|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| None | No IPR available | PRINTS | PR00449 | RASTRNSFRMNG | coord: 33..54
score: 51.86
coord: 171..193
score: 48.39
coord: 136..149
score: 50.42
coord: 56..72
score: 32.76
coord: 74..96
score: 52.87 |
| None | No IPR available | SMART | SM00174 | rho_sub_3 | coord: 35..196
e-value: 9.1E-11
score: 18.6 |
| None | No IPR available | SMART | SM00176 | ran_sub_2 | coord: 38..240
e-value: 5.6E-8
score: 42.5 |
| None | No IPR available | SMART | SM00175 | rab_sub_5 | coord: 33..196
e-value: 4.1E-108
score: 375.2 |
| None | No IPR available | SMART | SM00173 | ras_sub_4 | coord: 30..196
e-value: 6.5E-36
score: 135.3 |
| None | No IPR available | GENE3D | 3.40.50.300 | | coord: 26..221
e-value: 1.2E-67
score: 229.2 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 209..239 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 211..239 |
| None | No IPR available | PANTHER | PTHR24073 | FAMILY NOT NAMED | coord: 27..228 |
| None | No IPR available | PANTHER | PTHR24073:SF869 | RAS-RELATED PROTEIN RAB-2B | coord: 27..228 |
| None | No IPR available | PROSITE | PS51419 | RAB | coord: 28..262
score: 36.072 |
| None | No IPR available | CDD | cd01866 | Rab2 | coord: 29..196
e-value: 7.16213E-133
score: 372.141 |
| IPR005225 | Small GTP-binding protein domain | TIGRFAM | TIGR00231 | TIGR00231 | coord: 33..186
e-value: 1.2E-32
score: 110.9 |
| IPR001806 | Small GTPase superfamily | PFAM | PF00071 | Ras | coord: 34..194
e-value: 6.2E-62
score: 207.9 |
| IPR027417 | P-loop containing nucleoside triphosphate hydrolase | SUPERFAMILY | 52540 | P-loop containing nucleoside triphosphate hydrolases | coord: 28..207 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk05805 ID=Tk05805|Name=Tk05805|organism=Tigriopus kingsejongensis|type=polypeptide|length=311bp
LSISQFSILATDRVEEPKATSIPPITMSYAYLFKYIIIGDTGVGKSCLLL
QFTDKRFQPVHDLTIGVEFGARMINIEGKQIKLQIWDTAGQEAFRSITRS
YYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLE
SRRDVKREEGEAFAREHGLIFMETSAKTAANVEEAFINTAREIYDKIQEG
VFDINNEANGIKIGPQHSPANSNMPSGNQGGSSSGQRGRLQTKLVLPGAK
QATRSKATSISCQSTLTWYGKAEKTLELAFIPKTSKKPLTIPKTPKKSIT
TIPKISTKPIA back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|
