|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| None | No IPR available | COILS | Coil | Coil | coord: 422..442 |
| None | No IPR available | PANTHER | PTHR11588:SF248 | TUBULIN ALPHA-2 CHAIN | coord: 2..441 |
| None | No IPR available | PROSITE | PS51257 | PROKAR_LIPOPROTEIN | coord: 1..20
score: 5.0 |
| None | No IPR available | CDD | cd02186 | alpha_tubulin | coord: 2..439
e-value: 0.0
score: 757.07 |
| IPR000217 | Tubulin | PRINTS | PR01161 | TUBULIN | coord: 138..156
score: 68.97
coord: 57..76
score: 54.58
coord: 112..136
score: 52.55
coord: 182..195
score: 62.39
coord: 384..412
score: 56.61
coord: 10..30
score: 58.49
coord: 99..110
score: 57.63
coord: 196..216
score: 51.96
coord: 157..178
score: 38.63 |
| IPR000217 | Tubulin | PANTHER | PTHR11588 | TUBULIN | coord: 2..441 |
| IPR002452 | Alpha tubulin | PRINTS | PR01162 | ALPHATUBULIN | coord: 165..176
score: 54.48
coord: 92..105
score: 63.99
coord: 49..62
score: 34.39
coord: 426..442
score: 78.0
coord: 389..405
score: 79.63
coord: 18..33
score: 68.86
coord: 218..230
score: 53.65
coord: 278..293
score: 52.1
coord: 152..164
score: 57.21
coord: 351..364
score: 65.97
coord: 364..383
score: 51.3
coord: 325..346
score: 79.53
coord: 124..132
score: 79.83 |
| IPR018316 | Tubulin/FtsZ, 2-layer sandwich domain | SMART | SM00865 | Tubulin_C_4 | coord: 252..397
e-value: 8.3E-43
score: 158.2 |
| IPR018316 | Tubulin/FtsZ, 2-layer sandwich domain | PFAM | PF03953 | Tubulin_C | coord: 267..395
e-value: 3.1E-46
score: 156.6 |
| IPR003008 | Tubulin/FtsZ, GTPase domain | SMART | SM00864 | Tubulin_4 | coord: 53..250
e-value: 3.3E-64
score: 229.3 |
| IPR003008 | Tubulin/FtsZ, GTPase domain | PFAM | PF00091 | Tubulin | coord: 3..218
e-value: 1.2E-59
score: 201.7 |
| IPR037103 | Tubulin/FtsZ, C-terminal domain superfamily | GENE3D | 3.30.1330.20 | | coord: 273..387
e-value: 2.9E-56
score: 190.3 |
| IPR023123 | Tubulin, C-terminal | GENE3D | 1.10.287.600 | | coord: 388..440
e-value: 3.4E-32
score: 111.8 |
| IPR036525 | Tubulin/FtsZ, GTPase domain superfamily | GENE3D | 3.40.50.1440 | | coord: 1..272
e-value: 1.2E-113
score: 381.0 |
| IPR036525 | Tubulin/FtsZ, GTPase domain superfamily | SUPERFAMILY | 52490 | Tubulin nucleotide-binding domain-like | coord: 1..248 |
| IPR017975 | Tubulin, conserved site | PROSITE | PS00227 | TUBULIN | coord: 146..152 |
| IPR008280 | Tubulin/FtsZ, C-terminal | SUPERFAMILY | 55307 | Tubulin C-terminal domain-like | coord: 250..439 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk10468 ID=Tk10468|Name=Tk10468|organism=Tigriopus kingsejongensis|type=polypeptide|length=456bp
MRECISVHIGQAGVQMGGSCWELFGLEHGIGPDGNLLADAVESRSLKPDG
SDFSPFYLETKASKYVPRSLFVDLEPTVVDEVRHGPYRNLFHPEMILNSK
EDAANNFARGHYTVGKEMIELTLDRIRKLADGCNGLQGFLVFHSFGGGTG
SGFTALLMERLNAEYPRKSQLDFAIYPAPQVATAVVEPYNSILTTHSTME
HTDCSFLVDNEAIFDICQKKLDIDRPSYVNLNHMIAQVVSSITTSLRFQG
QLNVDLNEFQTNLVPYPRIHFPLVSYAPMVSQEKSRHEFMSVAELTTSCF
ETGYQMVKCDPRQGKYMACCLLYRGDVVPKDVNAAIQSIKTKRAIQFVDW
CPTGFKVGLNQEPMSVVGNCQLAKAPRSVCMISNTTAIAEAWSRLNHKFD
LMYAKRAFVHWYVGEGMEEGEMTEAREDLAALENDYEEVAGEDPGVFDDQ
ALGEEY back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
| Term | Definition |
|---|
| GO:0005874 | microtubule |
Vocabulary: Biological Process
| Term | Definition |
|---|
| GO:0007017 | microtubule-based process |
|
