Metalloproteinase with ShK

General

Date: 

1382047200
Sample

Strain: 

wild type

Tissue: 

Gland

Organism: 

Target description

Target sequence: 

MYTNQIIQRKSTAEHCEMMLLTIIATLLLTFHDVYSSVKHAECRIVYDKFHRQEMASRNF IAGAKWPNNEVPYEISSGYSSSDLDVIKSAMREIESKTCVKWVPRSGQKSFVLINPREDG CFAVLGYNPNRGMHVLNLQRSNGRSTCMIMGIAAHEMLHILGFAHEQTRPDRDQFVQIYW SRIKRDSISNYFRAIDINARERPPVCDPRSTQTSFDNCYSGFKTRTFGLEYDYGSIMHYG LDDFTTTGQDTMRVLRPVPTGIVIGNRKGMTNLDALKVKMRYDCNEDPEKKTTRKPSVEC KDIYRECPLYKNQCKTNQFIKDGCKVSCGECTECYDMYRNCPDMKHLCGELDAITKGCKL TCRLC

Target ID: 

Target name: 

EMLSAG00000009545

Target type: 

RNA
Uploads

Imaging technology: 

immunohistochemistry

Gallery image: 

Image files: