  E EK  + +S F     ++ +   + DLF AG         + +LY+ ++P +Q KIHEEI  VIG +R P L D+A +PY +A+I+E+QRL   VP  + H         G + +P+G     +   + +DP  W KP +F P+R ++D+G+++  +  IPF IGKR C GE LAK  +FL+   L+Q F  F +  ++ P   G  G+T  P PF+  + +R
Sbjct:   48 WSWLWRLPERGIPPGPAPWPVVGNFGFVLLPRFLRRKSWPYRRARNGGMNASGQGVQLLLADLGRVYGNIFSFLIGHYLVVVLNDFHSVREALVQQAEVF--SDRPRVPLTSIMTKGK----GIVFAHYGPVWRQQRKFSHSTLRHFGLGKLSLEPKIIEEFRYVKEEMQKHGDA-PFNPFPIVNNAVSNIICSLCFGRRFDYTNSEFKQMLNFMSRALEVCLNTQLLLVNICSWL--YYLPFGPFKELRQIEKDLTLFLKKIIKDHRESLDVENPQDFIDMYLLHVEEEKKNNSNSGFD----EDYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLHPNIQEKIHEEIARVIGADRAPSLTDKAQMPYTEATIMEVQRLSTVVPLSIPHMTSEKTVLQG-FTIPKGTIILPNLWSVHRDPAIWEKPNDFYPDRFLDDQGQLIKKETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSF-TFVLPKDSKPILTGKYGLTLAPHPFNIIISKR 543          
BLAST of cytochrome p450 partial vs. nr
Match: gi|1143366429|ref|XP_019936553.1| (PREDICTED: cytochrome P450 2J5-like [Paralichthys olivaceus])

HSP 1 Score: 267.7 bits (683), Expect = 4.500e-78
Identity = 173/498 (34.74%), Postives = 260/498 (52.21%), Query Frame = 0
Query:   47 LAWYVKNRLPANYPPTPPTRLPLFGHSHYLLFTRNSG--IEAIDELFHKYSKDGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAILAAGIKPSIAFIFPWLRDIFPNI-----DPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVP-NGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNPPPNEGICGITRIPKPFSFNLKRR 532
            +A ++K+R P NYPP P + LP+ G+     F+ +S    +   +L   Y    V +  LGS KLV +  + +LKE    +  NF    +      ++ R     + G+    G  W +QRRF LST + FG GKS ME+ I +E+ +  + +EK  +  P  T  +FN AV NI+ QM+ G+R++Y D + + +   ++E     G       I+ +L + FPN+      P  K      +++DFL   +Q H+K  D  + +D+IDA+L+EM    D +  F+ TN    ++   +D+F AG         + ++Y I NPE+Q K+  EI  VIG  R P +ADR ++PY DA I EIQR+G+ VP NGL  A       LG Y++P+G +     + ++ D + W  P+ F P   ++ EGK V  +  +PFS GKR C GE LAK  +FL L  LLQRF  F          EGI G  R+P PF  + K R
Sbjct:   25 MADFIKHRNPPNYPPGP-SGLPIVGN----FFSMDSKHPYKYFTKLAEIYGN--VFSVRLGSDKLVFVTGYKMLKESIVTQAENFVDRPQS----PMIDRMYGGSSGGLFMSNGETWKKQRRFALSTLRTFGLGKSLMEQSICEEIRYLQEELEKE-KGEPFSTAGLFNNAVSNIICQMVMGKRYEYSDHNFQTMLTYLSEFFRLEGS------IWGFLYESFPNVMNYLPGPHNKIFSHFIDIQDFLKQELQRHKKELDHNNPQDYIDAFLIEMANHKDSELGFTDTN----LIMCSLDMFLAGTETTAITLQWALVYFINNPEIQEKVQTEIDGVIGQSRQPTMADRPNMPYTDAVIHEIQRMGNIVPLNGLRVAAKDT--TLGGYFIPKGTSIMPMLTSVLFDKDEWETPDTFNPGHFLDAEGKFVRKEAHLPFSAGKRVCLGEGLAKMELFLFLVGLLQRFS-FTAPDGVELSTEGITGSVRVPHPFKVHAKAR 497          
BLAST of cytochrome p450 partial vs. nr
Match: gi|1101635226|ref|XP_018981179.1| (PREDICTED: cytochrome P450 2J2-like isoform X2 [Cyprinus carpio])

HSP 1 Score: 266.544 bits (680), Expect = 1.332e-77
Identity = 172/498 (34.54%), Postives = 260/498 (52.21%), Query Frame = 0
Query:   37 IIALVVVVLILAWYVKNRLPANYPPTPPTRLPLFGHSHYLLFTRNSGIE-AIDELFHKYSKDGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSNQSG-PIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAI-LAAGIKPSIAFIFPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNPPPNEGICGITRIPKPFSF 527
            I+    V L+L+ Y +N+ P N+PP P + LP+ G  H++    NS I     E   KY K  + +  +   ++V++  + L+KE +  +  N        L   I+      G++G+I   G  W +QRRF LST ++FG GK  +E  I  E  F  + I  SN+ G P     + N AV N++  ++ G RF+Y D D +N+ + ++EA+ L  G    +  +FPWL  + P   P  K + + Q V DF+   V  HR  +DP + RD+ID +L EMEK  D   + S  + + + + TL DLF AG         + +LY+I  PE+Q K+ EEI  V+G  + P L+DR ++PY +A I EIQR+G+ VP  L  A      Q+GKY +P+G    G  + ++ D   W  P  F P   ++ EGK       +PFS+GKR CPGE LA+  +FL  + LLQRF         P  N  + G T  P+P++ 
Sbjct:   15 ILIFSCVFLLLSDYFRNKAPKNFPPGPWS-LPIIGDIHHI---DNSRIHLQFSEFAEKYGK--IFSLRILGPRIVVLDGYKLVKEVYLQQGDNLADRPLLPLFYDII------GDKGLIAASGYKWKQQRRFALSTLRNFGLGKKSLEPSISLECCFLNEAI--SNEQGRPFDPHLLLNNAVSNVICVLVFGNRFEYSDNDFQNLLKNISEAVYLEGGFCAQLYNMFPWLLRLVPG--PHKKVIILWQKVIDFVREKVNAHRVDYDPSNPRDYIDCFLAEMEKLED--DTASGFDVENLCICTL-DLFVAGTETTSTTLYWGLLYMIKYPEIQAKVQEEIDCVVGGSQQPSLSDRDNMPYTNAVIHEIQRIGNIVPLNLARAT-VEDTQIGKYSIPKGTIVTGYLTSVLFDESEWETPYSFNPGHFLDVEGKFRRRDAFLPFSLGKRVCPGEQLARMELFLFFSSLLQRFTFSSPAGVEPSLNFKL-GATHCPQPYAL 491          
BLAST of cytochrome p450 partial vs. nr
Match: gi|1109008780|ref|XP_010743976.2| (PREDICTED: cytochrome P450 2J6-like [Larimichthys crocea])

HSP 1 Score: 266.544 bits (680), Expect = 1.450e-77
Identity = 166/502 (33.07%), Postives = 255/502 (50.80%), Query Frame = 0
Query:   37 IIALVVVVLILAWYVKNRLPANYPPTPPTRLPLFGHSHYLLFTRNSGIEAIDELFHKYSKDGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAILAAGIKPSIAF-IFPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGLMH-ANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNPPPNEGICGITRIPKPFSFNLKRR 532
