snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1, snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1 (mRNA) Tigriopus kingsejongensis

Overview
Namesnap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1
Unique Namesnap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1
TypemRNA
OrganismTigriopus kingsejongensis (Tigriopus kingsejongensis)
Associated RNAi Experiments

Nothing found

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold133_size323035supercontigscaffold133_size323035:131220..159481 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
maker2018-02-12 .496401
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
cytochrome p450 partialsnap_masked-scaffold133_size323035-processed-gene-1.7Tigriopus kingsejongensisgene


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:exon:224snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:exon:224Tigriopus kingsejongensisexon
snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:exon:225snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:exon:225Tigriopus kingsejongensisexon
snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:exon:226snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:exon:226Tigriopus kingsejongensisexon
snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:exon:227snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:exon:227Tigriopus kingsejongensisexon
snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:exon:228snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:exon:228Tigriopus kingsejongensisexon
snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:exon:229snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:exon:229Tigriopus kingsejongensisexon
snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:cdssnap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:cdsTigriopus kingsejongensisexon
snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:cdssnap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:cds-1999808Tigriopus kingsejongensisexon
snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:cdssnap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:cds-1999809Tigriopus kingsejongensisexon
snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:cdssnap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:cds-1999810Tigriopus kingsejongensisexon
snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:cdssnap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:cds-1999811Tigriopus kingsejongensisexon
snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:cdssnap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1:cds-1999812Tigriopus kingsejongensisexon


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
polypeptide-auto1999813auto1999813Tigriopus kingsejongensispolypeptide
Tk02241Tk02241Tigriopus kingsejongensispolypeptide


Sequences
The following sequences are available for this feature:

protein sequence of Tk02241

>Tk02241 ID=Tk02241|Name=Tk02241|organism=Tigriopus kingsejongensis|type=polypeptide|length=688bp
MSSDLNVSFEHIIKLQLTHLILGITLFFGILHGMLEIIALVVVVLILAWY
VKNRLPANYPPTPPTRLPLFGHSHYLLFTRNSGIEAIDELFHKYSKDGVM
AFHLGSFKLVIIGSFDLLKECFKAEDTNFRQANKENLALAILLRRSKNGN
EGIIEGVGRIWTEQRRFMLSTFKDFGFGKSDMERMIKDEVVFFLDYIEKS
NQSGPIKTINMFNTAVLNILWQMIAGERFDYDDKDLKNIFELVTEAILAA
GIKPSIAFIFPWLRDIFPNIDPLYKNVQIMQNVKDFLDSVVQEHRKTFDP
YHIRDFIDAYLLEMEKTTDVDSSFSKTNGDEMILQTLIDLFFAGQPAQPF
HVLYLIINPEVQTKIHEEIKTVIGLERTPDLADRADLPYLDASILEIQRL
GDTVPNGLMHANPFVGFQLGKYYVPQGHTFQGDFSEIMQDPEYWPKPEEF
KPERHINDEGKVVIDQRIIPFSIGKRKCPGETLAKSTIFLVLALLLQRFE
IFPIDPNNPPPNEGICGITRIPKPFSFNLKRRSSIPGPSDQDIFATQDIL
VLRGSDNFLKVAKMTFPTNTQPIPSCGQCALDTDISGGTYRVLQEVVWLH
AQQEFQTFCGCASLEAHHCLSCEPVQSPQPYFVSRLQMVSPEVRCVGNTT
WPIGFLPPSFRSELKKAFQVSMTMALTANSFKEGSRAK
back to top

mRNA from alignment at scaffold133_size323035:131220..159481-

Legend: polypeptideexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1 ID=snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1|Name=snap_masked-scaffold133_size323035-processed-gene-1.7-mRNA-1|organism=Tigriopus kingsejongensis|type=mRNA|length=28262bp|location=Sequence derived from alignment at scaffold133_size323035:131220..159481- (Tigriopus kingsejongensis)
ATGTCCTCAGATTTGAATGTCTCATTTGAGCATATCATTAAACTTCAGTT GACACACCTGATCCTCGGCATCACGCTGTTCTTTGGGATCCTCCACGGGT GAGCGGCTTAAAGCGTCAGCGATGTCAGCGATTGGAAAGAGCATTAGCTC TTTCCCCTTCTTCCACTCCAAGGTAAACACGAACGGGCTCAATTTTTCTT TGATGCGTTGGAGCCTTGGATTGTCACTGGCATCCAAAAAAATCCATTCA CAATTGGGAGCAGAGGCTTATGGTCTGTCACGACGGTGAAATGAGGCATT CCAAGGAGGTAAATGCGACACTGGTTCATGGTTCCATCTACCACGACGCC ATGTTATATCTCCATGAACGTTTATTCTCAGACTCCCGAACGTACGCAGG ACAAGCAGGAGCATGAAACGCATAAGAGCATGGTATCGGAAGAGCATCGC AATAACATTCATATCCAACAGGTGTTATAGTGACTTAACTACTTGACTAC TGACTACTTGACTTGACTACTGGTGTTATATTGACTCAGCTCATGGTAGG AGGGAACATCAAGGCCAAGGATCGAAACGCTATTGCAATTGAAGTTGGTG GCGTTTTGGCTCGCCATCTGCCCCGAGGGGAGTACCTTCGTCAACTGGCC TCGGGCCTAATCATAAGCAAGGTTAGTTACGTTGCAGCAGCCGTTGTTGC CCTTAGAATGGCGGGTGAGGAAGTCCGTCAATCCAGCGCCCATAAAGCCA CCCAAGTAGCAAATAACGAGGTGGCCCGGACAATTGCCGGCAAAAGTCAG CAAGACCATGTCCAAATTCCTGACCTCCTGAACCTCGCTGGGCTTCCCTC ATTGAACGAGATAGCCGCGAGGGCTGCCGTCATGGAGACCAGGAAGGCCC TCCAGAACTCCGATGGATTGAACGGGGGGCGAAACCCAATCGGAACCATT GTCCAACATTGAGGTTGGCAACGACCAAGGGAGCTGCTGCCTCAATAGCC AAATCAATGGCGAGACAAGCCTCCGTCTAGTCAAAAATTCATGTCCGACA GCCGTTTGTTTTACGTATTGTTTGTACGTCCCTTTTATTTTTTGTTTTGT TTCATTTTCCCGACTAGCAGACTTGCTAAAATCTTGACTTCCTGTTTAAT AAATTCGATTACACTCACTCCAGATCAAAGTTGCTACATCCCGGAATAAA TGTAGCCTTTTATGGATAAAACAGCTGCCAAATGTAGTTTTAATGTCGGA AAAAGCTACCAAATGCAGCTATTATGTAAGAAAATGAAACCTTGTTACCT TTTTAATCTTAGGCAGGAATTGTAAGTAGAAAAGGAAGGCACCCATAATA AGAAATGTCAAAAGGAGCAAAATAAAAAGTAAACAATGCATACAAATAGG CAAATGAAGAGTGAAAATGCAAATAAAACATGCCTAAAAATGGACTTCAA CCGTGATAATGTTCCTCTCTGAAAATGTTAACAGTTCAAAAAATAGGAAA AGGCGGAAAAGGAATAATAAACATTAGACCGAAAAATGCAAAAGAAAATA GAAAAGATTGGAAGTTGGAACATCTTTCTGAGGAAATTGCCTTGATATGT ACAGTTGTAATTTTCCTTCTCAAAATTGAAAAAATGCAAGAAAGGAAGAC CCCCTAAAAATGGTATAATATTTACCTATCTCCTTTTAACACTTGCCTCT TAGAAATGATTGGCTATGGTGGAACAACGTCTGGGCTCTGGTCCAAGCGA CCACAGAAAGGTGTGGCACGGTTTTGACTATACTATCGAAACAGTAAATC AACCTGAGTTTACTGACGGGTTTCAAAAGATGCCAATTGGGTTGGGCGTT TACCTGCGGGGATCAGGTGGTGGCAGAGAAAGTCATCAGACTGGGTGTGT AATCGAGTATTTCTTACATATTAAAATAGGTTTCTGACCGGGAGTCAACA CTTAGCCAACGAATGCTAGTCCATAGTGTTAGGGCCAATTATAAATAAAA TCGACGTTTAACTGCTCCACGTTTCTAGTGTCGATTGTTCGATGCAGAGT TGGTCCCACCTCTTGGGGTGGTCCAGTTTGCTCAACCTATCTTGATGAGC CGGTGCGTTCCACTAGTGGAGGTGCCTCAACAGGAGCAATGTGTTCATCC CTCTCATTCGCTTGGGGTGGGGCTTGGGCTCGACGGGCGTAACATATTAG ACAGAAGAAAATTATTCCGGAGCTAACGTTCCAGCGACGCCATTTGAGCA GCCATTTGGTCGTGCCCGTGCGGCCATATGGCCGATAAGACGATCTTCCA TTACCCGAATGTCTATCTGGATTAGATCTCGAGCCACCTTGTGCCAAGGG AGCGTCGTCTTCACCCATGTGGGTCGGTCTGAGGCGCTCTCGCGCTTCTA CTCCAGCATGGGGGGAAGGTCCTGTTGGTCGGTGTCCACTGGGGGAGTAT TACCCCGCCCAGGGTTCTTCTTTGGCGCCTTTTTGGGAGGCAGTCTCTGC TATTCTCGTCGTTCCTCCGAGTGAACTGATTTGATCAGAATCCAGTTATA CTAGGGGCATCCGGTCTTAATTAAGCATACGACTGCGCCATGTGGGATGA GCCTGAAGCCGAGTGGGGTGGCGTCTCGGGGAGCAGATCGTATCCGGGCG GAGAGCTATCCGCAATAACGGGACGCAAGTTAAAGACACGTTTATTTGGT TCAGTTTTATTCTAAACTGGAAACGGAAACCTCGCTCCCGTATGTCCTTT CGGTTCAGGATTGCCATATCCTTATCTAACAGGATCCTGCTACTCTCGAG TGGAGAGATCTGTGGGCCTTTCTAAAAGTTGGGTACCCTCATGTGTGACG CAACATTTTAAAGAGATCGGCCAGAGGAGGTGGGACGAGGGACCGGCCTG TAAGGCCAACAAGGCTCTCATCCCGACGTCTACAGTCCCCATCTTAAGAA CCTTCAAGCTGTCCCACCTAAATTCTAATTCCACTTTGAAAGAGTGCTTT