EMLSAG00000000868, EMLSAG00000000868-683634 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000868 vs. C. finmarchicus
Match: gi|592946436|gb|GAXK01012117.1| (TSA: Calanus finmarchicus comp1468303_c1_seq1 transcribed RNA sequence) HSP 1 Score: 31.187 bits (69), Expect = 1.819e-1 Identity = 22/67 (32.84%), Postives = 30/67 (44.78%), Query Frame = 0 Query: 19 WALQCETEYNKNGMPPQFKE-------------WAGQSIGSAWNSALSSLRDYESMIQVCYDEVKDF 72 W QC+ + +N + P F E AGQ+I AW + S+ D+ Q YDEV DF Sbjct: 115 WTNQCDCVFQRNEVYPCFHESTGGRDRSPVPGRGAGQNI--AWGTLRSTKADWTGRAQGWYDEVYDF 309
BLAST of EMLSAG00000000868 vs. C. finmarchicus
Match: gi|592946438|gb|GAXK01012115.1| (TSA: Calanus finmarchicus comp1468303_c0_seq2 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 4.574e+0 Identity = 15/33 (45.45%), Postives = 19/33 (57.58%), Query Frame = 0 Query: 40 AGQSIGSAWNSALSSLRDYESMIQVCYDEVKDF 72 AGQ+I AW + S+ D+ Q YDEV DF Sbjct: 279 AGQNI--AWGTLRSTKADWTGRAQGWYDEVYDF 371
BLAST of EMLSAG00000000868 vs. C. finmarchicus
Match: gi|592934862|gb|GAXK01023691.1| (TSA: Calanus finmarchicus comp115661_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 8.639e+0 Identity = 14/32 (43.75%), Postives = 20/32 (62.50%), Query Frame = 0 Query: 34 PQFKEWAGQSIGSAWNSALSSLRDYESMIQVC 65 PQFKE+ S+ AW S + LR +++IQ C Sbjct: 940 PQFKEF---SLWLAWLSTTAFLRGTDALIQTC 1026
BLAST of EMLSAG00000000868 vs. L. salmonis peptides
Match: EMLSAP00000000868 (pep:novel supercontig:LSalAtl2s:LSalAtl2s114:333629:338073:-1 gene:EMLSAG00000000868 transcript:EMLSAT00000000868 description:"snap_masked-LSalAtl2s114-processed-gene-3.3") HSP 1 Score: 161.77 bits (408), Expect = 4.791e-53 Identity = 76/76 (100.00%), Postives = 76/76 (100.00%), Query Frame = 0 Query: 1 MLRMCNSNPDVICLDLAKWALQCETEYNKNGMPPQFKEWAGQSIGSAWNSALSSLRDYESMIQVCYDEVKDFPQKT 76 MLRMCNSNPDVICLDLAKWALQCETEYNKNGMPPQFKEWAGQSIGSAWNSALSSLRDYESMIQVCYDEVKDFPQKT Sbjct: 1 MLRMCNSNPDVICLDLAKWALQCETEYNKNGMPPQFKEWAGQSIGSAWNSALSSLRDYESMIQVCYDEVKDFPQKT 76
BLAST of EMLSAG00000000868 vs. L. salmonis peptides
Match: EMLSAP00000000864 (pep:novel supercontig:LSalAtl2s:LSalAtl2s114:109666:110192:-1 gene:EMLSAG00000000864 transcript:EMLSAT00000000864 description:"snap_masked-LSalAtl2s114-processed-gene-1.2") HSP 1 Score: 78.1814 bits (191), Expect = 1.267e-19 Identity = 37/72 (51.39%), Postives = 46/72 (63.89%), Query Frame = 0 Query: 4 MCNSNPDVICLDLAKWALQCETEYNKNGMPPQFKEWAGQSIGSAWNSALSSLRDYESMIQVCYDEVKDFPQK 75 M N N V L +W LQC+ ++ N + PQF W GQ+I S+WNS +S R YE+MIQ YDEVKDFP K Sbjct: 1 MNNFNLFVTSHILIRWTLQCQRGHDNNRLTPQFDVWVGQNIASSWNSVKTSSRHYETMIQGWYDEVKDFPSK 72
BLAST of EMLSAG00000000868 vs. L. salmonis peptides
Match: EMLSAP00000000866 (pep:novel supercontig:LSalAtl2s:LSalAtl2s114:123519:124869:1 gene:EMLSAG00000000866 transcript:EMLSAT00000000866 description:"maker-LSalAtl2s114-augustus-gene-1.6") HSP 1 Score: 68.9366 bits (167), Expect = 1.826e-15 Identity = 39/57 (68.42%), Postives = 45/57 (78.95%), Query Frame = 0 Query: 19 WALQCETEYNKNGMPPQFKEWAGQSIGSAWNSALSSLRDYESMIQVCYDEVKDFPQK 75 WALQC T ++KN + PQ+ EW GQ+I SAW+SA SS RDYESMIQ YDEVKDFP K Sbjct: 207 WALQCRTGHDKNRITPQYNEWVGQNIASAWSSAKSSSRDYESMIQGWYDEVKDFPPK 263
BLAST of EMLSAG00000000868 vs. L. salmonis peptides
Match: EMLSAP00000011068 (pep:novel supercontig:LSalAtl2s:LSalAtl2s747:71658:81234:-1 gene:EMLSAG00000011068 transcript:EMLSAT00000011068 description:"maker-LSalAtl2s747-augustus-gene-0.5") HSP 1 Score: 65.0846 bits (157), Expect = 1.105e-13 Identity = 32/60 (53.33%), Postives = 40/60 (66.67%), Query Frame = 0 Query: 19 WALQCETEYNKNGMPPQFKE---WAGQSIGSAWNSALSSLRDYESMIQVCYDEVKDFPQK 75 WALQC ++KN + P+F W GQ++ SAW+S S RDYE MI+ YDEVKDFP K Sbjct: 258 WALQCPKGHDKNRITPEFSGENMWVGQNMASAWSSVKSMNRDYEGMIKGWYDEVKDFPAK 317 HSP 2 Score: 60.4622 bits (145), Expect = 3.537e-12 Identity = 30/70 (42.86%), Postives = 42/70 (60.00%), Query Frame = 0 Query: 10 DVICLDLAKWALQCETEYNKNGMPPQFKE----WAGQSIGSAWNSALSSLRDYESMIQVCYDEVKDFPQK 75 D + L WALQC ++KN + P+F + W GQ++ W+S SS R+YE MI+ Y+EV DFP K Sbjct: 597 DNLALSAQMWALQCPNAHDKNRLTPEFHDHPYVWVGQNLAFLWSSVKSSNRNYEDMIKGWYNEVSDFPSK 666 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000868 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000868 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 3
BLAST of EMLSAG00000000868 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 4
BLAST of EMLSAG00000000868 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000868 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000868 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000868 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s114:333629..338073- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000868-683634 ID=EMLSAG00000000868-683634|Name=EMLSAG00000000868|organism=Lepeophtheirus salmonis|type=gene|length=4445bp|location=Sequence derived from alignment at LSalAtl2s114:333629..338073- (Lepeophtheirus salmonis)back to top Add to Basket
|