            I+  + V L+LA  +KNR P N+PP P + LPL G  H +  +R   ++ I EL  KY    + +  L   ++V+I  + L++E       +F   ++  L L         GN+G++   G +W +QRRF L T ++FG GK  +E  I+ E  +  +      Q  P   +++ N AV NI+  ++ G RF+Y D+  + I +  +EA+L  G   + A+   PWL    P   P  K   ++Q + DF++  + EH+++ DP   RD+ID +L EM +  D DS F   N    +    +DLF AG         + +LY+I  P +Q ++  EI  V+G  R P LADR ++PY DA I EIQR+ D +P  ++H AN     +L KY +P+G         ++ D   W  P  F P+  ++ +GK       +PFS GKR C GE LA+  +FL    LLQRF   P     P     + G+ R PKP+S    +R
Sbjct:   18 ILIFLCVFLLLADVLKNRAPTNFPPGPWS-LPLIGDLHRIELSRLH-LQFI-ELAKKYGN--IFSLRLFGGRMVVINGYKLVREALVERGEDF--IDRPTLPLF----EESIGNKGLVASNGNLWKQQRRFALHTLRNFGVGKKSLEPSIQQECQYLTEAF-ALQQGKPFNALSLINNAVSNIICCLVFGHRFEYTDEQFQRILQNFSEAVLLEGTLWAQAYNTLPWLMKWVPG--PHRKIFMLLQKILDFIEIKINEHKESLDPSSPRDYIDYFLAEMGEKEDKDSGFDLKN----LCVCTLDLFGAGTETTTTSLHWGLLYMIYYPHIQERVQAEIDKVVGSSRQPSLADRENMPYTDAVIHEIQRMADIIPLNVVHMANK--DTKLNKYTIPKGTIIMPSLHSVLHDESMWETPHSFNPQHFLDQDGKFRKRDAFLPFSAGKRVCLGEKLARMELFLFFTSLLQRFSFSPSTGEQPSLEFNLGGV-RAPKPYSLCAVQR 498          
BLAST of cytochrome p450 partial vs. nr
Match: gi|432855536|ref|XP_004068236.1| (cytochrome P450 2J6 [Oryzias latipes])

HSP 1 Score: 266.544 bits (680), Expect = 1.457e-77
Identity = 171/493 (34.69%), Postives = 260/493 (52.74%), Query Frame = 0
Query:   48 AWYVKNRLPANYPPTPPTRLPLFGHSHYLLFTRNSGIEAIDELFHKYSKDGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNE-GIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAILAAGIKPSIAF-IFPWLRDIFPNI-DPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVP-NGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPIDPNNPPPNEGICGITRIPKPFSFNLKRR 532
            A ++K+R PAN+PP P   LP  G+  +L            ++   Y    V +  LGS   V +  + ++KE    +  NF      +   + +  R   GN  G+    G  W +QRRF LST + FG GK+ ME+ I +E+      IE + + GP     +FN AV NI+ Q++ G+RFDYDD + + + + ++EA+   G    I +  FP L    P   + +++N +I+Q   DFL   ++ H++  DP + RD+ID++++EMEK  + D  F+  N    +    +DLF AG         + ++YLI +P+VQ K+ +EI  VIG  R P +ADR +LPY DA + EIQR+G+ VP NGL  A       LG Y++P+G       + ++ D   W  P+ F PE  ++ +GK V  +  +PFS GKR C GE LA+  +FL L  LLQ+F  F +        EGI G TR+P P+    K R
Sbjct:   26 ADWIKHRKPANFPPGP-LGLPFVGN--FLTIDGKHPHIYFSKMAESYGN--VFSVRLGSQATVFVSGYKMVKEALVTQAENFV-----DRPFSEIGGRFYEGNSNGLFFSNGEKWKKQRRFALSTLRTFGLGKNTMEQSICEEIRHLQQQIE-NEKGGPFSPAGLFNNAVSNIICQLVMGKRFDYDDNNFQVMMKYISEAVQLEGSIWGILYESFPGLMKHLPGSHNKIFRNYKIVQ---DFLAQEIKIHKQDLDPNNPRDYIDSFIIEMEKHQNSDLGFNDAN----LAFCSLDLFVAGTETTSTTLMWALIYLIKHPDVQVKVQQEIDRVIGQNRLPSMADRPNLPYTDAVVHEIQRIGNIVPLNGLRVAAKDT--TLGGYFIPKGTALMPMLTSVLFDKTEWETPDTFNPEHFLDADGKFVKKEAFLPFSAGKRVCLGEGLARMELFLFLVGLLQKFS-FSVPEGVELSTEGITGTTRVPHPYKVYAKVR 497          
BLAST of cytochrome p450 partial vs. nr
Match: gi|488598894|ref|XP_004484588.1| (cytochrome P450 2J2-like [Dasypus novemcinctus])

HSP 1 Score: 265.774 bits (678), Expect = 3.253e-77
Identity = 163/475 (34.32%), Postives = 248/475 (52.21%), Query Frame = 0
Query:   41 VVVVLILAWYVKNRLPANYPPTPPTRLPLFGHSHYLLFTRNSGIEAIDELFHKYSKDGVMAFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGNEGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKSNQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAI-LAAGIKPSIAFIFPWLRDIFPN-IDPLYKNVQIMQNVKDFLDSVVQEHRKTFDPYHIRDFIDAYLLEMEKTTD-VDSSFSKTNGDEMILQTLIDLFFAGQPAQP----FHVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRLGDTVPNGL---MHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEFKPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFEIFPID 505
             V  L +A ++K R P NYPP PP  LP  G+   L F R+     +  L  KY    +++ H G  + V +    L+KE    ++ NF         L   +R       GI+   GR W EQRRF+L+T ++FG GK  +E  I++E    ++ IE+  +  P       N AV NI+  +  GERFDY D   + + + + EA  L   ++  +  +FPW+    P     L++N    +N+K F+  +++EH++ ++P  +RDFIDAYL E+ K +D   SSF + N   +I  TL DLFFAG         + +LYL +NPE+Q K+  EI  VIG    P  ADR  LPY +A I E+QR+ + +P  +   + A+  V      YY+P+G     + + + +DP  W  P+ F PE H  + G+    +  +PFSIGKR CPGE LA+S +F+     +Q+F   P +
Sbjct:   25 AVTFLFIADFLKRRRPKNYPPGPPG-LPFIGNFFQLDFQRSH--LQLQRLVKKYG--NLLSLHFGDLRAVTVTGLPLIKEVLVHQEQNFLNR------LRTPIRERIFKKNGIVMSNGRTWKEQRRFVLTTLRNFGLGKKSLEERIQEEARHLIEAIEEE-KGQPFDPHFKINNAVSNIICSITFGERFDYQDGQFQELLKWLDEATCLEPSMQCQLYNLFPWIMKFLPGPHQTLFRN---WENLKSFVSHIIEEHKRNWNPAEMRDFIDAYLQEIAKNSDNAASSFHEEN---LICSTL-DLFFAGTETTSTTLRWALLYLTVNPEIQEKVQAEIDRVIGPSHQPTTADRERLPYTNAVIHEVQRMANIIPFNVPREVSADTTV----AGYYLPKGTMILTNLTALHRDPAEWATPDVFNPE-HFLENGQFKKRESFLPFSIGKRACPGEQLARSELFIFFTSFMQKFTFRPAN 475          
The following BLAST results are available for this feature:
BLAST of cytochrome p450 partial vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides)
Total hits: 14
Match NameE-valueIdentityDescription
EMLSAG000000051631.266e-11840.04supercontig:LSalAtl2s:LSalAtl2s272:555567:557147:-... [more]
EMLSAG000000023598.738e-7133.47supercontig:LSalAtl2s:LSalAtl2s144:369128:376155:1... [more]
EMLSAG000000073281.950e-6030.14supercontig:LSalAtl2s:LSalAtl2s412:195302:204629:-... [more]
EMLSAG000000077582.152e-5530.72supercontig:LSalAtl2s:LSalAtl2s453:376415:377986:-... [more]
EMLSAG000000046882.876e-5226.97supercontig:LSalAtl2s:LSalAtl2s245:535864:537578:-... [more]
EMLSAG000000068221.889e-5031.52supercontig:LSalAtl2s:LSalAtl2s383:99037:100275:-1... [more]
EMLSAG000000057216.937e-3726.35supercontig:LSalAtl2s:LSalAtl2s309:682709:688189:1... [more]
EMLSAG000000094059.405e-1524.24supercontig:LSalAtl2s:LSalAtl2s5:994028:996076:1 g... [more]
EMLSAG000000114751.819e-1133.67supercontig:LSalAtl2s:LSalAtl2s792:187038:188249:1... [more]
EMLSAG000000052692.123e-1124.55supercontig:LSalAtl2s:LSalAtl2s281:237457:238966:1... [more]

Pages

back to top
BLAST of cytochrome p450 partial vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|341940387|sp|O54750.2|CP2J6_MOUSE1.662e-7433.47RecName: Full=Cytochrome P450 2J6; AltName: Full=A... [more]
gi|1706096|sp|P52786.2|CP2J1_RABIT3.726e-7233.74RecName: Full=Cytochrome P450 2J1; AltName: Full=C... [more]
gi|74913029|sp|Q6R7M4.1|C15A1_DIPPU2.875e-7131.88RecName: Full=Methyl farnesoate epoxidase; AltName... [more]
gi|1706098|sp|P51590.1|CP2J3_RAT3.670e-6932.95RecName: Full=Cytochrome P450 2J3; AltName: Full=C... [more]
gi|21264413|sp|P51589.2|CP2J2_HUMAN6.759e-6933.89RecName: Full=Cytochrome P450 2J2; AltName: Full=A... [more]
gi|3913341|sp|O54749.1|CP2J5_MOUSE9.807e-6831.26RecName: Full=Cytochrome P450 2J5; AltName: Full=A... [more]
gi|150438887|sp|Q9CX98.2|CP2U1_MOUSE1.679e-6629.42RecName: Full=Cytochrome P450 2U1[more]
gi|81908683|sp|Q4V8D1.1|CP2U1_RAT3.019e-6631.03RecName: Full=Cytochrome P450 2U1[more]
gi|74762432|sp|Q7Z449.1|CP2U1_HUMAN9.243e-6629.35RecName: Full=Cytochrome P450 2U1[more]
gi|122142141|sp|Q0IIF9.1|CP2U1_BOVIN2.806e-6329.16RecName: Full=Cytochrome P450 2U1[more]

Pages

back to top
BLAST of cytochrome p450 partial vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR)
Total hits: 25
Match NameE-valueIdentityDescription
gi|1143366429|ref|XP_019936553.1|4.500e-7834.74PREDICTED: cytochrome P450 2J5-like [Paralichthys ... [more]
gi|1101635226|ref|XP_018981179.1|1.332e-7734.54PREDICTED: cytochrome P450 2J2-like isoform X2 [Cy... [more]
gi|1109008780|ref|XP_010743976.2|1.450e-7733.07PREDICTED: cytochrome P450 2J6-like [Larimichthys ... [more]
gi|432855536|ref|XP_004068236.1|1.457e-7734.69cytochrome P450 2J6 [Oryzias latipes][more]
gi|488598894|ref|XP_004484588.1|3.253e-7734.32cytochrome P450 2J2-like [Dasypus novemcinctus][more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold133_size323035supercontigscaffold133_size323035:131220..159481 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
maker2018-02-12 .496401
T. kinsejongensis vs L. Salmonis peptides2018-04-19
T. kingejongensis peptided Blastp vs. SwissProt2018-04-19
T. kingsejongensis proteins Blastp vs. NR2018-05-15
Properties
Property NameValue
NoteF:binding
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1Tigriopus kingsejongensismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at scaffold133_size323035:131220..159481-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>snap_masked-scaffold133_size323035-processed-gene-1.7 ID=snap_masked-scaffold133_size323035-processed-gene-1.7|Name=cytochrome p450 partial|organism=Tigriopus kingsejongensis|type=gene|length=28262bp|location=Sequence derived from alignment at scaffold133_size323035:131220..159481- (Tigriopus kingsejongensis)
ATGTCCTCAGATTTGAATGTCTCATTTGAGCATATCATTAAACTTCAGTT GACACACCTGATCCTCGGCATCACGCTGTTCTTTGGGATCCTCCACGGGT GAGCGGCTTAAAGCGTCAGCGATGTCAGCGATTGGAAAGAGCATTAGCTC TTTCCCCTTCTTCCACTCCAAGGTAAACACGAACGGGCTCAATTTTTCTT TGATGCGTTGGAGCCTTGGATTGTCACTGGCATCCAAAAAAATCCATTCA CAATTGGGAGCAGAGGCTTATGGTCTGTCACGACGGTGAAATGAGGCATT CCAAGGAGGTAAATGCGACACTGGTTCATGGTTCCATCTACCACGACGCC ATGTTATATCTCCATGAACGTTTATTCTCAGACTCCCGAACGTACGCAGG ACAAGCAGGAGCATGAAACGCATAAGAGCATGGTATCGGAAGAGCATCGC AATAACATTCATATCCAACAGGTGTTATAGTGACTTAACTACTTGACTAC TGACTACTTGACTTGACTACTGGTGTTATATTGACTCAGCTCATGGTAGG AGGGAACATCAAGGCCAAGGATCGAAACGCTATTGCAATTGAAGTTGGTG GCGTTTTGGCTCGCCATCTGCCCCGAGGGGAGTACCTTCGTCAACTGGCC TCGGGCCTAATCATAAGCAAGGTTAGTTACGTTGCAGCAGCCGTTGTTGC CCTTAGAATGGCGGGTGAGGAAGTCCGTCAATCCAGCGCCCATAAAGCCA CCCAAGTAGCAAATAACGAGGTGGCCCGGACAATTGCCGGCAAAAGTCAG CAAGACCATGTCCAAATTCCTGACCTCCTGAACCTCGCTGGGCTTCCCTC ATTGAACGAGATAGCCGCGAGGGCTGCCGTCATGGAGACCAGGAAGGCCC TCCAGAACTCCGATGGATTGAACGGGGGGCGAAACCCAATCGGAACCATT GTCCAACATTGAGGTTGGCAACGACCAAGGGAGCTGCTGCCTCAATAGCC AAATCAATGGCGAGACAAGCCTCCGTCTAGTCAAAAATTCATGTCCGACA GCCGTTTGTTTTACGTATTGTTTGTACGTCCCTTTTATTTTTTGTTTTGT TTCATTTTCCCGACTAGCAGACTTGCTAAAATCTTGACTTCCTGTTTAAT AAATTCGATTACACTCACTCCAGATCAAAGTTGCTACATCCCGGAATAAA TGTAGCCTTTTATGGATAAAACAGCTGCCAAATGTAGTTTTAATGTCGGA AAAAGCTACCAAATGCAGCTATTATGTAAGAAAATGAAACCTTGTTACCT TTTTAATCTTAGGCAGGAATTGTAAGTAGAAAAGGAAGGCACCCATAATA AGAAATGTCAAAAGGAGCAAAATAAAAAGTAAACAATGCATACAAATAGG CAAATGAAGAGTGAAAATGCAAATAAAACATGCCTAAAAATGGACTTCAA CCGTGATAATGTTCCTCTCTGAAAATGTTAACAGTTCAAAAAATAGGAAA AGGCGGAAAAGGAATAATAAACATTAGACCGAAAAATGCAAAAGAAAATA GAAAAGATTGGAAGTTGGAACATCTTTCTGAGGAAATTGCCTTGATATGT ACAGTTGTAATTTTCCTTCTCAAAATTGAAAAAATGCAAGAAAGGAAGAC CCCCTAAAAATGGTATAATATTTACCTATCTCCTTTTAACACTTGCCTCT TAGAAATGATTGGCTATGGTGGAACAACGTCTGGGCTCTGGTCCAAGCGA CCACAGAAAGGTGTGGCACGGTTTTGACTATACTATCGAAACAGTAAATC AACCTGAGTTTACTGACGGGTTTCAAAAGATGCCAATTGGGTTGGGCGTT TACCTGCGGGGATCAGGTGGTGGCAGAGAAAGTCATCAGACTGGGTGTGT AATCGAGTATTTCTTACATATTAAAATAGGTTTCTGACCGGGAGTCAACA CTTAGCCAACGAATGCTAGTCCATAGTGTTAGGGCCAATTATAAATAAAA TCGACGTTTAACTGCTCCACGTTTCTAGTGTCGATTGTTCGATGCAGAGT TGGTCCCACCTCTTGGGGTGGTCCAGTTTGCTCAACCTATCTTGATGAGC CGGTGCGTTCCACTAGTGGAGGTGCCTCAACAGGAGCAATGTGTTCATCC CTCTCATTCGCTTGGGGTGGGGCTTGGGCTCGACGGGCGTAACATATTAG ACAGAAGAAAATTATTCCGGAGCTAACGTTCCAGCGACGCCATTTGAGCA GCCATTTGGTCGTGCCCGTGCGGCCATATGGCCGATAAGACGATCTTCCA TTACCCGAATGTCTATCTGGATTAGATCTCGAGCCACCTTGTGCCAAGGG AGCGTCGTCTTCACCCATGTGGGTCGGTCTGAGGCGCTCTCGCGCTTCTA CTCCAGCATGGGGGGAAGGTCCTGTTGGTCGGTGTCCACTGGGGGAGTAT TACCCCGCCCAGGGTTCTTCTTTGGCGCCTTTTTGGGAGGCAGTCTCTGC TATTCTCGTCGTTCCTCCGAGTGAACTGATTTGATCAGAATCCAGTTATA CTAGGGGCATCCGGTCTTAATTAAGCATACGACTGCGCCATGTGGGATGA GCCTGAAGCCGAGTGGGGTGGCGTCTCGGGGAGCAGATCGTATCCGGGCG GAGAGCTATCCGCAATAACGGGACGCAAGTTAAAGACACGTTTATTTGGT TCAGTTTTATTCTAAACTGGAAACGGAAACCTCGCTCCCGTATGTCCTTT CGGTTCAGGATTGCCATATCCTTATCTAACAGGATCCTGCTACTCTCGAG TGGAGAGATCTGTGGGCCTTTCTAAAAGTTGGGTACCCTCATGTGTGACG CAACATTTTAAAGAGATCGGCCAGAGGAGGTGGGACGAGGGACCGGCCTG TAAGGCCAACAAGGCTCTCATCCCGACGTCTACAGTCCCCATCTTAAGAA CCTTCAAGCTGTCCCACCTAAATTCTAATTCCACTTTGAAAGAGTGCTTT GCAATCATTTTTCGAGCAACATTACTGATTGGGTGCCTAATTATCAAGCT TAATCTTGGGATCCTGAGTCATTGCCAGAGCTCTTGTTTGTTGAGAAAAG TCAGGATTAGCAATGGTAACTCTCACGAAAAATGTGGAACGTTCAGTCGA AATTGCCTCGAAACGATATTGAGGCCTTGTGCAAAATTACATTTAAGGGC ATGAAAAATCATTGAGAAATTAGGCGTGTCGACTATAAATGTGGAGATAA CACTGCAGAGATATCGAGAACTTCAACATGGTGAAGATCGACCTCACACA AGAGCCAGGACAATACGTACAAAGTCAGCGATCAAAATTGTGTGCAACCG CACCAGGGAAAAGCCAGACATATCAAGTGGTATTTTGGCCAAGGACATGA TGATATTAACTCCTTTGAGCAAATCCAGTGTAAAATGGTGCTTATTCCAT TATGAATGAGAAGGTCCTGCCTTGGCTGGTGAGGTTGGGTCAAAAAATAC ACCTTTCCACATTACTTAAGGCCCTGGGTATTGTCCAGAATGGTTTAAAA TCCCAGAGCATGATTCTGATTATGTTGTTAAATATTGGGGATATTTCCAG CAGTTATTCAAAATTGGTTGGAATATTCTTGTGAAACTATTCATATTTTA ACCAACTCCATGCACAAAAAAGCAATTTGGAATGAAAAACCGCAATTTTC TGTAATTGCGTGTAAAAATTCCACGTACGTACATGTGAAATTGCTCGAAA TATCGAAAATATGGAGTCTTCAATCTAAGTGTACGTACTCGTACATTGAA ATAAAATCTCGGGACCTACAGTGCAAACTTGACATGAGTCTCGCAGATCT CTTGAGTATCAATAAATCATGTCAGAATTTATTATGTCAGAATGTGGATA AAATGCAAATATATTAAGTAATACGTGTTTGGCCTGATGGTCAGAGGTCT GTTGCAAAGGGTGTGCTGCGTGTATGTTGGACGGGGACTATTAATGTTAC AAGCAAACGTGTTGCTTTTTTGAAGGGTTGGAGCCAGATTGCAATAAATC GCGTGATTCATTGAGTTAAAATCTAAGAAATGCTTCAAATATTATTTTTT ACATACAATATTTGATATTAAGGCTAAGTTCCTTTAGTTCAACCAATTTG ATTACACTTTAGCATAATAATTGCATTAAAAATCAATCTATTGTCTGGGA TTTCTCATTGATTCAGTCGGTTGAGGCTGATACACCCAAAAAGCAAAGAG TTAACAAAAAGTGAGCCTCCTTGAAAGCTAACCGGCAATGAAGTAAATTA ATCTTGAGAACGGTACCTGACAAGCAAAAATAGGTGCTTATTCTATTTTG TGTTTAGCTCTACTTGACCTAAGAAACAATGTGAATAACTCCATGTTATT TTAAGGAGAATTTGATCGAACGACAATGAAACAATCCGGGAGCAAATGGC AACACTAGTGGAGATGTAGTTTTCTGAAAGGGTATCTCTAGAGTAACAAA GGTTGCTTGGTCAAGTTAGTTCACCGTGAACTTTCCTGGCCCTGCTTGAC CGGCAGAAAGCCAAGCACACCCGAAACTGAGTTGCGGCTAGCTGAATTCG GCTCACTTTGGAGTTGTTTCTGACGAACTCAACGTGGGAGACTTTTAAGC CCAAACTGGATCTGGATAGGATTGAATGGAACTAGGGTCGATTTGTGTCT CCATAACCGAGTTGATTTTGTGATCATTGACATCCAGTGTATGATGAGAA CCGATATCAAGACACCAGTGTGAAAATCAACAACAGATTACATTGAAACA TTGATCCATGCCTTGGGATAAGGTGCAAGGATCCCAGCACCTGTCTCAAA TGCAAACATTGCTTTGCGTAATACACACTCCCGGCTTGCTTTATCACTCA GCTGCTCATAAGGAGGCAGTAGCAGGTCAGTTGTATGTTACTCTCGCTTT GGTGGCTCAAAAGTGTTGGCGGAAATCCGACCTACATTGTACATATCGAG GGATAAGGGAGCTTTGGTCACTTAAGCGACGAGATTCAACGTACACCATC ATCTTTGGAGCCTTTGCCAACTCAGCATGTTGGAGATCATAGCTCTCGTG GTGGTGGTTCTCATCCTGGCGTGGTATGTCAAGAATCGACTTCCGGCCAA TTACCCACCCACTCCACCTACCCGGCTCCCGCTCTTTGGTCATTCTCACT ACTTGCTCTTCACTCGTAACTCGGGGATTGAGGCCATCGATGAGCTGTTT CACAAGTATTCAAAGGATGGGGTCATGGCCTTTCATCTCGGGTCATTTAA GCTGGTGATCATCGGGTCCTTCGACCTTTTGAAAGAGTGCTTCAAGGCAG AAGACACCAACTTCCGACAAGCCAACAAGGAGAATCTCGCCCTGGCCATA CTCTTACGGAGGAGCAAGAATGGCAATGAGGGCATCATTGAAGGTGTGGG CAGAATTTGGACCGAGCAAAGGCGGTTCATGCTCTCGACTTTCAAAGATT TTGGTTTTGGCAAGAGCGATATGGAACGCATGATCAAAGACGAGGTGGTC TTTTTCCTGGATTACATTGAAAAATCGAATCAATCCGGGCCAATCAAGAC CATAAATATGTTCAATACGGCCGTGCTGAACATCTTGTGGCAAATGATAG CCGGTGAAAGATTTGACTATGACGACAAAGATCTGAAAAATATCTTCGAA CTCGTCACTGAGGCCATTCTGGCCGCAGGAATCAAGCCTTCAATAGCCTT TATCTTCCCTTGGTTGCGGGACATCTTTCCGAACATTGATCCCTTGTACA AAAATGTCCAAATCATGCAGAATGTCAAGGATTTCCTGGACTCTGTCGTG CAAGAGCATAGGAAGACCTTTGATCCCTACCATATCAGAGATTTCATCGA CGCTTACCTTCTGGAGATGGAGAAGACAACGGACGTGGATTCATCGTTTA GCAAAACCAATGGAGATGAAATGATTCTTCAGACCTTGATTGATCTGTTC TTTGCCGGGTCCGAGACAACCAGCTCAACCCTTTCATGTGCTGTACTTGA TCATCAATCCTGAGGTCCAAACCAAGATCCATGAGGAGATCAAAACTGTC ATCGGCCTGGAACGGACCCCGGATCTGGCCGACCGTGCCGACCTCCCGTA CTTGGATGCATCCATCCTTGAAATCCAACGCCTGGGCGACACTGTCCCAA ATGGTTTGATGCACGCCAATCCTTTTGTGGGGTTCCAATTGGGGAAGTAC TACGTTCCCCAAGGCCACACATTCCAAGGGGACTTTTCCGAAATCATGCA GGATCCTGAGTATTGGCCCAAACCGGAGGAGTTCAAGCCCGAACGTCACA TCAACGACGAAGGCAAAGTTGTGATAGACCAGCGGATCATTCCCTTCTCC ATTGGCAAGCGAAAGTGCCCGGGCGAGACTCTGGCCAAGTCCACAATCTT CTTGGTCCTGGCCTTGCTTCTCCAGCGATTTGAGATCTTCCCCATTGATC CCAATAACCCCCCACCCAATGAAGGCATATGCGGTATTACTCGGATACCC AAGCCGTTCTCCTTCAACCTCAAGCGAAGATCGTGATTTGGTACTGGAAT ATAAAATTGGCTCAACATTTGAGCCAATGCCAAAACGTATGCAAATGGCC GCTAGTTGCGAGGGTGACCAACGACTCAGCCAATACACATATTGTACAGC TTTGTGTGAGTTCACTTCAACTTGGACTTTAGTAAAAGTCCTCTGAATGT GTCTCTTGATGCTGTGAAATTTTTATTATTGCTTGGCTCTTTCGAACTAT CAATAAAACCAATCCTAATTCACTGTACATACGAGTACCTGATAAAAAGT CTATTTAGGCTTTTTCTTGTGAATAAATGAAACCGTGGGGTCTTTGTAAA AACAATAAAAAAAGTTGAGCTGCCGAAAACAAACATCTTGCAAACGTCTA GATTGTTTGTACTCTATTTTATAGAGACCAATCACTTTAGAGGGGCGGAA AGTTGGATTTCTGATTAACCCAATTGGGTATCTATTCGACTGTGCAATGT CATGTACACTAGGTCGATTCATGATGAAAAAAAACGCATTGCTCATTGGA AATTTGGCCACGAGTTCGGTCATATTGGGGCATTGCCTCATTTTCTGTGA CTGCCATTGTCGGCTCAATTCGATTTTTGAGAGGAATGCTGTCTCCTTTT TGTCATACTTCTCTCATTTTTAAAAATAGAAACCTTAGTCGTGCAGGAAT GTCGCAACGAGGTCCAGCAGGTCAGGGGCAGCCAACCGTTGTTCCACTGC ATCTTCCATATGTGGCCAACACATTGGTGGATAACGGCATTGCCATGTGG AACAAGCTCCCAGCTAGAGGTCAGCACCATGCAGATGGCTTCGAACCTGG CCAATTTTGTCTTAAAATCGGGCCCTGATTAATCCAATAAATATTTTTCC TCTGTCTCTCGAATGCCCTTTAATGTTATTTTCTGGTTCGCATTTCATGT ATTATTTTTGTATAGTTTCTGAGTTACCCTTTTGAACCCTTATTGTTACC TTTCTGTTGCATTATGGTCCTTTATTGGTGTTGTGTGTGTATTGAATAGT TCCGTTTCTATTTTGTGATGTTTTTGAACCTGTGTTGTAAGATTCGGTTT CTATTGTTTTGGTACATTTTGGTTGTGCTTAATATAAATAATTCCCTAGC ACACTGGAAACTTCTTGTTTACAAAATGCAATTGCCAGTTTCCGGGCATA ATTTACATATTAAATATACATATACGTACATGTACATATATAACATGTAT TTAACATTAGATGAAAGGTAAATACATACGATAACACACTGGGGTGCGAG TTTTTGCAAATATGTCTCATTTTGAGTACCTCAGGCGTTGCTCAGTTAAA CCATGGATTTCATGACATCAGGAGGAATCACTGAATTCGAGGTTACGTGA ATGTCCCTTTTTTGGTAAGCGCCCAAAACAACGAGACTAGAACCCTTACT TACTAGACTTGGTCATGCTGCTCATCTGGCAATATCTAAATTGGCTTCAG GATTAAACTAGCTCACAATCACCATTCCTGGCGCACCAGATGCTACGTAT ATATGGCGTTGGTAGCTGAACACAGCTCACTTTGGAGTCGTCACTGGAGT CAACGTGGATGTGGAAAAGCGGGAGACGAAAACTCAGCTGTTGTTAAGGC CAAACTGGATCTGGAAGGGATTGAACGAACTTATAGAGTGGAGTTGTGTG TCGATAACCGACTTGATTATGTGTTCTTTGACATTGAGTCCATGATGAGA ATCAATATCAAGACAGCACCAGCGTGAAATTCAAATACAAATTAAAAAAC TGATCCATGCTGGAAGGAAACCAGCAGCTGTCCTAATTGTGAGCACAGCT TTGAGTAAAACAGGCTGGCTTAGCCGTTAGCAGTGCGGCAAAAAAGGTGT TTCTTTGCCCAAACATGTCAACTTTTCAGGTGCCAAATGTGGCGTACATA GGTGATGGAAAAGGAAGAAGGTGATACCGTTATTTAAAAACCATGGAATT GCTAAAATCTCCAATCTTGGAGTTCAAAAGCTAACATTGGTGCCAAGAAA TTCTGAGTAGCTATGAGGCAGACTGAATAGACTGAAAATTCAAACGAGGA AGTGGTGTGCTCGCTCATTTCAGAGCCAATTTGGGTTCAAAGAAGGCTTG AAGCCAAAATAGTTTGGGAGCCAAACAACCGGAATCAAGCCAGCCTTGGG GTTGGCTCCCGATGTTAAAAAGGGAGCACATCAGAGAAAAAACAGGATTT CGGAAATTCGCTGAGCGTTTTCCCAAAACACCATAATGTTGTGCTTCTTC ATTTGGAGTTATTCGCCAGATCTTAGTAGCGTACAACATAGAGATACAAT GACATACGCTGTGTTTTGTTTCTTAAGATGGAGAAAGGGAAAAATGCCCT GTTCTAAAAGTGCACTGCAACCGTATTTGATTTAGTGCTAGAAAACGGCG ATACAAATGCGAAAACTTGTAATCCATGTCCGATTTCTTTCTTAAGAAAA CTTGTTTGGGTTGGTAACGCTTCTTTAGGAGTTAACCTTTTTTGTCGCGC TCAAGTCATCATGATGTTGCCTCTGAAGAGGCAACAGCAAGTCAGTTGTG ATGCACCTCACTTTGGTGGCTCAAAAGGGATAGCGGAAATCCGGCGGACA TGGAACATGTCAAGGGATAAGGAAACTTTGGTCATCTAAACTACGAAAGG CAACGTTCACCATCCCTTCTAGCTTTCGGCAACTTAGCATGTTGCAATTC ATAGCTCTGTTGTGATGGTTTTCATCCTGACTAAGGCCGCTCCAGTAGAG GTCTGGCATTTCAAACCGGTTGGAACCGGGCGGAATTTGAAGGAGCCAGT TAGTCCAAAAGCCAAAATCATCAGGCTAGCCCAGGCAGAATTGGCCCATG TTGCGCGTTATTTTTCGCATCGCAGATTCAATTGAAATGGGTTGCCTGGG CGCCACGTAGAAGCCTCGATATCCTCCTATGTCTTTTTATCAAAAAATAC GGCCCCCGACACTCAAATCAGGTCGAATTTGGACTCGGGTGAAACATCTT CTGTTTTTGGCATTGGGTGCAGGCAGTCCGTGTTGGCCCGCGCCAAGTCA GCCCGATCGGGCTAGCTTTGTTGGACCAGGGTGGTGGCTGAGCCAGAAAG AGGCCAAACCGAGCAGTCATGATTACACAACCAGAGAGAAATAACGTCAA TGTCCTAAGATTTAGGCAACGTATGGGAAATGCACGTTTTCAAACAGCTT GAAGCGCCAAATTTATCAATATAACTGTTATGGAATATATAACGCTTATA TATTAATACTCCATGGTCACCAAAATCCATCCCCTTATCTCTAGGGCTCA TCCTCTTGCACTTGCTGAAGTGCACCCAGATTCCTCAGAGTGTGATAGCT GCTCCCTGTGCAGCTCCACCCAATCCACATGAACAATGGAAAGGGCCCAA TAGGGTCCTGGCCCTGTAGGGTAGTGATGGTGTTCTCTCAGTAGTTTATT ACCAGGAGTTCAAGTGGTCAGGTAATTCCCGCAACTTATGAGGCATGTTA GTGAGCTTCAATTGCCCTTTTGAATGACCTCAATGGAGCCCGACCCTCAG TGCTCACACCTATGAATCCCTATTAGGGTCTTCTGTCATGATGAATATGC ATTATGAGAAGATTAACTGGCTGTTTATGGGGATAATTAACTCTTAGGTT TCACTTTTTCCAAATAAACATTCTATGATTGTCTATCTTCCACAGAGCGT TTCATTTGCATTAGAACGCCTAATCGGGAGGTGGCGTGAGCGGAACGCTT CCATGTATCTATAATTCCTTGGTTAAGATCACTACTTTGTGCGGCCGGCA AGGATTTATGTGTCCTTCCCGCCTGGGGCACCGAAAGTGCTGCCGCTGCT CCTTCCAGGCGTCCATTGGCAGGAGAGAAAGAGTGACTAAAGTTCAGTTT