|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR000494 | Receptor L-domain | PFAM | PF01030 | Recep_L_domain | coord: 71..154
e-value: 7.6E-17
score: 61.4 |
| IPR036941 | Receptor L-domain superfamily | GENE3D | 3.80.20.20 | | coord: 37..155
e-value: 9.0E-43
score: 148.0 |
| None | No IPR available | PANTHER | PTHR24416:SF95 | EPIDERMAL GROWTH FACTOR RECEPTOR | coord: 43..155 |
| None | No IPR available | PANTHER | PTHR24416 | TYROSINE-PROTEIN KINASE RECEPTOR | coord: 43..155 |
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 23..155 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_C_REGION | Signal peptide C-region | coord: 19..22 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_H_REGION | Signal peptide H-region | coord: 8..18 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_N_REGION | Signal peptide N-region | coord: 1..7 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE | Signal Peptide | coord: 1..22 |
| None | No IPR available | SIGNALP_EUK | SignalP-noTM | SignalP-noTM | coord: 1..22
score: 0.771 |
| None | No IPR available | SUPERFAMILY | 52058 | L domain-like | coord: 43..154 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk11083 ID=Tk11083|Name=Tk11083|organism=Tigriopus kingsejongensis|type=polypeptide|length=155bp
MSPPWTRLLYLGLVLGIWPSEAVRTRDVRPEEAEDDKNLRHGKICIGTSG
RMSVPNNREHHYRNLRDRYTNCTYVDGNLELTWLQDENLDLSFLQHIREV
TGYVLISHVDVTRIVLPSLQIIRGRTLFKLSVQEDEFALIVTLSKMHNLE
LPALR back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|