GCAATCATTTTTCGAGCAACATTACTGATTGGGTGCCTAATTATCAAGCT TAATCTTGGGATCCTGAGTCATTGCCAGAGCTCTTGTTTGTTGAGAAAAG TCAGGATTAGCAATGGTAACTCTCACGAAAAATGTGGAACGTTCAGTCGA AATTGCCTCGAAACGATATTGAGGCCTTGTGCAAAATTACATTTAAGGGC ATGAAAAATCATTGAGAAATTAGGCGTGTCGACTATAAATGTGGAGATAA CACTGCAGAGATATCGAGAACTTCAACATGGTGAAGATCGACCTCACACA AGAGCCAGGACAATACGTACAAAGTCAGCGATCAAAATTGTGTGCAACCG CACCAGGGAAAAGCCAGACATATCAAGTGGTATTTTGGCCAAGGACATGA TGATATTAACTCCTTTGAGCAAATCCAGTGTAAAATGGTGCTTATTCCAT TATGAATGAGAAGGTCCTGCCTTGGCTGGTGAGGTTGGGTCAAAAAATAC ACCTTTCCACATTACTTAAGGCCCTGGGTATTGTCCAGAATGGTTTAAAA TCCCAGAGCATGATTCTGATTATGTTGTTAAATATTGGGGATATTTCCAG CAGTTATTCAAAATTGGTTGGAATATTCTTGTGAAACTATTCATATTTTA ACCAACTCCATGCACAAAAAAGCAATTTGGAATGAAAAACCGCAATTTTC TGTAATTGCGTGTAAAAATTCCACGTACGTACATGTGAAATTGCTCGAAA TATCGAAAATATGGAGTCTTCAATCTAAGTGTACGTACTCGTACATTGAA ATAAAATCTCGGGACCTACAGTGCAAACTTGACATGAGTCTCGCAGATCT CTTGAGTATCAATAAATCATGTCAGAATTTATTATGTCAGAATGTGGATA AAATGCAAATATATTAAGTAATACGTGTTTGGCCTGATGGTCAGAGGTCT GTTGCAAAGGGTGTGCTGCGTGTATGTTGGACGGGGACTATTAATGTTAC AAGCAAACGTGTTGCTTTTTTGAAGGGTTGGAGCCAGATTGCAATAAATC GCGTGATTCATTGAGTTAAAATCTAAGAAATGCTTCAAATATTATTTTTT ACATACAATATTTGATATTAAGGCTAAGTTCCTTTAGTTCAACCAATTTG ATTACACTTTAGCATAATAATTGCATTAAAAATCAATCTATTGTCTGGGA TTTCTCATTGATTCAGTCGGTTGAGGCTGATACACCCAAAAAGCAAAGAG TTAACAAAAAGTGAGCCTCCTTGAAAGCTAACCGGCAATGAAGTAAATTA ATCTTGAGAACGGTACCTGACAAGCAAAAATAGGTGCTTATTCTATTTTG TGTTTAGCTCTACTTGACCTAAGAAACAATGTGAATAACTCCATGTTATT TTAAGGAGAATTTGATCGAACGACAATGAAACAATCCGGGAGCAAATGGC AACACTAGTGGAGATGTAGTTTTCTGAAAGGGTATCTCTAGAGTAACAAA GGTTGCTTGGTCAAGTTAGTTCACCGTGAACTTTCCTGGCCCTGCTTGAC CGGCAGAAAGCCAAGCACACCCGAAACTGAGTTGCGGCTAGCTGAATTCG GCTCACTTTGGAGTTGTTTCTGACGAACTCAACGTGGGAGACTTTTAAGC CCAAACTGGATCTGGATAGGATTGAATGGAACTAGGGTCGATTTGTGTCT CCATAACCGAGTTGATTTTGTGATCATTGACATCCAGTGTATGATGAGAA CCGATATCAAGACACCAGTGTGAAAATCAACAACAGATTACATTGAAACA TTGATCCATGCCTTGGGATAAGGTGCAAGGATCCCAGCACCTGTCTCAAA TGCAAACATTGCTTTGCGTAATACACACTCCCGGCTTGCTTTATCACTCA GCTGCTCATAAGGAGGCAGTAGCAGGTCAGTTGTATGTTACTCTCGCTTT GGTGGCTCAAAAGTGTTGGCGGAAATCCGACCTACATTGTACATATCGAG GGATAAGGGAGCTTTGGTCACTTAAGCGACGAGATTCAACGTACACCATC ATCTTTGGAGCCTTTGCCAACTCAGCATGTTGGAGATCATAGCTCTCGTG GTGGTGGTTCTCATCCTGGCGTGGTATGTCAAGAATCGACTTCCGGCCAA TTACCCACCCACTCCACCTACCCGGCTCCCGCTCTTTGGTCATTCTCACT ACTTGCTCTTCACTCGTAACTCGGGGATTGAGGCCATCGATGAGCTGTTT CACAAGTATTCAAAGGATGGGGTCATGGCCTTTCATCTCGGGTCATTTAA GCTGGTGATCATCGGGTCCTTCGACCTTTTGAAAGAGTGCTTCAAGGCAG AAGACACCAACTTCCGACAAGCCAACAAGGAGAATCTCGCCCTGGCCATA CTCTTACGGAGGAGCAAGAATGGCAATGAGGGCATCATTGAAGGTGTGGG CAGAATTTGGACCGAGCAAAGGCGGTTCATGCTCTCGACTTTCAAAGATT TTGGTTTTGGCAAGAGCGATATGGAACGCATGATCAAAGACGAGGTGGTC TTTTTCCTGGATTACATTGAAAAATCGAATCAATCCGGGCCAATCAAGAC CATAAATATGTTCAATACGGCCGTGCTGAACATCTTGTGGCAAATGATAG CCGGTGAAAGATTTGACTATGACGACAAAGATCTGAAAAATATCTTCGAA CTCGTCACTGAGGCCATTCTGGCCGCAGGAATCAAGCCTTCAATAGCCTT TATCTTCCCTTGGTTGCGGGACATCTTTCCGAACATTGATCCCTTGTACA AAAATGTCCAAATCATGCAGAATGTCAAGGATTTCCTGGACTCTGTCGTG CAAGAGCATAGGAAGACCTTTGATCCCTACCATATCAGAGATTTCATCGA CGCTTACCTTCTGGAGATGGAGAAGACAACGGACGTGGATTCATCGTTTA GCAAAACCAATGGAGATGAAATGATTCTTCAGACCTTGATTGATCTGTTC TTTGCCGGGTCCGAGACAACCAGCTCAACCCTTTCATGTGCTGTACTTGA TCATCAATCCTGAGGTCCAAACCAAGATCCATGAGGAGATCAAAACTGTC ATCGGCCTGGAACGGACCCCGGATCTGGCCGACCGTGCCGACCTCCCGTA CTTGGATGCATCCATCCTTGAAATCCAACGCCTGGGCGACACTGTCCCAA ATGGTTTGATGCACGCCAATCCTTTTGTGGGGTTCCAATTGGGGAAGTAC TACGTTCCCCAAGGCCACACATTCCAAGGGGACTTTTCCGAAATCATGCA GGATCCTGAGTATTGGCCCAAACCGGAGGAGTTCAAGCCCGAACGTCACA TCAACGACGAAGGCAAAGTTGTGATAGACCAGCGGATCATTCCCTTCTCC ATTGGCAAGCGAAAGTGCCCGGGCGAGACTCTGGCCAAGTCCACAATCTT CTTGGTCCTGGCCTTGCTTCTCCAGCGATTTGAGATCTTCCCCATTGATC CCAATAACCCCCCACCCAATGAAGGCATATGCGGTATTACTCGGATACCC