GATCCGGCGGATGAAATACCTGTGAAGTCTCGAATCAGCGTCGAAAGTCA GAGTACAAACCAAGCTGGTAAACCCTCAATCATTAGATCCGAAGTAATAG GGCTGTGGGCCGCTGACATCACAGATTTGGCGGGAAACGTATTTTCGAAA AAAATCAGCTGCATGTAGGACAGTCCCTCCAAGTCTATTGTACTGGATCA GGCAAAACCAAGGCAATGCATCATAATCTACCACGTTCCCTAGCTCTAAT GCAGTCACCTATCGATTTAATTAATATTATATGCACATTTGTTTCCTTCC TTTAAATAGAAAGCTGGGTTTCTACAGTAAGTATAGAAATCTTGCTTTCT ATTTTATATTATTATGGTTAGGTAGCTACGTCAAGACGTAGCCGACTTAG TAAAGTTAATTTTCTTCTTTGAAGAAACTACTGTTCTGAAGACTGATTTA TCTTCAAGCCAAACTCCAGTAGGGTGACCAAATTCGCACGGTTGATGCTG GGCTTTGCCTTGGGCTCGGATCATTTTTTGCCGGAGTTCGCCCAATTCCA TCAAGCCACCGGTCCGATGGGAGGAAGCCAGACACACCTCCACAAAGTTA ATTTTCGCACGAAGGAGCTGCTGATCGTAGTTTTGGCGTAGAAGTTGTAA AAAAAGGCCAGGCCATACTGTCCAAGAGTTTTGCATACCTTGGCCAATGC GTTGATGATGATTTGTTTATAAACTAAGGGGACTGATCAGCGGAGGGCCT TGTCCTGGCTAGTGGCTACCCTGATTCCATAGCGACGCTCTGCGGCATCT CCAGTGTCTCTCCGGTCAAACGTGCCACAGCCCTATATATTTCTAGGGGA ACTCATGATTTTGAAATTGACCATCTTCTCCTTAATCGGTGTTCAGACCA AGACTCATTGGCCAAACTAACCGACTTTTCCCATTCAATACTTTCAAAGA CAAATCTTAAGATATCATTTAGATGCTCGCACTCAATAACTTTTACTNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCA TCAAACCATTTGGGACAGTGTCGCCCAGGCGTTGGATTTCAAGGATGGAT GCATCCAAGTACGGGAGGTCGGCACGGTCGGCCAGATCCGGGGTCCGTTC CAGGCCGATGACAGTTTTGATCTCCTCATGGATCTTGGTTTGGACTTCAG GATTGATGATCAAGTACAGCACAGCCCATGAAAGGGTTGAGCTGGTTGTC TCGGACCCGGCAAAGAACAGATCAATCAAGGTCTGAAGAATCATTTCATC TCCATTGGTTTTGCAAAACGATGAATCCACGTCCGTTGTTTTCTCCATCT CCAGAAGGTAAGCGTCGATGAAATCTCTGATATGGTAGGGATCAAAGGTC TTCCTATGCTCTTGCACGACAGAGTCCAAGAAATCCTTGACATTCTGCAT GATCTGGGCATTTTTGTACAAGGGATCAATGTTCGGAAAGATGTCCCGCA ACCAAGGGAAGATCAGGGCAATTGAAGGCTTGATTCCCGCGGCCAGAACG GCCTCATTGACCAATCCAATGATATTTTTCAGATCTTTGTCGTCATAGTC AAATCTTTCACCGGCTATCATTTGCCACAAGATGTTTAACACGGCCGTAT TGAACATATTAATGGTCTTGATTGGCCCGGATTGGTTCGATATTTCAATG TATTCCAGGAAAAAGACAACCTCGTCTTTGATCATGTGTTCCATATCGCT CTTGCCGAAACCGAAATCTTTGAAAGTCGAGAGCATGAACCGCCTTTGCT CGGTCCAAATTCTTCCCACACCTTCAATGATGCCCTCATTGCCATTCTTG CTCCTTCTAAAAAGCTTTGAGAGGGCGACATTCTCTTTGTTGCCTTGTCG GAAGTTGGTGTCTTCAGCCTTGAAGCACTCTTTCAAAAGGTCGAAGGACC CGATGATCACCAGCTTGAAGGGCCCGAGATGAACGGCCATGACCCCATCC TTTGAATACTTGTGAAACAGCTCATCGATGGCCTCAATCCCCGAGTTACG AGTGAAGAGCAAGTAGTGAGAATGACCAAAGAGCGGGAGCCGGGTAGGTG GAGTGGGTGGATAATTGGCCGGAAGTCGAGTCTTGACGTACCACGCCAGG ATGAGAACCACCACCACCAGAGCTATTAATTCCAACATGCTGAGTTGTCG AAAGCTTCAAGGGTGATGGTGAACGTTGCCTCTTGTTGCTTACACTGTGA CAAAAAGGAAAGGCGTGTTAAAAAAACGAGCAAAATTCGACAGCCATAAA GCCCTAATACAATAAATGTTCTAACGCAGTTTTTGCATGGATGAGCCTTC AAGTTGGTCTCCTACTTGGCTCGATCAGCCTCTTCAGAGATAATATGGCC TTTTAGCGCAACTTTTGCCAAAATTGAGAAGCGAGGGAAGTAAGTAGAGA TGGGAATATAACATCACTTTGTTGTCACAGTGATGACCAAAGCCTCCAGT ATGTTGGTCGGAATTCTGCTATCACTTTTAACCCATTAAAGCGAAGAGTA ACGCAACTAGTGCTTCCAGAATCATCGCTGATTTACCTCGTGATTAGGTG ATTAGGCTTAGATGATTAGGTAAGTTAGCGATTGTTGATCATTCTTTAAA AAATTGCAATGATTTGTCGACTATCAAAACGTTGTGAAAAATGGGCTGGA GTTCACAAATCAATTAAAAAACGCTCATAAAAAGAGTATAGGGTAAATGG TGAGCCTCGAAAAAATGATGGACAATGCAAAAAAAAATAAAAACTTTGTA GGCAACCATAAAAAAATTGATGGAAAAAACCAACAGTATTGTACTGCTAT TTTCTGCTTATAGAGGGTATCTTGAAAAAATCATGAAATACCTGGAATTG GATTCATATAATATTTCTTTTTGCCAAAAAGCACAAGCAAAGGGAAAACG CTGACCCGAATAGCCTTCCAAAAAAACCCAATAAATAGGTATAACCTATA TTGAAAGATGAGGTATATCAAAAGAAGCAACAACCGAATATGGAAAAACA TCAAATATGAAAAATATCTAATAAAAACCAAAAGATCATCAAAACAGTTT ATTTTTATTTTTATATCAAAGTTGCATCAGAAATATTGATTGCCGATAAA TTCCTAAATCTTCGACGGTTAGCAAATACCTGTTAGCGAAAATGGAGGCA CTGAACCCAACTGTCTTGCTGTTGGCTCGTCAGAAACACACGATGTTAAA TTGAGTACGACAAAAAAGATTAAAAACACGTAAAAGTTTTTGAAGAAGAA AATTAGACAGGGATTCCACGTTTTCGCATTTGTATCGCCGTTGTCCAGCA TTCAAGGAGAATTTGGTTGTTAATCCTGCGAATTTCCAAAATCTTGCCTT TTTCAAACCTGATCTGAACATTGCAAAACAACCCTGGCTTAATTCCGGTC TGTTTGGCTCCCACCCTAGTTTTGATTCAACCTTTTTTGACCCCAAAATG GCTTCTAACTGAGCGAGTACTTTATAGTTTCAATGTTGACCGCCTCATAG CTACTCAGAATTTTAGGACACCAGTGTTAGCTTTGGAAACTTTAAGGCGA TTTAATGATTTTTCAAATTGTATTTTAACTTTTCCATCGCCTGTTATGCC AGTTTGTCACCAAAAATGATACATTTGACTATAAACCCCCTCTTTCTTGT CGCACTCGAACGATAAAACAAGCCTGGAGTGTATTTTACCCGATGCTACG CTTGCAATTAAGACACATGCTAGATTCGTTCTCACATGGATTAATACGTA TATGAATCAGTCCTTCAATTTCACAATGGTATTGTCCTCATCATGCACTG GATGTCAAAAATCACATAATCAAGTCTGTTATCGACGCACAAATCCACTT TGACTTCGTTCAATCCCTTCCAGATCCAGTTTGAGCTTAACTGCAACTGT GCTTTTGTCTCCTACGTTTCCACATCAGCATTGACTTCAATGACGACTCC AAAATGAGCTACGTTCAGCCACCGCATGGAAGTACTAGAATCACCTGGAG GTCGCAAATAACGAAAAATGGGAACAGGAAGCTCGAAATCTCGAAAACCG TTTATGTGCTCAATTGATGGACTGGAGGTGCGCATGCCATTTTTTAACAC TTCTGCAGGGTTTAAGAGGCCATCAACTAGCCACTCTGAAACCCAACCGA ACTTTGTGAAATGTCCCTGCAACTCCAGCTCGTCAATTGATTGCATTAAC GGCTTTCGAGCTGCCTGAACCATGCCGTCTATGGACCCATTTTTCGTTCT GTGCGACCTCCAGGTGATCCTAGTACTCCATGGCCACGGATAGCACCAGC ACAAGAACCGGATTCACCACTGAAGGAAAGGTTGCGTGAATGATATTCCA TTGAAGGGACACATTCACTGTACTAATGTGCCTGGAAGGAGAGTGTGGCC AATAGGCAGGAGAGAAAAGGCCCGGCCACTTCAGCCCATTTGAGAAGTGT TGCCAGAATCCAAGTTTGCATGTTTTATCTAGCAGATTTCCGGAATTTTA CGAATTGTTCATTTTTGCTCTGGTTTTTGTGTCGGCCCTTCATGAAGGGA