EMLSAG00000001098, EMLSAG00000001098-683864 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001098 vs. C. finmarchicus
Match: gi|592761525|gb|GAXK01192888.1| (TSA: Calanus finmarchicus comp1374665_c0_seq1 transcribed RNA sequence) HSP 1 Score: 29.6462 bits (65), Expect = 9.747e-1 Identity = 15/49 (30.61%), Postives = 23/49 (46.94%), Query Frame = 0 Query: 44 LKPLLCHIGRLFWVIVRKIHYM-AHFLCPILRKGDCLQKRPEYMGPSIL 91 L+P + +G W +VR H R G CL+ R ++GP +L Sbjct: 122 LRPFVLGVGEGLWAVVRGSGVKHCHLN*EAGRGGCCLRARDGHLGPQVL 268
BLAST of EMLSAG00000001098 vs. C. finmarchicus
Match: gi|592922783|gb|GAXK01035606.1| (TSA: Calanus finmarchicus comp617244_c0_seq7 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 2.962e+0 Identity = 17/40 (42.50%), Postives = 21/40 (52.50%), Query Frame = 0 Query: 5 RQYKELIQMCYQAYPHLKKKKGLRSRDLLGHS-ITLICFY 43 R Y LIQ +A HLK +K S DL+ S I + C Y Sbjct: 479 RAYLALIQNSMEAMQHLKVQKSSISTDLISKSPIAVTCHY 598
BLAST of EMLSAG00000001098 vs. C. finmarchicus
Match: gi|592879862|gb|GAXK01078039.1| (TSA: Calanus finmarchicus comp3137442_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 3.774e+0 Identity = 9/29 (31.03%), Postives = 18/29 (62.07%), Query Frame = 0 Query: 13 MCYQAYPHLKKKKGLRSRDLLGHSITLIC 41 +C+ + PH+ +GL +++ HS+ L C Sbjct: 2 LCFPSLPHISHSQGLTQLNIVPHSLVLCC 88
BLAST of EMLSAG00000001098 vs. C. finmarchicus
Match: gi|592911537|gb|GAXK01046838.1| (TSA: Calanus finmarchicus comp139385_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 4.034e+0 Identity = 20/68 (29.41%), Postives = 35/68 (51.47%), Query Frame = 0 Query: 24 KKGLRSRDLLGHSITLICFYLKPLLCHIGRLFWVIVRKIHYMAHFLCPILRKGDCLQKRPEYMGPSIL 91 +G+RS DL L+ + LC + + V+++ + H+LC IL+ G+CL +GP +L Sbjct: 226 SRGIRSLDL----DQLVTLHRGNCLC-VSPICSVLLKSCPKLEHYLC-ILKAGECLHCDLSILGPDLL 411
BLAST of EMLSAG00000001098 vs. C. finmarchicus
Match: gi|592853720|gb|GAXK01103824.1| (TSA: Calanus finmarchicus comp166360_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 4.497e+0 Identity = 11/32 (34.38%), Postives = 19/32 (59.38%), Query Frame = 0 Query: 34 GHSITLICFYLKPLLCHIGRLFWVIVRKIHYM 65 + L CF + + C IG+L WV+V +H++ Sbjct: 144 NFQVMLNCFIFEKV-CDIGQLVWVLVNAVHFL 236
BLAST of EMLSAG00000001098 vs. C. finmarchicus
Match: gi|592755754|gb|GAXK01198659.1| (TSA: Calanus finmarchicus comp5295567_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 4.949e+0 Identity = 12/42 (28.57%), Postives = 20/42 (47.62%), Query Frame = 0 Query: 15 YQAYPHLKKKKGLRSRDLLGHSITLICFYLKPLLCHIGRLFW 56 + +P L K+G + + + CF+L P L +G FW Sbjct: 143 WGFFPGLTSKRGYEKK--ITKTAWFFCFFLHPFLEILGNFFW 262
BLAST of EMLSAG00000001098 vs. C. finmarchicus
Match: gi|592922787|gb|GAXK01035602.1| (TSA: Calanus finmarchicus comp617244_c0_seq3 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 7.100e+0 Identity = 17/40 (42.50%), Postives = 21/40 (52.50%), Query Frame = 0 Query: 5 RQYKELIQMCYQAYPHLKKKKGLRSRDLLGHS-ITLICFY 43 R Y LIQ +A HLK +K S DL+ S I + C Y Sbjct: 971 RAYLALIQNSMEAMQHLKVQKSSISTDLISKSPIAVTCHY 1090