AAGCCGTTCTCCTTCAACCTCAAGCGAAGATCGTGATTTGGTACTGGAAT ATAAAATTGGCTCAACATTTGAGCCAATGCCAAAACGTATGCAAATGGCC GCTAGTTGCGAGGGTGACCAACGACTCAGCCAATACACATATTGTACAGC TTTGTGTGAGTTCACTTCAACTTGGACTTTAGTAAAAGTCCTCTGAATGT GTCTCTTGATGCTGTGAAATTTTTATTATTGCTTGGCTCTTTCGAACTAT CAATAAAACCAATCCTAATTCACTGTACATACGAGTACCTGATAAAAAGT CTATTTAGGCTTTTTCTTGTGAATAAATGAAACCGTGGGGTCTTTGTAAA AACAATAAAAAAAGTTGAGCTGCCGAAAACAAACATCTTGCAAACGTCTA GATTGTTTGTACTCTATTTTATAGAGACCAATCACTTTAGAGGGGCGGAA AGTTGGATTTCTGATTAACCCAATTGGGTATCTATTCGACTGTGCAATGT CATGTACACTAGGTCGATTCATGATGAAAAAAAACGCATTGCTCATTGGA AATTTGGCCACGAGTTCGGTCATATTGGGGCATTGCCTCATTTTCTGTGA CTGCCATTGTCGGCTCAATTCGATTTTTGAGAGGAATGCTGTCTCCTTTT TGTCATACTTCTCTCATTTTTAAAAATAGAAACCTTAGTCGTGCAGGAAT GTCGCAACGAGGTCCAGCAGGTCAGGGGCAGCCAACCGTTGTTCCACTGC ATCTTCCATATGTGGCCAACACATTGGTGGATAACGGCATTGCCATGTGG AACAAGCTCCCAGCTAGAGGTCAGCACCATGCAGATGGCTTCGAACCTGG CCAATTTTGTCTTAAAATCGGGCCCTGATTAATCCAATAAATATTTTTCC TCTGTCTCTCGAATGCCCTTTAATGTTATTTTCTGGTTCGCATTTCATGT ATTATTTTTGTATAGTTTCTGAGTTACCCTTTTGAACCCTTATTGTTACC TTTCTGTTGCATTATGGTCCTTTATTGGTGTTGTGTGTGTATTGAATAGT TCCGTTTCTATTTTGTGATGTTTTTGAACCTGTGTTGTAAGATTCGGTTT CTATTGTTTTGGTACATTTTGGTTGTGCTTAATATAAATAATTCCCTAGC ACACTGGAAACTTCTTGTTTACAAAATGCAATTGCCAGTTTCCGGGCATA ATTTACATATTAAATATACATATACGTACATGTACATATATAACATGTAT TTAACATTAGATGAAAGGTAAATACATACGATAACACACTGGGGTGCGAG TTTTTGCAAATATGTCTCATTTTGAGTACCTCAGGCGTTGCTCAGTTAAA CCATGGATTTCATGACATCAGGAGGAATCACTGAATTCGAGGTTACGTGA ATGTCCCTTTTTTGGTAAGCGCCCAAAACAACGAGACTAGAACCCTTACT TACTAGACTTGGTCATGCTGCTCATCTGGCAATATCTAAATTGGCTTCAG GATTAAACTAGCTCACAATCACCATTCCTGGCGCACCAGATGCTACGTAT ATATGGCGTTGGTAGCTGAACACAGCTCACTTTGGAGTCGTCACTGGAGT CAACGTGGATGTGGAAAAGCGGGAGACGAAAACTCAGCTGTTGTTAAGGC CAAACTGGATCTGGAAGGGATTGAACGAACTTATAGAGTGGAGTTGTGTG TCGATAACCGACTTGATTATGTGTTCTTTGACATTGAGTCCATGATGAGA ATCAATATCAAGACAGCACCAGCGTGAAATTCAAATACAAATTAAAAAAC TGATCCATGCTGGAAGGAAACCAGCAGCTGTCCTAATTGTGAGCACAGCT TTGAGTAAAACAGGCTGGCTTAGCCGTTAGCAGTGCGGCAAAAAAGGTGT TTCTTTGCCCAAACATGTCAACTTTTCAGGTGCCAAATGTGGCGTACATA GGTGATGGAAAAGGAAGAAGGTGATACCGTTATTTAAAAACCATGGAATT GCTAAAATCTCCAATCTTGGAGTTCAAAAGCTAACATTGGTGCCAAGAAA TTCTGAGTAGCTATGAGGCAGACTGAATAGACTGAAAATTCAAACGAGGA AGTGGTGTGCTCGCTCATTTCAGAGCCAATTTGGGTTCAAAGAAGGCTTG AAGCCAAAATAGTTTGGGAGCCAAACAACCGGAATCAAGCCAGCCTTGGG GTTGGCTCCCGATGTTAAAAAGGGAGCACATCAGAGAAAAAACAGGATTT CGGAAATTCGCTGAGCGTTTTCCCAAAACACCATAATGTTGTGCTTCTTC ATTTGGAGTTATTCGCCAGATCTTAGTAGCGTACAACATAGAGATACAAT GACATACGCTGTGTTTTGTTTCTTAAGATGGAGAAAGGGAAAAATGCCCT GTTCTAAAAGTGCACTGCAACCGTATTTGATTTAGTGCTAGAAAACGGCG ATACAAATGCGAAAACTTGTAATCCATGTCCGATTTCTTTCTTAAGAAAA CTTGTTTGGGTTGGTAACGCTTCTTTAGGAGTTAACCTTTTTTGTCGCGC TCAAGTCATCATGATGTTGCCTCTGAAGAGGCAACAGCAAGTCAGTTGTG ATGCACCTCACTTTGGTGGCTCAAAAGGGATAGCGGAAATCCGGCGGACA TGGAACATGTCAAGGGATAAGGAAACTTTGGTCATCTAAACTACGAAAGG CAACGTTCACCATCCCTTCTAGCTTTCGGCAACTTAGCATGTTGCAATTC ATAGCTCTGTTGTGATGGTTTTCATCCTGACTAAGGCCGCTCCAGTAGAG GTCTGGCATTTCAAACCGGTTGGAACCGGGCGGAATTTGAAGGAGCCAGT TAGTCCAAAAGCCAAAATCATCAGGCTAGCCCAGGCAGAATTGGCCCATG TTGCGCGTTATTTTTCGCATCGCAGATTCAATTGAAATGGGTTGCCTGGG CGCCACGTAGAAGCCTCGATATCCTCCTATGTCTTTTTATCAAAAAATAC GGCCCCCGACACTCAAATCAGGTCGAATTTGGACTCGGGTGAAACATCTT CTGTTTTTGGCATTGGGTGCAGGCAGTCCGTGTTGGCCCGCGCCAAGTCA GCCCGATCGGGCTAGCTTTGTTGGACCAGGGTGGTGGCTGAGCCAGAAAG AGGCCAAACCGAGCAGTCATGATTACACAACCAGAGAGAAATAACGTCAA TGTCCTAAGATTTAGGCAACGTATGGGAAATGCACGTTTTCAAACAGCTT GAAGCGCCAAATTTATCAATATAACTGTTATGGAATATATAACGCTTATA TATTAATACTCCATGGTCACCAAAATCCATCCCCTTATCTCTAGGGCTCA TCCTCTTGCACTTGCTGAAGTGCACCCAGATTCCTCAGAGTGTGATAGCT GCTCCCTGTGCAGCTCCACCCAATCCACATGAACAATGGAAAGGGCCCAA TAGGGTCCTGGCCCTGTAGGGTAGTGATGGTGTTCTCTCAGTAGTTTATT ACCAGGAGTTCAAGTGGTCAGGTAATTCCCGCAACTTATGAGGCATGTTA