GGAAGCTTATTATAGCCCAGTGTCTTACCAAGTTATGGGAAGAAAGCAAA AGTGTATTATGGTACATAAAATTGAAATCACTTAGGGACACTACAATGGA GTTGAGGTTGCTTTCAAACAGACCTGTTGATTGCGCACTCCGTGCAATGG ACCAGAGCGCAGCAACCTACCATTTTCCAACCCCCAACCTTTGTTCCTAA GGTGGTCAACCATTAGTCTGAATGTTGATTGCATCACAACATAGCTTCGT TACCTCTAGAGTTGACCAAAAATAGCAAATGAAAAAGACCCAAATTGGAC AAAAATTACAAAAAACTAGACAAACACTGCATATACAGTGGCAAAAAATA AAACTTAGTGTGCTTTACAGTGATACTTGGATATAACATACAAAATCACA ACTTTTTGTGATTTCGAGCAAGCTTGTAGGAGGATTATTTTTGCTGCATT AGCCGCAGAGGTTTCTGCACTCTTCGGCCACGGGTTGATATTGTCGCCGG AGGGGGTCTTGGGAGTGTTCAAAAGGTTGGAGCAGTGAGACGACGACCAA GTGTCTGGGGGAGGGCTGTGCCTCTAACCAACGCATTAATGACCACTAAC TCTGGCTGTCATTGCTCTGACGCACTAGAGTTCTGAGTTGTGTAAATTAC GCGATAGGTAGTTATCGATCTGATGTTTGATAACTAAACCAGTAACTTTC CAACTCTATAACAACGATCAACTCTTTACTAACAATGCTTATAACAACAC ATACTCGTATGTCCCTAACTGGCCTTTGTGAAAACATGCCTTTTGGCTTA TCTCAGGTCGCGGTGGCCATCCCATTTTTTTCTGATATGCGTCTTTTTTA CGTCACACTATCGTTACCATTTGGATACTCCCAAAGAACAATAAAACAAT CATCACAGATAGGTATATAAAATATATACATGAGAGGGGAGGAGAGGCCA AGGGAGAGTACGAGCAGCAGAGCTGTTGAGTGACCACATATCACTAGAAG ATATTTTGTCCGATTCAGATCGATTCCCGGGCCCAGTGATCAAGACATTT TCGCCACTCAAGACATTCTTGTACTGAGGGGATCTGACAACTTCCTGAAA GGTGATTTTTTTTCTAGTCAGGTTTCTTTCCAATACTCCTCAGAATTTGT TTTTTTCACTGCACGTGAGTCTATGCCCTTTACAGTCAAAATAGCATTTG CTGCAATGCCACGCTTCAGCACTTGTGATTTTCTCTTGTTGGCCGGTGAA ATGTCTAGTGAATACTATATATTCGTATGATAATGCGCGATGGCCCAATA ACTAGAGGTAGAGGTAAATATACCAGTGTATTTAATGACAGAGCACGAGG AGGCAGGGTGACTAGAGAATACATCACAGTATGACTCAGTCATCACTAGG GCTGTAAAAAGCTGGAAAAAACTTTTTGCTGCTTTTTTTCGCTTTTTTGA TGGAAATAATCTTAAATGCTGGAAATAGCCTTAAATGCTGGAAATGATGT GAAATGCTGGAAATAAGTTTTTTTCTGGAAATTTTGGATGATTTCAGTAA ATGACTGACTTAAGATGCTTCAAAATTGGCAAAAAACTTTGATTTCAGTA AATGACTGTCTTAAAATGCTTCAAAATTGACAAAAAACTTAAAATTAGTT GGCGAAGAAAATGGATTCAGGTGAGATTTAATAAAAATTCAGCAGGACTT TTTTGCATAGTTTTACGAAGGTCATCCGGTTCCCACGCTTCTAAAAGTGA CCAAGACCAGGGAGTGCATGTTTTCATTATTTCTTATAATTTGGAGAGAA AACGTACCATTAGTCAAAATTCCACAATTTGTCGAAAATTGTCACTTCCT GAAAATTATGTTTATTCCCATCAGATTCTATGGTTTTTATCACTTGCCTT CAAATATCAATGATTGATATTTTCACACGTAACCGATAATTCGACACGCA GCATCAAGTAAGCAATGAAGATGAACTCAAAGCTGAAGCTAAATATTTTT CGACAAATAGTTAAGTTGTGACTAATGGTACGTTTTCTCACCAAAATATA TATATAAAAAATCGCTAGTTTTGGTCTAATTTAGAAGTGTTGGAACAGGA GTAGCATTAAAGCCAGCTAATAGGTTTTCTTTTTGTTTCGTGGAGCATTG AGTCATTTTGTTATATTAAAAATTCTTCCAATTTTGTCGATTGCATTACA TCTGACAACATTAACAGTATTTGAATCTGCAAATTGATATTTAAATTCGT ACGAAATATAATGAACATTTTTCTTAAACACATGTTTGTGGCAACTTTAT CTGACTTCCTTTGGTACCAAATGGGAAAATGTCCTCTATTGTGGCTTTTT ATCACTTTGAAGCCAATTTTTTGTTGTTTTAGCGATTTGCTTTTCCAATT TTTCAGGTTTTTTTCGCTGTAATTTTGCTTATTTCACTCTTATTTCCTGG TTTTATTTGCTGTAAACGACACTTTTTCTGCTGTTTAAGCGCTTTTTTAC AGCCCTAGTCATCACAGTATCAAATAACGTATGACTATGGATCTTATTTG AATTTTGGGTGCAAAAGCTTTGAAGGCCATGTTGAAGATGAACGAATTTG ATCCTACATTACTGGTTGATAGAAATTGATTTCCGTCACAATCAGGCATG GGCTGTCTGCGTCTCTTTGTAAAGTGAAACGTGTCCCTCCATTGGAAAAT AATTTACGCAACCTTTCCTTCAGTAGTGAATCCGGTTCTTGTGCTGGTCT ACGGAACCCTGTACATCTACGTAGAAGTTTGTTTGTTTGGAAGGCCCTAG GAATGATCAGTATAGTGCAATCACTTCCCAGTTAGAAATCTCCGAAGAGA CATATTCGACCTTAAGACTTTCTGAAAATTGTATTCTAATCCTTGGACCG AGTTCAAGATAGACTTGGTTTGACCCAGTAGGGACAAGACTACCTTAGGG TTCCTGTCCAGGGATATATTGGTGCCGTCGTGAATGATAGCCCACAGATG GTAGGTGGCAGGGCAAACTGTCGCTAGATGACAGGGTGATTCCTCCGTAT TACCGCATAAGCGACAACTTTGGCCAGCCACTTGCCCTGATTTGACTGCG TTAAAGTAGTTCAGGTCACAATGACCAGTGATCCAAGGGATCAGCTGGCC CAGACCCTTCCTACTTAGGTCCAGTATATGCTTGGAAAAATATTGATCTG GATTGCGGATCCAGTACTTAGTCTGGCGGAAGCCGACACTATTGCTCCGT TGAACACTCCATTGAACGCCCCATTTGTGGAAAGTAAAATCCTTAATGGC TGATTTGGTAAAGCTAAATGGTGTGGGAACAAATGGCTTGGGCCTTGAGT TCGCACCAGCTTACTACTACATGCCAAAGATGATGCTTGGACGAGTTTGG GGTGTAAGCGAGAGGACCCGAGAATAACCCTAACCCGTGAAGATGTCTCT GCTAAAAGATTTAGTTTCTCATAACAATTCAGTGTGATTGAAGATGAAGC CGTCTTTCGCTGTAAAGCTAAGAGTGCCGTTTTCCTGCTCACAATAATAT CAACATCCCCGGCACATTTGGACAATAAGCTTTCGGCGATTTTGCCAGTA GCTATAAGGTCCCACTGCCCTGGAGTGGTGAACTGCCCTAAGAAACCAGC TTCGTCTTGGAAGGATCTGTGGCTGTTCGAGATGACAATGGCTGCCACCG TTCTTCCATTTGTGACAACTCCCCCCACAAAACCTACCACGGTGCTATTA TGGGGTTTAATGATGTTGTCAGTTTCTATTACCTTAAATTGCGGTAATAG CCAAGAGGTTGGAATATAATCGGTAGGGATCCCACAGCTAGGTAGTGTCC TGACCTCATCTTTCCAGTAGCGAAGATGACCTTTCCCACTAATACCCAGC CCATCCCATCTTGTGGGCAATGTGCTCTGGATACGGATATAAGTGGTGGT ACTTATCGTGTGTTGCAGGAGGTCGTATGGCTCCATGCCCAACAGGAGTT CCAAACCTTCTGTGGGTGTGCTTCGTTGGAAGCCCACCACTGTTTGAGCT GCGAGCCTGTTCAGTCTCCTCAGCCTTACTTTGTGTCGCGCCTTCAGATG GTGAGCCCAGAGGTGCGCTGCGTAGGTTAGCCCAGTTCAAACAATCCCGG TGTAGGCCCAGCGGGAGAGTTTGGGCATAGGGCCCCACGTCCTTCCGATG CTGTTGGAGACCTGGAAGAGTAGAGCCAAGGCCTTGTTGATTTTGTGATC AATATGTTGCGTCGACGATAACTTCTCATCGAGAATAACACCGAGGTATT TCGTAGACTTTTCATATTTGATCAATTGGGCACCCATTTTTAATCTTGGA GGGAGTAATGGTTTAAGCTTCTTGTGGAACCAAACCGCAATGGTCTTCTT TGGGTGAAAGTTGAGGCCATTTTTTAGTCCCCATTCCAAGGCTATTTTAA TTTTGCCTTGGGCAATCTGACCCAGTTGTCCGGGGTCATGGCCTGTGAAA ATTACTGCATCGTCTGCCAATCCCGTAACTTTTGCCCCGCCACCATTCAA CTTCCTCACTAGGGTATCAAACACCATGTTCCAGGCCAGAGGGGAGATTA