BLAST of EMLSAG00000001098 vs. C. finmarchicus
Match: gi|592922789|gb|GAXK01035600.1| (TSA: Calanus finmarchicus comp617244_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 7.142e+0 Identity = 17/40 (42.50%), Postives = 21/40 (52.50%), Query Frame = 0 Query: 5 RQYKELIQMCYQAYPHLKKKKGLRSRDLLGHS-ITLICFY 43 R Y LIQ +A HLK +K S DL+ S I + C Y Sbjct: 1066 RAYLALIQNSMEAMQHLKVQKSSISTDLISKSPIAVTCHY 1185
BLAST of EMLSAG00000001098 vs. C. finmarchicus
Match: gi|592865812|gb|GAXK01091750.1| (TSA: Calanus finmarchicus comp4232516_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 7.188e+0 Identity = 16/65 (24.62%), Postives = 28/65 (43.08%), Query Frame = 0 Query: 12 QMCYQAYPHLKKKKGLRSRDLLGHSITLICFYLKPLLCHIGRLF-----WVIVRKIHYMAHFLCP 71 +C Y H++ + + + + LIC + LLCH RL +++ I +HF P Sbjct: 25 AICLNRYTHVRSNHNSSTHNEMNLAGILICIVIVFLLCHFPRLIINCAEFLMTNNIVSCSHFTPP 219
BLAST of EMLSAG00000001098 vs. C. finmarchicus
Match: gi|592848948|gb|GAXK01108596.1| (TSA: Calanus finmarchicus comp4118668_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 9.210e+0 Identity = 14/22 (63.64%), Postives = 15/22 (68.18%), Query Frame = 0 Query: 19 PHLKKKKGLRSRDLLGHSITLI 40 P K KGLRS DL GHS+ LI Sbjct: 159 P*TK*SKGLRSGDLAGHSLPLI 224
BLAST of EMLSAG00000001098 vs. L. salmonis peptides
Match: EMLSAP00000001098 (pep:novel supercontig:LSalAtl2s:LSalAtl2s117:967861:968875:-1 gene:EMLSAG00000001098 transcript:EMLSAT00000001098 description:"snap-LSalAtl2s117-processed-gene-9.44") HSP 1 Score: 194.126 bits (492), Expect = 3.718e-65 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 0 Query: 1 MYKERQYKELIQMCYQAYPHLKKKKGLRSRDLLGHSITLICFYLKPLLCHIGRLFWVIVRKIHYMAHFLCPILRKGDCLQKRPEYMGPSILPSMR 95 MYKERQYKELIQMCYQAYPHLKKKKGLRSRDLLGHSITLICFYLKPLLCHIGRLFWVIVRKIHYMAHFLCPILRKGDCLQKRPEYMGPSILPSMR Sbjct: 1 MYKERQYKELIQMCYQAYPHLKKKKGLRSRDLLGHSITLICFYLKPLLCHIGRLFWVIVRKIHYMAHFLCPILRKGDCLQKRPEYMGPSILPSMR 95 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001098 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000001098 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 10
BLAST of EMLSAG00000001098 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000001098 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000001098 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000001098 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000001098 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s117:967861..968875- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001098-683864 ID=EMLSAG00000001098-683864|Name=EMLSAG00000001098|organism=Lepeophtheirus salmonis|type=gene|length=1015bp|location=Sequence derived from alignment at LSalAtl2s117:967861..968875- (Lepeophtheirus salmonis)back to top Add to Basket
|