GTGAGCTTCAATTGCCCTTTTGAATGACCTCAATGGAGCCCGACCCTCAG TGCTCACACCTATGAATCCCTATTAGGGTCTTCTGTCATGATGAATATGC ATTATGAGAAGATTAACTGGCTGTTTATGGGGATAATTAACTCTTAGGTT TCACTTTTTCCAAATAAACATTCTATGATTGTCTATCTTCCACAGAGCGT TTCATTTGCATTAGAACGCCTAATCGGGAGGTGGCGTGAGCGGAACGCTT CCATGTATCTATAATTCCTTGGTTAAGATCACTACTTTGTGCGGCCGGCA AGGATTTATGTGTCCTTCCCGCCTGGGGCACCGAAAGTGCTGCCGCTGCT CCTTCCAGGCGTCCATTGGCAGGAGAGAAAGAGTGACTAAAGTTCAGTTT GATCCGGCGGATGAAATACCTGTGAAGTCTCGAATCAGCGTCGAAAGTCA GAGTACAAACCAAGCTGGTAAACCCTCAATCATTAGATCCGAAGTAATAG GGCTGTGGGCCGCTGACATCACAGATTTGGCGGGAAACGTATTTTCGAAA AAAATCAGCTGCATGTAGGACAGTCCCTCCAAGTCTATTGTACTGGATCA GGCAAAACCAAGGCAATGCATCATAATCTACCACGTTCCCTAGCTCTAAT GCAGTCACCTATCGATTTAATTAATATTATATGCACATTTGTTTCCTTCC TTTAAATAGAAAGCTGGGTTTCTACAGTAAGTATAGAAATCTTGCTTTCT ATTTTATATTATTATGGTTAGGTAGCTACGTCAAGACGTAGCCGACTTAG TAAAGTTAATTTTCTTCTTTGAAGAAACTACTGTTCTGAAGACTGATTTA TCTTCAAGCCAAACTCCAGTAGGGTGACCAAATTCGCACGGTTGATGCTG GGCTTTGCCTTGGGCTCGGATCATTTTTTGCCGGAGTTCGCCCAATTCCA TCAAGCCACCGGTCCGATGGGAGGAAGCCAGACACACCTCCACAAAGTTA ATTTTCGCACGAAGGAGCTGCTGATCGTAGTTTTGGCGTAGAAGTTGTAA AAAAAGGCCAGGCCATACTGTCCAAGAGTTTTGCATACCTTGGCCAATGC GTTGATGATGATTTGTTTATAAACTAAGGGGACTGATCAGCGGAGGGCCT TGTCCTGGCTAGTGGCTACCCTGATTCCATAGCGACGCTCTGCGGCATCT CCAGTGTCTCTCCGGTCAAACGTGCCACAGCCCTATATATTTCTAGGGGA ACTCATGATTTTGAAATTGACCATCTTCTCCTTAATCGGTGTTCAGACCA AGACTCATTGGCCAAACTAACCGACTTTTCCCATTCAATACTTTCAAAGA CAAATCTTAAGATATCATTTAGATGCTCGCACTCAATAACTTTTACTNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCA TCAAACCATTTGGGACAGTGTCGCCCAGGCGTTGGATTTCAAGGATGGAT GCATCCAAGTACGGGAGGTCGGCACGGTCGGCCAGATCCGGGGTCCGTTC CAGGCCGATGACAGTTTTGATCTCCTCATGGATCTTGGTTTGGACTTCAG GATTGATGATCAAGTACAGCACAGCCCATGAAAGGGTTGAGCTGGTTGTC TCGGACCCGGCAAAGAACAGATCAATCAAGGTCTGAAGAATCATTTCATC TCCATTGGTTTTGCAAAACGATGAATCCACGTCCGTTGTTTTCTCCATCT CCAGAAGGTAAGCGTCGATGAAATCTCTGATATGGTAGGGATCAAAGGTC TTCCTATGCTCTTGCACGACAGAGTCCAAGAAATCCTTGACATTCTGCAT GATCTGGGCATTTTTGTACAAGGGATCAATGTTCGGAAAGATGTCCCGCA ACCAAGGGAAGATCAGGGCAATTGAAGGCTTGATTCCCGCGGCCAGAACG GCCTCATTGACCAATCCAATGATATTTTTCAGATCTTTGTCGTCATAGTC AAATCTTTCACCGGCTATCATTTGCCACAAGATGTTTAACACGGCCGTAT TGAACATATTAATGGTCTTGATTGGCCCGGATTGGTTCGATATTTCAATG TATTCCAGGAAAAAGACAACCTCGTCTTTGATCATGTGTTCCATATCGCT CTTGCCGAAACCGAAATCTTTGAAAGTCGAGAGCATGAACCGCCTTTGCT CGGTCCAAATTCTTCCCACACCTTCAATGATGCCCTCATTGCCATTCTTG CTCCTTCTAAAAAGCTTTGAGAGGGCGACATTCTCTTTGTTGCCTTGTCG GAAGTTGGTGTCTTCAGCCTTGAAGCACTCTTTCAAAAGGTCGAAGGACC CGATGATCACCAGCTTGAAGGGCCCGAGATGAACGGCCATGACCCCATCC TTTGAATACTTGTGAAACAGCTCATCGATGGCCTCAATCCCCGAGTTACG AGTGAAGAGCAAGTAGTGAGAATGACCAAAGAGCGGGAGCCGGGTAGGTG GAGTGGGTGGATAATTGGCCGGAAGTCGAGTCTTGACGTACCACGCCAGG ATGAGAACCACCACCACCAGAGCTATTAATTCCAACATGCTGAGTTGTCG AAAGCTTCAAGGGTGATGGTGAACGTTGCCTCTTGTTGCTTACACTGTGA CAAAAAGGAAAGGCGTGTTAAAAAAACGAGCAAAATTCGACAGCCATAAA GCCCTAATACAATAAATGTTCTAACGCAGTTTTTGCATGGATGAGCCTTC AAGTTGGTCTCCTACTTGGCTCGATCAGCCTCTTCAGAGATAATATGGCC TTTTAGCGCAACTTTTGCCAAAATTGAGAAGCGAGGGAAGTAAGTAGAGA TGGGAATATAACATCACTTTGTTGTCACAGTGATGACCAAAGCCTCCAGT ATGTTGGTCGGAATTCTGCTATCACTTTTAACCCATTAAAGCGAAGAGTA ACGCAACTAGTGCTTCCAGAATCATCGCTGATTTACCTCGTGATTAGGTG ATTAGGCTTAGATGATTAGGTAAGTTAGCGATTGTTGATCATTCTTTAAA AAATTGCAATGATTTGTCGACTATCAAAACGTTGTGAAAAATGGGCTGGA GTTCACAAATCAATTAAAAAACGCTCATAAAAAGAGTATAGGGTAAATGG TGAGCCTCGAAAAAATGATGGACAATGCAAAAAAAAATAAAAACTTTGTA GGCAACCATAAAAAAATTGATGGAAAAAACCAACAGTATTGTACTGCTAT TTTCTGCTTATAGAGGGTATCTTGAAAAAATCATGAAATACCTGGAATTG GATTCATATAATATTTCTTTTTGCCAAAAAGCACAAGCAAAGGGAAAACG CTGACCCGAATAGCCTTCCAAAAAAACCCAATAAATAGGTATAACCTATA TTGAAAGATGAGGTATATCAAAAGAAGCAACAACCGAATATGGAAAAACA TCAAATATGAAAAATATCTAATAAAAACCAAAAGATCATCAAAACAGTTT