TGCCCCCTTGGGGAATTCCTCTTGTAAGAGATTTTGTGGGGAATTCCTCT TGTAAGAGATTTTGTCACCTTCACGCCTTGAAATTCGACCTCAACAGTAC GATTTCGAAGGTAGTTACCATACCACCTGGATATGTTTATGGCAACCCCA TGATTCCCCTCCATAGCCTCGGCCACTTTCGTTGGGTCCATATTGTCGGA GGCTCCTTGGATGTCTAAGAAGATCCGCAGCGCATACTTCTTGTTCAGAG TTGCGTGTTCAATCCCGTCCACCGTCACTGAAAGTGCGGAGTTTGCCTTT CGCACTATTTGGAAGTATTACTCACGATTGTACTTTGCCAGACTTAGGGC CAAACTCAAAAGCGACCCAATTTTTAGAATCGAAATCCAGCATTAAACAG CTGTAACTGGTCTAACTTTCCAATAACGAAAATGAATGTCAGATAATGTT GCTGACTCTGGGAAGCTCTCAGAGATGTCAGGCTGGCCATGTTCAGCCTC TTAATGCTGCATTAGTCGTGATTATCTACATTTGTTACCAATTCTGTGCT GAATAAATATACATTTCCGATTTGAAAATCTGGTCACTTTGACGTTGGCC CTAAGCCTCGACGCATAATTCTTCTGTGTACAGGGTTCCATGCATAAGCA TATTCAAGGCGTGCCCGTGCGTATGTCGGGAAAAAGAGGGCCATTGAAGC GCGCCGGTCATGTGTTAGCCTTGCACCTAATATTTACAATCATGATAGTG AGATTCTGTTAAGGTTATCTCTGCATTTTTTCAATTTAGTGCAGCACTGA TATCCGGTGTTTAGCGAAACGACGTTTGATATCTGAAATGCAGGTAAGCA GCTGCAGTACATTTTTTTCAAAAAGTCGCCTAGGCATCAAATCTGGCAAG TGTAATTCTGTGTGCAAGATTCCATGGCTGGTGCTATCTGTTGTTGAACG CAGATTTTGGAAAAGTAGGGTACTAAAGCCCAGTTGTTGTTAAGTCCAAA CTGGATCTGGAAGGGATTGAACGAAGTCAGAGTGGATTTGTGCGTCGATA ACAGACTTGATTATGTGATCTTTGACATCCAGTGCATGATGAGGACAACA CCATTGTGAAATTCAAGGACTGATTCATATACTAATCCATGTGAGAAGGA ATCTAGCATGTGTCTGAATTGCAAACGTAGCTTTGGGTAAAATACACTCC AGGCTTGTTTTATCGTGTGCGGCAAAAAAGAGGGTTTATATGGCCAAATG TGTCATTTTTGGTGACAAACTGGCATTACAGGCGATGGAAAAGTGAAAAT ATGATTTGAAAAAATCACGATGTCCCCTAAAATCTGCAATTTTAAGAAAG ATTCCAAGGCCAACACAGGTGTCCTAAAATTGTGAGTAGCTATGAGGCGG TAATTTGAAAATTGAAACGATAAAGTGCTGGCTCAGTTGGAAGCCAAATT GGGGTCAAAAGGTTGAAACAAAAGTAGTTTGGGAGCCAAACAAACCGGAA TTCAGCCAAGGATGTTTCGCACTGTTTAGATCAGCAGATGAGGTTTAAAA AAGGCAAGATGTCTGAAATTCGCAGGATTAGCAACCAAATTATCCTTGAA TGATGGACAATGGCGATTCACGTTTGAAAACGTGGAATCCCCGTCAAATT TCCTTCTTCACAAACTTTTTCGTGTTGAAATCGTTTCTTTAGGAGTTTTT AACTTTTTTTGTCGCACTCAATTTATCACCGTGTTGCTTCTGACGAGACA GCAGCAAGTCAGTTGTGTTTATTGCTCCCATTATCGCTAATCGGTATTCA ATAATTATCGAAGATTTAGGAATTTATCAATATTCGATAATTTTGTTGCA ACTTTCGATAATTTCGAGATTACGTGATTGATCTAAAAAAATTAAAACAC TTTATTGACGATCTCTCAGTTTTCATTACATATTTTTTAAATTTTTATGT TTTTCCATTTTCAGTTTTTGCTTCTTGAGATATATCTTATCTTACTGTAT AGGTTACACATATTATATTTGGGGGGTTTGGAAGGCTATTTGCGTCAACG TTTTCTCTTCCCTTGTGCTTTTTGACAAACAGAAATATTATCAATCCAAT CCTAGGAATTTGATGAATTTTTCAAGATAGCCTCTGTAAGTAGATAATAG TAGTAAAATATTGTAAAGATTTTTCACCTTTTTGTAACTTTTTCATGGTT GCTTTCAAAGTTCTATTTATTTTTGCATTTTTCATCATTCTCCGAGGCCT TTTTTTTATTTTTTGAGGTCTCCCATATAGTGAATACTTTTCTTATGAAC GTTTTTTTAATTGATTTGTGAACACCAGCCCATTGTTCACAAATCTTTCA ATGGTCGACAAATCATTGCATTTTTTTTAAGAATGGTCAACAATCGATAA TTTTAATCAGCGATGATTTTGGAAGCACTAGTTGTGTTACTCTTCGCTTT TATGGCTGAAAAGTGATAGCGGAATTCCGACCAACATACTTGAGGCGTTG GTCATCACTCTGACAACAAAGGGATGTTATACAGTATTCCTATATCTACT TACTTCTCTCAATTTTGGCAAAAGTTGCCCAAAAAGGCCATATTGTCTCC GAAGAGGCTGATCAAGCCAATTTGGAGACCAACTTGAAGGCTCATCCATG CAAAAACTACGCTAGAACATTTATAAACAATGAGATGGCTGCCCCTCAAC CGGGTATCGGTGGTGTGTCGTCCATTCCGGCCACCACCACGCCCCAACCG TCGCCCTCTCCGTCCGCCATGAACCTGAGANNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNTTTTCTGGTCGCAAGCTTTTTGTAGTTATCATCTT TTTTAGTTCATCGATGAGCAGTGTATTAGTGTGTTCACGTACTAATTACT GCTATTTGTCCTATTCAACCTATTTTGTGATGTTTGTACTATTTATATTT CGCCAAACATTGTGAGCGATCTTTCATTTCGATCGTATTTTATAAGTAGA CATATCTTAATTATCTTTGTGCTTTCTTGGCACTCAGTTTTTGAGCAAAT TTGCTTCTTCTTGCTTTAAACTGTGATTTTATGTTGTGCTATTTGAAAAG TGGTCCTGTATTTGTTTGAAATTTTATTGTATTCTGCCCTCCCTCCTCCG CTGCCGTGTCTTTGTGTAAAATTTTGTGTTCTCTCCTAGGATCACAGTGA AAACGATAAAAAGAGAAAAAGATAAGTCGAAAGACTTATCTGTGACCCTC GGTGCATCCCATAATTTCTTTTTGCATATGATGAATCTGGGATCTCCGAA ATAAACTAAACTAAACTTGTCATCTAATAAGGGTCTTTGTGGGTGTGATG TCCTGGTGTGGTCACCCCCAATGCTCGTGTCTAGTCATGTCTTCATGCTC CCGTCAGTGATATCACTGACGGGCAGGGACTATATATATCGTGTCCCTCT GGGTATAAAGCATCCAGGCTAGTCACATCGATCTTAGTGACAGACGTCAC AGTGGGATGATGAATTCTATAGTATGAATTAAGTTTCCCCACCTTGTAGG TAGGTAAAAGGCCATGCATTGTCAGGGTCAGCAGAAATAAGAAATGAGTC GACGGATTCCAGACAATGGACTTTGCAATAACCTAACAACCAACATACTG ACCTGCTAGTTAATGAATCAGTTGCCAGATGTTATACGGCCAGAGAGCGG AAAAAAAGGAATTCAATATTATTTTTGTTTTGTGTTTTGCCAATTGTGGT TAAAATCTACGTATTATGCCTTTTTGTCCCATATTTGGTCAAAAAAATGG CATTTACTTCCTGCAGAAAGTTCGATTGTATGTTTGCAGAAAATAATTGT TGCAAGGAAATAACAGAAACAATGGGCTCCTTGAAAACACGTACGTCTCA AGGATCTGTTCCGGTTTTTTTGAGCTCCACTCCACTCACTCCGCCCCGGA GCGGTTTTCGGAGCGAACAGAGCTCGAGCGTAACTTTCCGAGATTGGCCA ACTTCATGAAATTTGAGGTATTTGTTCCTCTATTAGTGTTTTATGTCCAT CTCGGCCGAAAAAAGACTGCATCCTATGTAGACTGTGTGTAATCGGTTTG ATTATTTACAAAATTTAAAGACGACACATTAGCAAGTCTGCTAGTCGTGA CAGGTGGGTAAAAAATTGGCGAATGACTAGATGAGTGCTGCTTTAGCGAT TGTCTTGGCTATTGCAGCCGCAGGTCCCCTCGTGGTTGCTCCCCTCAGCG CTGGGAGCACATTCCACATCCTGGCCGCATGGGTCGCTAACTTGTTGACA GGCTTGCGAAGTGGAGGCAAGACAACCCCCGCTGCTTGGGACCTGGTGGT CGCTGGCGCGGATAAGCCAGCGTCTGGGTGGCAGGGAACACGACTTGGCC GATCGGGTTTCTGCCACCATCCTTCCGGTCGGAGCTGAAGAAGGCCTTCC AAGTCTCGATGACCATGGCCTTGACGGCCAACTCGTTCAAGGAGGGGAGC CGGGCCAAGTGA
back to top
Synonyms
The feature 'cytochrome p450 partial' has the following synonyms
Synonym
Tk02241
Add to Basket