EMLSAG00000007200, EMLSAG00000007200-689966 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000007200 vs. C. finmarchicus
Match: gi|592775133|gb|GAXK01179435.1| (TSA: Calanus finmarchicus comp290197_c1_seq2 transcribed RNA sequence) HSP 1 Score: 39.6614 bits (91), Expect = 4.631e-4 Identity = 23/53 (43.40%), Postives = 32/53 (60.38%), Query Frame = 0 Query: 14 NSSNDEAKVFLTLSPLASVSLLGYTDKRRLVLNWKSPKNIMITDDWIGLFSHD 66 N S+ +VFLT++ A V G +KRRL LNW +P + DD++GLF D Sbjct: 1338 NFSSPGLQVFLTVNSKARVFWDGTVEKRRLELNWVTPPDRQ-DDDYVGLFRDD 1493
BLAST of EMLSAG00000007200 vs. C. finmarchicus
Match: gi|592775134|gb|GAXK01179434.1| (TSA: Calanus finmarchicus comp290197_c1_seq1 transcribed RNA sequence) HSP 1 Score: 38.1206 bits (87), Expect = 1.486e-3 Identity = 23/60 (38.33%), Postives = 34/60 (56.67%), Query Frame = 0 Query: 14 NSSNDEAKVFLTLSPLASVSLLGYTDKRRLVLNWKSPKNIMITDDWIGLFSHDRIGNETS 73 N S +VFLT++ LA V G +KRRL LNW SP++ D++ L+ D + N + Sbjct: 1317 NFSAPSLEVFLTINSLARVLWDGTFEKRRLELNWVSPQD-REDGDYVALYHDDPLHNNQT 1493
BLAST of EMLSAG00000007200 vs. C. finmarchicus
Match: gi|592854057|gb|GAXK01103487.1| (TSA: Calanus finmarchicus comp60044_c2_seq4 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.748e+0 Identity = 12/35 (34.29%), Postives = 22/35 (62.86%), Query Frame = 0 Query: 4 VTPLDTSCYRNSSNDEAKVFLTLSPLASVSLLGYT 38 +TP +++ SN + F+ +SP++S+ LLGY Sbjct: 1119 LTPFNSAFSMACSNIRSSFFINISPISSLILLGYV 1223
BLAST of EMLSAG00000007200 vs. L. salmonis peptides
Match: EMLSAP00000007200 (pep:novel supercontig:LSalAtl2s:LSalAtl2s404:397564:398489:-1 gene:EMLSAG00000007200 transcript:EMLSAT00000007200 description:"maker-LSalAtl2s404-snap-gene-4.41") HSP 1 Score: 154.836 bits (390), Expect = 2.614e-50 Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 0 Query: 1 MTLVTPLDTSCYRNSSNDEAKVFLTLSPLASVSLLGYTDKRRLVLNWKSPKNIMITDDWIGLFSHDRIGNETSRK 75 MTLVTPLDTSCYRNSSNDEAKVFLTLSPLASVSLLGYTDKRRLVLNWKSPKNIMITDDWIGLFSHDRIGNETSRK Sbjct: 1 MTLVTPLDTSCYRNSSNDEAKVFLTLSPLASVSLLGYTDKRRLVLNWKSPKNIMITDDWIGLFSHDRIGNETSRK 75
BLAST of EMLSAG00000007200 vs. Select Arthropod Genomes
Match: EFX90339.1 (hypothetical protein DAPPUDRAFT_220083 [Daphnia pulex]) HSP 1 Score: 48.521 bits (114), Expect = 1.438e-7 Identity = 23/55 (41.82%), Postives = 31/55 (56.36%), Query Frame = 0 Query: 18 DEAKVFLTLSPLASVSLLGYTDKRRLVLNWKSPKNIMITDDWIGLFSHDRIGNET 72 + +VFLTLSPLA G + +R++ LNW + DWIGL+ HD N T Sbjct: 29 ESPRVFLTLSPLAKSLPGGNSQQRQIELNWHGNGAVSQPGDWIGLYEHDPTNNPT 83
BLAST of EMLSAG00000007200 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold275_size226830-snap-gene-1.27 (protein:Tk00641 transcript:maker-scaffold275_size226830-snap-gene-1.27-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_220083") HSP 1 Score: 46.9802 bits (110), Expect = 3.588e-8 Identity = 23/45 (51.11%), Postives = 31/45 (68.89%), Query Frame = 0 Query: 22 VFLTLSPLASVSLLGYTDKRRLVLNWKSPKNIMITDDWIGLFSHD 66 VFLT+S LAS + G +D R++ LNW +P+ TDDW+GLF D Sbjct: 59 VFLTVSSLASSGMFGGSDSRKIELNW-TPRPGASTDDWVGLFRTD 102 The following BLAST results are available for this feature:
BLAST of EMLSAG00000007200 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000007200 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 3
BLAST of EMLSAG00000007200 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000007200 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000007200 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 1
BLAST of EMLSAG00000007200 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000007200 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s404:397564..398489- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000007200-689966 ID=EMLSAG00000007200-689966|Name=EMLSAG00000007200|organism=Lepeophtheirus salmonis|type=gene|length=926bp|location=Sequence derived from alignment at LSalAtl2s404:397564..398489- (Lepeophtheirus salmonis)back to top Add to Basket
|