ATTTTTATTTTTATATCAAAGTTGCATCAGAAATATTGATTGCCGATAAA TTCCTAAATCTTCGACGGTTAGCAAATACCTGTTAGCGAAAATGGAGGCA CTGAACCCAACTGTCTTGCTGTTGGCTCGTCAGAAACACACGATGTTAAA TTGAGTACGACAAAAAAGATTAAAAACACGTAAAAGTTTTTGAAGAAGAA AATTAGACAGGGATTCCACGTTTTCGCATTTGTATCGCCGTTGTCCAGCA TTCAAGGAGAATTTGGTTGTTAATCCTGCGAATTTCCAAAATCTTGCCTT TTTCAAACCTGATCTGAACATTGCAAAACAACCCTGGCTTAATTCCGGTC TGTTTGGCTCCCACCCTAGTTTTGATTCAACCTTTTTTGACCCCAAAATG GCTTCTAACTGAGCGAGTACTTTATAGTTTCAATGTTGACCGCCTCATAG CTACTCAGAATTTTAGGACACCAGTGTTAGCTTTGGAAACTTTAAGGCGA TTTAATGATTTTTCAAATTGTATTTTAACTTTTCCATCGCCTGTTATGCC AGTTTGTCACCAAAAATGATACATTTGACTATAAACCCCCTCTTTCTTGT CGCACTCGAACGATAAAACAAGCCTGGAGTGTATTTTACCCGATGCTACG CTTGCAATTAAGACACATGCTAGATTCGTTCTCACATGGATTAATACGTA TATGAATCAGTCCTTCAATTTCACAATGGTATTGTCCTCATCATGCACTG GATGTCAAAAATCACATAATCAAGTCTGTTATCGACGCACAAATCCACTT TGACTTCGTTCAATCCCTTCCAGATCCAGTTTGAGCTTAACTGCAACTGT GCTTTTGTCTCCTACGTTTCCACATCAGCATTGACTTCAATGACGACTCC AAAATGAGCTACGTTCAGCCACCGCATGGAAGTACTAGAATCACCTGGAG GTCGCAAATAACGAAAAATGGGAACAGGAAGCTCGAAATCTCGAAAACCG TTTATGTGCTCAATTGATGGACTGGAGGTGCGCATGCCATTTTTTAACAC TTCTGCAGGGTTTAAGAGGCCATCAACTAGCCACTCTGAAACCCAACCGA ACTTTGTGAAATGTCCCTGCAACTCCAGCTCGTCAATTGATTGCATTAAC GGCTTTCGAGCTGCCTGAACCATGCCGTCTATGGACCCATTTTTCGTTCT GTGCGACCTCCAGGTGATCCTAGTACTCCATGGCCACGGATAGCACCAGC ACAAGAACCGGATTCACCACTGAAGGAAAGGTTGCGTGAATGATATTCCA TTGAAGGGACACATTCACTGTACTAATGTGCCTGGAAGGAGAGTGTGGCC AATAGGCAGGAGAGAAAAGGCCCGGCCACTTCAGCCCATTTGAGAAGTGT TGCCAGAATCCAAGTTTGCATGTTTTATCTAGCAGATTTCCGGAATTTTA CGAATTGTTCATTTTTGCTCTGGTTTTTGTGTCGGCCCTTCATGAAGGGA GGAAGCTTATTATAGCCCAGTGTCTTACCAAGTTATGGGAAGAAAGCAAA AGTGTATTATGGTACATAAAATTGAAATCACTTAGGGACACTACAATGGA GTTGAGGTTGCTTTCAAACAGACCTGTTGATTGCGCACTCCGTGCAATGG ACCAGAGCGCAGCAACCTACCATTTTCCAACCCCCAACCTTTGTTCCTAA GGTGGTCAACCATTAGTCTGAATGTTGATTGCATCACAACATAGCTTCGT TACCTCTAGAGTTGACCAAAAATAGCAAATGAAAAAGACCCAAATTGGAC AAAAATTACAAAAAACTAGACAAACACTGCATATACAGTGGCAAAAAATA AAACTTAGTGTGCTTTACAGTGATACTTGGATATAACATACAAAATCACA ACTTTTTGTGATTTCGAGCAAGCTTGTAGGAGGATTATTTTTGCTGCATT AGCCGCAGAGGTTTCTGCACTCTTCGGCCACGGGTTGATATTGTCGCCGG AGGGGGTCTTGGGAGTGTTCAAAAGGTTGGAGCAGTGAGACGACGACCAA GTGTCTGGGGGAGGGCTGTGCCTCTAACCAACGCATTAATGACCACTAAC TCTGGCTGTCATTGCTCTGACGCACTAGAGTTCTGAGTTGTGTAAATTAC GCGATAGGTAGTTATCGATCTGATGTTTGATAACTAAACCAGTAACTTTC CAACTCTATAACAACGATCAACTCTTTACTAACAATGCTTATAACAACAC ATACTCGTATGTCCCTAACTGGCCTTTGTGAAAACATGCCTTTTGGCTTA TCTCAGGTCGCGGTGGCCATCCCATTTTTTTCTGATATGCGTCTTTTTTA CGTCACACTATCGTTACCATTTGGATACTCCCAAAGAACAATAAAACAAT CATCACAGATAGGTATATAAAATATATACATGAGAGGGGAGGAGAGGCCA AGGGAGAGTACGAGCAGCAGAGCTGTTGAGTGACCACATATCACTAGAAG ATATTTTGTCCGATTCAGATCGATTCCCGGGCCCAGTGATCAAGACATTT TCGCCACTCAAGACATTCTTGTACTGAGGGGATCTGACAACTTCCTGAAA GGTGATTTTTTTTCTAGTCAGGTTTCTTTCCAATACTCCTCAGAATTTGT TTTTTTCACTGCACGTGAGTCTATGCCCTTTACAGTCAAAATAGCATTTG CTGCAATGCCACGCTTCAGCACTTGTGATTTTCTCTTGTTGGCCGGTGAA ATGTCTAGTGAATACTATATATTCGTATGATAATGCGCGATGGCCCAATA ACTAGAGGTAGAGGTAAATATACCAGTGTATTTAATGACAGAGCACGAGG AGGCAGGGTGACTAGAGAATACATCACAGTATGACTCAGTCATCACTAGG GCTGTAAAAAGCTGGAAAAAACTTTTTGCTGCTTTTTTTCGCTTTTTTGA TGGAAATAATCTTAAATGCTGGAAATAGCCTTAAATGCTGGAAATGATGT GAAATGCTGGAAATAAGTTTTTTTCTGGAAATTTTGGATGATTTCAGTAA ATGACTGACTTAAGATGCTTCAAAATTGGCAAAAAACTTTGATTTCAGTA AATGACTGTCTTAAAATGCTTCAAAATTGACAAAAAACTTAAAATTAGTT GGCGAAGAAAATGGATTCAGGTGAGATTTAATAAAAATTCAGCAGGACTT TTTTGCATAGTTTTACGAAGGTCATCCGGTTCCCACGCTTCTAAAAGTGA CCAAGACCAGGGAGTGCATGTTTTCATTATTTCTTATAATTTGGAGAGAA AACGTACCATTAGTCAAAATTCCACAATTTGTCGAAAATTGTCACTTCCT GAAAATTATGTTTATTCCCATCAGATTCTATGGTTTTTATCACTTGCCTT CAAATATCAATGATTGATATTTTCACACGTAACCGATAATTCGACACGCA GCATCAAGTAAGCAATGAAGATGAACTCAAAGCTGAAGCTAAATATTTTT CGACAAATAGTTAAGTTGTGACTAATGGTACGTTTTCTCACCAAAATATA TATATAAAAAATCGCTAGTTTTGGTCTAATTTAGAAGTGTTGGAACAGGA GTAGCATTAAAGCCAGCTAATAGGTTTTCTTTTTGTTTCGTGGAGCATTG AGTCATTTTGTTATATTAAAAATTCTTCCAATTTTGTCGATTGCATTACA TCTGACAACATTAACAGTATTTGAATCTGCAAATTGATATTTAAATTCGT ACGAAATATAATGAACATTTTTCTTAAACACATGTTTGTGGCAACTTTAT CTGACTTCCTTTGGTACCAAATGGGAAAATGTCCTCTATTGTGGCTTTTT ATCACTTTGAAGCCAATTTTTTGTTGTTTTAGCGATTTGCTTTTCCAATT TTTCAGGTTTTTTTCGCTGTAATTTTGCTTATTTCACTCTTATTTCCTGG TTTTATTTGCTGTAAACGACACTTTTTCTGCTGTTTAAGCGCTTTTTTAC AGCCCTAGTCATCACAGTATCAAATAACGTATGACTATGGATCTTATTTG AATTTTGGGTGCAAAAGCTTTGAAGGCCATGTTGAAGATGAACGAATTTG ATCCTACATTACTGGTTGATAGAAATTGATTTCCGTCACAATCAGGCATG GGCTGTCTGCGTCTCTTTGTAAAGTGAAACGTGTCCCTCCATTGGAAAAT AATTTACGCAACCTTTCCTTCAGTAGTGAATCCGGTTCTTGTGCTGGTCT ACGGAACCCTGTACATCTACGTAGAAGTTTGTTTGTTTGGAAGGCCCTAG GAATGATCAGTATAGTGCAATCACTTCCCAGTTAGAAATCTCCGAAGAGA CATATTCGACCTTAAGACTTTCTGAAAATTGTATTCTAATCCTTGGACCG AGTTCAAGATAGACTTGGTTTGACCCAGTAGGGACAAGACTACCTTAGGG TTCCTGTCCAGGGATATATTGGTGCCGTCGTGAATGATAGCCCACAGATG GTAGGTGGCAGGGCAAACTGTCGCTAGATGACAGGGTGATTCCTCCGTAT TACCGCATAAGCGACAACTTTGGCCAGCCACTTGCCCTGATTTGACTGCG TTAAAGTAGTTCAGGTCACAATGACCAGTGATCCAAGGGATCAGCTGGCC CAGACCCTTCCTACTTAGGTCCAGTATATGCTTGGAAAAATATTGATCTG GATTGCGGATCCAGTACTTAGTCTGGCGGAAGCCGACACTATTGCTCCGT TGAACACTCCATTGAACGCCCCATTTGTGGAAAGTAAAATCCTTAATGGC TGATTTGGTAAAGCTAAATGGTGTGGGAACAAATGGCTTGGGCCTTGAGT TCGCACCAGCTTACTACTACATGCCAAAGATGATGCTTGGACGAGTTTGG GGTGTAAGCGAGAGGACCCGAGAATAACCCTAACCCGTGAAGATGTCTCT GCTAAAAGATTTAGTTTCTCATAACAATTCAGTGTGATTGAAGATGAAGC CGTCTTTCGCTGTAAAGCTAAGAGTGCCGTTTTCCTGCTCACAATAATAT CAACATCCCCGGCACATTTGGACAATAAGCTTTCGGCGATTTTGCCAGTA GCTATAAGGTCCCACTGCCCTGGAGTGGTGAACTGCCCTAAGAAACCAGC TTCGTCTTGGAAGGATCTGTGGCTGTTCGAGATGACAATGGCTGCCACCG TTCTTCCATTTGTGACAACTCCCCCCACAAAACCTACCACGGTGCTATTA TGGGGTTTAATGATGTTGTCAGTTTCTATTACCTTAAATTGCGGTAATAG CCAAGAGGTTGGAATATAATCGGTAGGGATCCCACAGCTAGGTAGTGTCC TGACCTCATCTTTCCAGTAGCGAAGATGACCTTTCCCACTAATACCCAGC CCATCCCATCTTGTGGGCAATGTGCTCTGGATACGGATATAAGTGGTGGT ACTTATCGTGTGTTGCAGGAGGTCGTATGGCTCCATGCCCAACAGGAGTT CCAAACCTTCTGTGGGTGTGCTTCGTTGGAAGCCCACCACTGTTTGAGCT GCGAGCCTGTTCAGTCTCCTCAGCCTTACTTTGTGTCGCGCCTTCAGATG GTGAGCCCAGAGGTGCGCTGCGTAGGTTAGCCCAGTTCAAACAATCCCGG TGTAGGCCCAGCGGGAGAGTTTGGGCATAGGGCCCCACGTCCTTCCGATG CTGTTGGAGACCTGGAAGAGTAGAGCCAAGGCCTTGTTGATTTTGTGATC AATATGTTGCGTCGACGATAACTTCTCATCGAGAATAACACCGAGGTATT TCGTAGACTTTTCATATTTGATCAATTGGGCACCCATTTTTAATCTTGGA GGGAGTAATGGTTTAAGCTTCTTGTGGAACCAAACCGCAATGGTCTTCTT TGGGTGAAAGTTGAGGCCATTTTTTAGTCCCCATTCCAAGGCTATTTTAA TTTTGCCTTGGGCAATCTGACCCAGTTGTCCGGGGTCATGGCCTGTGAAA ATTACTGCATCGTCTGCCAATCCCGTAACTTTTGCCCCGCCACCATTCAA CTTCCTCACTAGGGTATCAAACACCATGTTCCAGGCCAGAGGGGAGATTA TGCCCCCTTGGGGAATTCCTCTTGTAAGAGATTTTGTGGGGAATTCCTCT TGTAAGAGATTTTGTCACCTTCACGCCTTGAAATTCGACCTCAACAGTAC GATTTCGAAGGTAGTTACCATACCACCTGGATATGTTTATGGCAACCCCA TGATTCCCCTCCATAGCCTCGGCCACTTTCGTTGGGTCCATATTGTCGGA GGCTCCTTGGATGTCTAAGAAGATCCGCAGCGCATACTTCTTGTTCAGAG TTGCGTGTTCAATCCCGTCCACCGTCACTGAAAGTGCGGAGTTTGCCTTT CGCACTATTTGGAAGTATTACTCACGATTGTACTTTGCCAGACTTAGGGC CAAACTCAAAAGCGACCCAATTTTTAGAATCGAAATCCAGCATTAAACAG CTGTAACTGGTCTAACTTTCCAATAACGAAAATGAATGTCAGATAATGTT GCTGACTCTGGGAAGCTCTCAGAGATGTCAGGCTGGCCATGTTCAGCCTC TTAATGCTGCATTAGTCGTGATTATCTACATTTGTTACCAATTCTGTGCT GAATAAATATACATTTCCGATTTGAAAATCTGGTCACTTTGACGTTGGCC CTAAGCCTCGACGCATAATTCTTCTGTGTACAGGGTTCCATGCATAAGCA TATTCAAGGCGTGCCCGTGCGTATGTCGGGAAAAAGAGGGCCATTGAAGC GCGCCGGTCATGTGTTAGCCTTGCACCTAATATTTACAATCATGATAGTG AGATTCTGTTAAGGTTATCTCTGCATTTTTTCAATTTAGTGCAGCACTGA TATCCGGTGTTTAGCGAAACGACGTTTGATATCTGAAATGCAGGTAAGCA GCTGCAGTACATTTTTTTCAAAAAGTCGCCTAGGCATCAAATCTGGCAAG TGTAATTCTGTGTGCAAGATTCCATGGCTGGTGCTATCTGTTGTTGAACG CAGATTTTGGAAAAGTAGGGTACTAAAGCCCAGTTGTTGTTAAGTCCAAA CTGGATCTGGAAGGGATTGAACGAAGTCAGAGTGGATTTGTGCGTCGATA ACAGACTTGATTATGTGATCTTTGACATCCAGTGCATGATGAGGACAACA CCATTGTGAAATTCAAGGACTGATTCATATACTAATCCATGTGAGAAGGA ATCTAGCATGTGTCTGAATTGCAAACGTAGCTTTGGGTAAAATACACTCC AGGCTTGTTTTATCGTGTGCGGCAAAAAAGAGGGTTTATATGGCCAAATG TGTCATTTTTGGTGACAAACTGGCATTACAGGCGATGGAAAAGTGAAAAT ATGATTTGAAAAAATCACGATGTCCCCTAAAATCTGCAATTTTAAGAAAG ATTCCAAGGCCAACACAGGTGTCCTAAAATTGTGAGTAGCTATGAGGCGG TAATTTGAAAATTGAAACGATAAAGTGCTGGCTCAGTTGGAAGCCAAATT GGGGTCAAAAGGTTGAAACAAAAGTAGTTTGGGAGCCAAACAAACCGGAA TTCAGCCAAGGATGTTTCGCACTGTTTAGATCAGCAGATGAGGTTTAAAA AAGGCAAGATGTCTGAAATTCGCAGGATTAGCAACCAAATTATCCTTGAA TGATGGACAATGGCGATTCACGTTTGAAAACGTGGAATCCCCGTCAAATT TCCTTCTTCACAAACTTTTTCGTGTTGAAATCGTTTCTTTAGGAGTTTTT AACTTTTTTTGTCGCACTCAATTTATCACCGTGTTGCTTCTGACGAGACA GCAGCAAGTCAGTTGTGTTTATTGCTCCCATTATCGCTAATCGGTATTCA ATAATTATCGAAGATTTAGGAATTTATCAATATTCGATAATTTTGTTGCA ACTTTCGATAATTTCGAGATTACGTGATTGATCTAAAAAAATTAAAACAC TTTATTGACGATCTCTCAGTTTTCATTACATATTTTTTAAATTTTTATGT TTTTCCATTTTCAGTTTTTGCTTCTTGAGATATATCTTATCTTACTGTAT AGGTTACACATATTATATTTGGGGGGTTTGGAAGGCTATTTGCGTCAACG TTTTCTCTTCCCTTGTGCTTTTTGACAAACAGAAATATTATCAATCCAAT CCTAGGAATTTGATGAATTTTTCAAGATAGCCTCTGTAAGTAGATAATAG TAGTAAAATATTGTAAAGATTTTTCACCTTTTTGTAACTTTTTCATGGTT GCTTTCAAAGTTCTATTTATTTTTGCATTTTTCATCATTCTCCGAGGCCT TTTTTTTATTTTTTGAGGTCTCCCATATAGTGAATACTTTTCTTATGAAC GTTTTTTTAATTGATTTGTGAACACCAGCCCATTGTTCACAAATCTTTCA ATGGTCGACAAATCATTGCATTTTTTTTAAGAATGGTCAACAATCGATAA TTTTAATCAGCGATGATTTTGGAAGCACTAGTTGTGTTACTCTTCGCTTT TATGGCTGAAAAGTGATAGCGGAATTCCGACCAACATACTTGAGGCGTTG GTCATCACTCTGACAACAAAGGGATGTTATACAGTATTCCTATATCTACT TACTTCTCTCAATTTTGGCAAAAGTTGCCCAAAAAGGCCATATTGTCTCC GAAGAGGCTGATCAAGCCAATTTGGAGACCAACTTGAAGGCTCATCCATG CAAAAACTACGCTAGAACATTTATAAACAATGAGATGGCTGCCCCTCAAC CGGGTATCGGTGGTGTGTCGTCCATTCCGGCCACCACCACGCCCCAACCG TCGCCCTCTCCGTCCGCCATGAACCTGAGANNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNTTTTCTGGTCGCAAGCTTTTTGTAGTTATCATCTT TTTTAGTTCATCGATGAGCAGTGTATTAGTGTGTTCACGTACTAATTACT GCTATTTGTCCTATTCAACCTATTTTGTGATGTTTGTACTATTTATATTT CGCCAAACATTGTGAGCGATCTTTCATTTCGATCGTATTTTATAAGTAGA CATATCTTAATTATCTTTGTGCTTTCTTGGCACTCAGTTTTTGAGCAAAT TTGCTTCTTCTTGCTTTAAACTGTGATTTTATGTTGTGCTATTTGAAAAG TGGTCCTGTATTTGTTTGAAATTTTATTGTATTCTGCCCTCCCTCCTCCG CTGCCGTGTCTTTGTGTAAAATTTTGTGTTCTCTCCTAGGATCACAGTGA AAACGATAAAAAGAGAAAAAGATAAGTCGAAAGACTTATCTGTGACCCTC GGTGCATCCCATAATTTCTTTTTGCATATGATGAATCTGGGATCTCCGAA ATAAACTAAACTAAACTTGTCATCTAATAAGGGTCTTTGTGGGTGTGATG TCCTGGTGTGGTCACCCCCAATGCTCGTGTCTAGTCATGTCTTCATGCTC CCGTCAGTGATATCACTGACGGGCAGGGACTATATATATCGTGTCCCTCT GGGTATAAAGCATCCAGGCTAGTCACATCGATCTTAGTGACAGACGTCAC AGTGGGATGATGAATTCTATAGTATGAATTAAGTTTCCCCACCTTGTAGG TAGGTAAAAGGCCATGCATTGTCAGGGTCAGCAGAAATAAGAAATGAGTC GACGGATTCCAGACAATGGACTTTGCAATAACCTAACAACCAACATACTG ACCTGCTAGTTAATGAATCAGTTGCCAGATGTTATACGGCCAGAGAGCGG AAAAAAAGGAATTCAATATTATTTTTGTTTTGTGTTTTGCCAATTGTGGT TAAAATCTACGTATTATGCCTTTTTGTCCCATATTTGGTCAAAAAAATGG CATTTACTTCCTGCAGAAAGTTCGATTGTATGTTTGCAGAAAATAATTGT TGCAAGGAAATAACAGAAACAATGGGCTCCTTGAAAACACGTACGTCTCA AGGATCTGTTCCGGTTTTTTTGAGCTCCACTCCACTCACTCCGCCCCGGA GCGGTTTTCGGAGCGAACAGAGCTCGAGCGTAACTTTCCGAGATTGGCCA ACTTCATGAAATTTGAGGTATTTGTTCCTCTATTAGTGTTTTATGTCCAT CTCGGCCGAAAAAAGACTGCATCCTATGTAGACTGTGTGTAATCGGTTTG ATTATTTACAAAATTTAAAGACGACACATTAGCAAGTCTGCTAGTCGTGA CAGGTGGGTAAAAAATTGGCGAATGACTAGATGAGTGCTGCTTTAGCGAT TGTCTTGGCTATTGCAGCCGCAGGTCCCCTCGTGGTTGCTCCCCTCAGCG CTGGGAGCACATTCCACATCCTGGCCGCATGGGTCGCTAACTTGTTGACA GGCTTGCGAAGTGGAGGCAAGACAACCCCCGCTGCTTGGGACCTGGTGGT CGCTGGCGCGGATAAGCCAGCGTCTGGGTGGCAGGGAACACGACTTGGCC GATCGGGTTTCTGCCACCATCCTTCCGGTCGGAGCTGAAGAAGGCCTTCC AAGTCTCGATGACCATGGCCTTGACGGCCAACTCGTTCAAGGAGGGGAGC CGGGCCAAGTGA
back to top
Add to Basket